--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:49:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplW/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.25 -422.90
2 -416.28 -419.88
--------------------------------------
TOTAL -416.27 -422.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897713 0.094207 0.377027 1.535445 0.860498 1501.00 1501.00 1.000
r(A<->C){all} 0.170244 0.019748 0.000041 0.455582 0.138017 227.42 248.97 1.000
r(A<->G){all} 0.160051 0.019068 0.000084 0.457143 0.124902 334.40 348.06 1.000
r(A<->T){all} 0.165224 0.019026 0.000168 0.442449 0.128910 158.95 236.40 1.000
r(C<->G){all} 0.177775 0.021568 0.000072 0.466881 0.142002 212.69 230.71 1.001
r(C<->T){all} 0.156353 0.018470 0.000049 0.435127 0.117947 175.13 201.90 1.015
r(G<->T){all} 0.170354 0.020406 0.000085 0.460001 0.135683 209.91 269.95 1.001
pi(A){all} 0.256115 0.000628 0.208723 0.307644 0.255011 1140.96 1231.89 1.000
pi(C){all} 0.266936 0.000635 0.217559 0.315424 0.266463 1184.57 1238.71 1.000
pi(G){all} 0.266465 0.000661 0.215753 0.316809 0.266090 1320.34 1342.95 1.000
pi(T){all} 0.210484 0.000558 0.165585 0.257112 0.209314 1071.33 1128.97 1.000
alpha{1,2} 0.418777 0.224414 0.000281 1.404044 0.249937 1019.83 1156.00 1.000
alpha{3} 0.450721 0.230578 0.000365 1.464957 0.296121 1020.72 1115.91 1.000
pinvar{all} 0.994617 0.000041 0.981693 0.999999 0.996660 1286.24 1314.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -390.639687
Model 2: PositiveSelection -390.639637
Model 0: one-ratio -390.639692
Model 7: beta -390.639717
Model 8: beta&w>1 -390.639598
Model 0 vs 1 1.0000000088439265E-5
Model 2 vs 1 9.999999997489795E-5
Model 8 vs 7 2.380000000812288E-4
>C1
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C2
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C3
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C4
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C5
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C6
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
C1 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C2 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C3 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C4 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C5 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C6 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
**************************************************
C1 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C2 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C3 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C4 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C5 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C6 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
**************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3000]--->[3000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C2 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C3 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C4 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C5 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C6 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
**************************************************
C1 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C2 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C3 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C4 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C5 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C6 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
**************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C2 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C3 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C4 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C5 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C6 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
**************************************************
C1 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C2 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C3 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C4 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C5 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C6 GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
**************************************************
C1 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C2 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C3 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C4 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C5 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C6 ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
**************************************************
C1 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C2 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C3 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C4 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C5 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C6 TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
**************************************************
C1 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C2 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C3 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C4 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C5 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C6 GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
**************************************************
C1 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C2 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C3 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C4 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C5 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C6 TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
**************************************************
>C1
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C2
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C3
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C4
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C5
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C6
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C1
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C2
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C3
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C4
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C5
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
>C6
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 300 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790899
Setting output file names to "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1006042561
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0522985363
Seed = 824132891
Swapseed = 1579790899
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -671.414345 -- -24.965149
Chain 2 -- -671.414281 -- -24.965149
Chain 3 -- -671.414384 -- -24.965149
Chain 4 -- -671.414345 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -671.414345 -- -24.965149
Chain 2 -- -671.414345 -- -24.965149
Chain 3 -- -671.414384 -- -24.965149
Chain 4 -- -671.414384 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-671.414] (-671.414) (-671.414) (-671.414) * [-671.414] (-671.414) (-671.414) (-671.414)
500 -- [-427.527] (-424.619) (-426.962) (-424.221) * (-424.114) (-427.836) (-421.259) [-423.143] -- 0:00:00
1000 -- (-427.976) (-431.628) [-426.996] (-428.020) * (-431.520) (-424.321) (-425.415) [-425.854] -- 0:00:00
1500 -- (-424.209) (-426.386) (-423.527) [-425.490] * (-425.136) [-423.907] (-426.394) (-428.037) -- 0:00:00
2000 -- [-424.064] (-423.994) (-423.217) (-431.584) * (-426.600) (-430.391) (-421.154) [-426.203] -- 0:00:00
2500 -- [-422.691] (-419.549) (-428.569) (-424.660) * (-421.222) (-423.495) (-425.605) [-428.967] -- 0:00:00
3000 -- (-426.529) (-424.153) (-430.760) [-427.139] * (-431.820) [-432.181] (-434.932) (-428.529) -- 0:00:00
3500 -- (-429.888) [-425.634] (-425.199) (-432.058) * (-426.609) (-425.448) (-437.692) [-425.170] -- 0:00:00
4000 -- (-432.015) [-425.820] (-430.366) (-429.144) * [-420.849] (-428.772) (-429.521) (-428.417) -- 0:00:00
4500 -- (-427.153) [-427.739] (-422.600) (-425.219) * (-428.845) [-429.268] (-424.494) (-431.036) -- 0:00:00
5000 -- (-425.537) (-425.907) [-420.441] (-426.449) * (-427.102) [-424.813] (-429.555) (-423.441) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- [-431.888] (-426.910) (-424.076) (-424.994) * (-426.219) (-425.301) [-425.284] (-425.541) -- 0:00:00
6000 -- (-424.125) [-426.960] (-426.837) (-425.120) * [-421.654] (-431.437) (-425.762) (-426.064) -- 0:00:00
6500 -- (-424.869) [-424.390] (-421.357) (-429.791) * (-427.449) (-427.685) (-426.298) [-430.789] -- 0:00:00
7000 -- (-425.528) [-422.709] (-424.019) (-430.541) * (-429.621) (-425.469) [-426.496] (-431.407) -- 0:00:00
7500 -- [-433.408] (-425.788) (-430.811) (-427.312) * (-427.636) [-421.310] (-430.160) (-426.360) -- 0:00:00
8000 -- (-425.905) [-427.185] (-424.131) (-417.820) * [-424.717] (-429.463) (-420.717) (-424.197) -- 0:00:00
8500 -- (-437.610) (-429.843) [-425.381] (-416.696) * (-424.040) [-423.448] (-424.390) (-427.776) -- 0:00:00
9000 -- (-430.489) (-429.013) (-423.401) [-416.058] * (-431.640) (-427.334) (-421.118) [-424.378] -- 0:00:00
9500 -- (-433.632) (-424.318) (-428.745) [-416.941] * (-422.742) (-430.140) [-425.619] (-426.207) -- 0:01:44
10000 -- (-437.270) (-422.226) [-423.801] (-415.864) * (-438.060) (-425.694) (-425.794) [-416.009] -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-436.680) (-429.870) [-426.770] (-415.882) * (-428.317) (-426.935) (-422.134) [-415.427] -- 0:01:34
11000 -- (-425.498) [-422.307] (-425.756) (-415.894) * (-430.045) (-425.284) (-430.080) [-418.541] -- 0:01:29
11500 -- (-433.906) (-426.404) (-429.855) [-415.460] * (-422.542) (-426.669) (-441.137) [-418.104] -- 0:01:25
12000 -- (-424.571) [-425.537] (-431.142) (-415.826) * (-425.021) (-424.414) [-425.346] (-416.589) -- 0:01:22
12500 -- [-421.141] (-425.615) (-430.644) (-416.382) * (-425.535) (-428.276) (-430.234) [-416.028] -- 0:01:19
13000 -- (-425.796) [-422.760] (-425.108) (-426.204) * [-431.340] (-421.755) (-422.035) (-416.605) -- 0:01:15
13500 -- (-429.284) (-423.841) (-423.867) [-421.570] * (-421.224) [-420.712] (-427.953) (-418.609) -- 0:01:13
14000 -- (-433.167) (-427.089) (-424.662) [-415.532] * (-422.545) [-428.189] (-425.060) (-417.175) -- 0:01:10
14500 -- (-433.469) (-432.397) (-428.903) [-418.438] * [-424.922] (-423.696) (-420.554) (-416.277) -- 0:01:07
15000 -- [-415.792] (-437.119) (-431.204) (-416.322) * (-426.526) (-428.480) [-421.956] (-417.047) -- 0:01:05
Average standard deviation of split frequencies: 0.072184
15500 -- (-415.413) [-420.438] (-445.351) (-416.537) * (-425.629) (-429.541) (-424.957) [-415.609] -- 0:01:03
16000 -- [-415.887] (-423.686) (-429.775) (-417.634) * (-429.283) (-421.255) (-435.386) [-417.190] -- 0:01:01
16500 -- [-416.211] (-423.955) (-421.173) (-417.739) * (-427.918) [-422.067] (-428.468) (-415.945) -- 0:00:59
17000 -- (-416.781) [-426.576] (-423.361) (-416.563) * (-429.054) (-423.194) (-416.294) [-417.710] -- 0:00:57
17500 -- (-418.927) [-418.709] (-419.982) (-414.952) * (-436.882) [-425.005] (-415.700) (-417.764) -- 0:00:56
18000 -- (-418.230) (-416.685) (-419.017) [-416.863] * [-419.320] (-426.872) (-416.774) (-417.111) -- 0:00:54
18500 -- [-422.102] (-421.084) (-416.677) (-415.837) * [-416.220] (-421.213) (-415.526) (-417.050) -- 0:00:53
19000 -- [-415.364] (-416.442) (-415.861) (-416.925) * (-415.527) (-429.243) [-416.863] (-418.201) -- 0:00:51
19500 -- (-415.408) [-415.088] (-416.242) (-418.207) * (-416.336) [-427.015] (-415.120) (-416.797) -- 0:00:50
20000 -- (-415.599) (-420.369) (-416.374) [-420.054] * (-416.035) (-429.988) [-416.085] (-419.532) -- 0:00:49
Average standard deviation of split frequencies: 0.060026
20500 -- [-416.855] (-416.946) (-419.383) (-416.078) * [-417.332] (-428.540) (-415.740) (-417.223) -- 0:00:47
21000 -- [-417.624] (-417.235) (-417.529) (-415.794) * (-417.797) (-429.317) [-416.083] (-415.671) -- 0:00:46
21500 -- (-425.732) [-416.473] (-417.945) (-417.287) * (-417.287) (-424.022) (-417.860) [-415.503] -- 0:00:45
22000 -- (-417.565) [-417.596] (-419.607) (-418.788) * (-419.111) (-427.526) (-416.078) [-417.255] -- 0:00:44
22500 -- (-416.677) [-419.131] (-421.400) (-421.357) * (-419.674) (-434.310) (-418.284) [-417.191] -- 0:00:43
23000 -- (-417.407) [-419.533] (-417.886) (-415.812) * (-419.625) [-425.002] (-415.954) (-415.581) -- 0:00:42
23500 -- (-416.730) (-415.526) (-415.218) [-417.118] * (-417.058) (-423.630) (-414.897) [-419.181] -- 0:00:41
24000 -- [-416.139] (-415.622) (-415.368) (-419.542) * (-417.812) (-432.387) [-416.810] (-417.346) -- 0:00:40
24500 -- [-416.975] (-415.624) (-417.570) (-416.602) * (-415.366) [-421.620] (-418.999) (-415.177) -- 0:00:39
25000 -- (-415.952) (-416.573) [-416.724] (-417.066) * [-418.738] (-427.380) (-417.829) (-416.359) -- 0:00:39
Average standard deviation of split frequencies: 0.043679
25500 -- (-419.439) [-416.080] (-415.842) (-416.997) * (-415.578) (-426.996) (-415.809) [-417.515] -- 0:00:38
26000 -- (-417.698) (-416.833) (-420.857) [-417.239] * (-419.242) [-414.796] (-418.322) (-416.556) -- 0:00:37
26500 -- (-414.935) [-415.579] (-419.333) (-415.438) * (-417.155) (-417.472) [-415.710] (-416.061) -- 0:01:13
27000 -- (-417.834) [-416.271] (-417.770) (-417.074) * (-419.391) (-415.462) (-417.090) [-418.752] -- 0:01:12
27500 -- (-415.595) [-416.078] (-419.830) (-416.277) * (-416.651) [-417.462] (-415.767) (-423.003) -- 0:01:10
28000 -- [-421.452] (-415.594) (-416.939) (-415.998) * (-416.170) (-418.894) [-416.144] (-421.100) -- 0:01:09
28500 -- (-418.399) (-421.783) (-418.614) [-415.360] * (-415.760) [-417.868] (-416.406) (-417.943) -- 0:01:08
29000 -- (-421.557) (-419.219) [-415.698] (-415.807) * [-416.046] (-422.231) (-416.012) (-415.451) -- 0:01:06
29500 -- (-417.210) (-417.980) (-415.133) [-416.821] * [-415.424] (-415.876) (-415.286) (-416.942) -- 0:01:05
30000 -- (-417.774) [-416.180] (-414.599) (-419.625) * (-415.494) (-417.089) (-415.864) [-417.778] -- 0:01:04
Average standard deviation of split frequencies: 0.041724
30500 -- (-414.671) (-416.094) (-420.302) [-417.707] * (-415.836) (-415.463) (-416.719) [-415.250] -- 0:01:03
31000 -- (-417.681) (-416.092) (-416.556) [-418.452] * (-414.805) (-417.707) (-419.037) [-418.528] -- 0:01:02
31500 -- [-414.885] (-422.881) (-416.503) (-415.790) * [-414.722] (-420.826) (-417.783) (-416.909) -- 0:01:01
32000 -- [-416.433] (-417.887) (-416.899) (-416.331) * (-416.315) [-414.705] (-419.616) (-417.865) -- 0:01:00
32500 -- [-417.284] (-418.498) (-417.677) (-419.018) * (-415.543) [-420.815] (-417.317) (-415.980) -- 0:00:59
33000 -- (-417.636) [-414.827] (-417.621) (-417.740) * [-414.902] (-416.822) (-416.860) (-419.405) -- 0:00:58
33500 -- (-418.198) [-416.843] (-418.555) (-416.208) * (-417.362) [-417.225] (-420.031) (-416.087) -- 0:00:57
34000 -- (-416.418) [-416.709] (-417.660) (-415.380) * (-417.063) (-425.036) (-418.064) [-415.696] -- 0:00:56
34500 -- (-422.324) (-418.011) (-415.819) [-416.944] * [-417.134] (-418.897) (-416.327) (-416.517) -- 0:00:55
35000 -- (-416.329) [-415.568] (-416.855) (-416.944) * (-418.231) (-418.800) (-417.537) [-416.868] -- 0:00:55
Average standard deviation of split frequencies: 0.039879
35500 -- (-415.431) (-416.547) [-417.076] (-418.833) * (-416.645) (-418.291) (-417.590) [-415.971] -- 0:00:54
36000 -- (-416.546) (-415.330) [-418.148] (-416.581) * [-416.911] (-417.503) (-416.338) (-415.865) -- 0:00:53
36500 -- (-415.220) (-416.648) (-416.052) [-418.875] * (-419.639) (-414.964) [-415.443] (-415.810) -- 0:00:52
37000 -- [-415.616] (-417.895) (-416.347) (-422.247) * [-415.947] (-416.479) (-417.220) (-416.685) -- 0:00:52
37500 -- [-418.796] (-419.365) (-414.709) (-418.184) * [-416.992] (-417.193) (-415.713) (-417.610) -- 0:00:51
38000 -- (-418.823) [-414.716] (-415.955) (-419.759) * [-415.831] (-419.585) (-415.179) (-418.137) -- 0:00:50
38500 -- (-416.329) (-414.839) (-418.541) [-416.817] * (-417.498) (-426.485) [-418.534] (-415.181) -- 0:00:49
39000 -- [-415.385] (-415.604) (-417.400) (-416.167) * [-415.468] (-417.240) (-416.461) (-417.266) -- 0:00:49
39500 -- (-416.492) [-415.994] (-415.331) (-418.132) * (-420.064) (-415.994) (-415.829) [-415.520] -- 0:00:48
40000 -- (-415.338) [-418.354] (-416.723) (-418.572) * [-416.077] (-416.347) (-415.513) (-416.780) -- 0:00:48
Average standard deviation of split frequencies: 0.043056
40500 -- (-417.029) [-417.205] (-418.320) (-416.836) * (-417.984) [-416.951] (-421.209) (-417.983) -- 0:00:47
41000 -- (-416.404) [-417.117] (-417.724) (-420.875) * (-416.008) (-418.361) (-417.999) [-416.832] -- 0:00:46
41500 -- (-416.226) (-418.615) (-419.673) [-417.634] * (-415.994) (-416.237) [-418.944] (-417.530) -- 0:00:46
42000 -- (-415.406) (-417.425) [-415.887] (-415.790) * (-420.151) (-416.668) (-416.962) [-418.885] -- 0:00:45
42500 -- (-416.301) [-416.978] (-419.323) (-416.814) * (-416.383) (-417.884) (-414.795) [-414.856] -- 0:00:45
43000 -- (-416.595) [-418.552] (-418.229) (-418.919) * (-417.864) (-418.115) (-417.994) [-417.733] -- 0:00:44
43500 -- (-418.256) [-416.629] (-421.712) (-416.259) * (-416.897) [-418.305] (-416.331) (-416.417) -- 0:00:43
44000 -- (-416.487) (-416.901) [-416.223] (-415.408) * (-416.918) [-417.673] (-416.331) (-415.891) -- 0:01:05
44500 -- (-420.949) (-416.722) [-416.425] (-418.227) * (-420.860) (-416.100) [-417.917] (-418.672) -- 0:01:04
45000 -- (-417.017) [-417.151] (-415.391) (-418.726) * (-418.035) [-418.326] (-415.968) (-421.307) -- 0:01:03
Average standard deviation of split frequencies: 0.038552
45500 -- (-420.436) [-415.753] (-416.863) (-415.665) * (-417.358) [-416.287] (-416.190) (-419.967) -- 0:01:02
46000 -- (-417.118) (-421.120) (-416.112) [-415.811] * (-420.749) [-415.270] (-416.976) (-418.581) -- 0:01:02
46500 -- (-417.614) [-416.364] (-417.546) (-416.420) * (-417.685) [-418.899] (-416.290) (-417.642) -- 0:01:01
47000 -- (-415.264) (-416.564) (-418.021) [-415.893] * (-415.941) (-415.571) [-420.565] (-416.985) -- 0:01:00
47500 -- (-418.216) [-415.476] (-416.948) (-417.604) * (-415.913) (-416.295) (-417.804) [-418.727] -- 0:01:00
48000 -- (-417.663) [-415.455] (-419.766) (-416.473) * [-416.989] (-416.750) (-419.013) (-418.978) -- 0:00:59
48500 -- (-415.406) (-417.115) (-416.636) [-418.131] * (-417.207) (-416.563) (-419.891) [-418.688] -- 0:00:58
49000 -- (-417.070) (-416.939) (-418.451) [-416.514] * (-417.967) (-419.816) [-418.788] (-416.093) -- 0:00:58
49500 -- [-420.013] (-416.730) (-417.267) (-416.522) * (-418.541) [-416.549] (-416.234) (-416.799) -- 0:00:57
50000 -- (-418.450) (-416.431) (-417.621) [-415.431] * (-416.642) (-417.655) (-416.900) [-415.198] -- 0:00:57
Average standard deviation of split frequencies: 0.028355
50500 -- [-415.592] (-417.665) (-416.326) (-416.000) * (-416.386) (-417.603) (-418.868) [-416.485] -- 0:00:56
51000 -- (-417.419) [-417.843] (-416.104) (-415.024) * (-418.117) [-419.062] (-416.614) (-416.025) -- 0:00:55
51500 -- (-416.048) (-417.576) [-415.558] (-414.642) * (-419.901) (-419.115) [-417.208] (-418.403) -- 0:00:55
52000 -- (-418.562) [-419.903] (-416.203) (-415.281) * (-420.288) (-416.310) (-415.797) [-415.240] -- 0:00:54
52500 -- (-425.355) (-420.238) (-417.296) [-416.903] * (-417.444) [-419.443] (-416.269) (-420.123) -- 0:00:54
53000 -- (-422.027) (-417.236) [-415.801] (-422.921) * (-417.382) (-415.423) [-417.759] (-418.786) -- 0:00:53
53500 -- (-416.119) (-415.590) (-414.859) [-421.473] * (-417.040) (-416.879) (-415.385) [-415.187] -- 0:00:53
54000 -- [-417.046] (-418.626) (-415.780) (-421.881) * [-415.457] (-416.226) (-416.911) (-420.460) -- 0:00:52
54500 -- (-415.052) [-415.319] (-416.464) (-415.321) * [-414.830] (-419.995) (-418.845) (-418.494) -- 0:00:52
55000 -- [-414.875] (-416.305) (-415.991) (-415.686) * (-418.030) [-415.853] (-416.120) (-418.962) -- 0:00:51
Average standard deviation of split frequencies: 0.029884
55500 -- [-415.678] (-417.302) (-420.523) (-416.409) * [-416.859] (-414.881) (-416.462) (-416.299) -- 0:00:51
56000 -- (-416.118) (-416.144) (-418.685) [-416.834] * [-415.262] (-414.810) (-420.363) (-416.571) -- 0:00:50
56500 -- [-417.975] (-416.035) (-417.033) (-416.574) * (-416.180) (-416.592) (-421.388) [-416.344] -- 0:00:50
57000 -- (-420.054) (-420.293) [-418.827] (-415.631) * (-418.795) (-419.078) [-418.036] (-418.780) -- 0:00:49
57500 -- (-418.127) [-415.211] (-415.072) (-415.785) * (-417.759) (-417.435) (-418.660) [-415.734] -- 0:00:49
58000 -- [-417.860] (-417.480) (-418.001) (-417.257) * (-418.238) (-415.889) [-416.152] (-416.058) -- 0:00:48
58500 -- [-417.643] (-420.761) (-416.885) (-416.508) * (-415.251) (-416.243) [-419.246] (-419.004) -- 0:00:48
59000 -- (-417.400) (-415.263) (-422.574) [-415.770] * (-417.879) [-417.367] (-416.092) (-415.764) -- 0:00:47
59500 -- (-415.629) (-414.830) [-418.429] (-419.190) * (-416.689) (-418.210) (-415.951) [-416.869] -- 0:00:47
60000 -- [-417.939] (-414.906) (-415.573) (-415.525) * (-418.488) [-416.430] (-416.989) (-417.335) -- 0:00:47
Average standard deviation of split frequencies: 0.028862
60500 -- [-417.999] (-415.802) (-416.338) (-417.039) * [-417.416] (-415.017) (-417.378) (-415.929) -- 0:01:02
61000 -- (-416.223) [-418.239] (-416.931) (-416.013) * [-417.118] (-414.996) (-417.206) (-416.028) -- 0:01:01
61500 -- [-416.718] (-417.510) (-417.943) (-417.214) * (-416.408) (-416.195) [-415.751] (-417.275) -- 0:01:01
62000 -- (-415.548) [-417.087] (-416.612) (-418.634) * (-416.201) [-416.735] (-416.367) (-417.106) -- 0:01:00
62500 -- (-419.423) (-416.628) [-414.985] (-417.678) * (-416.261) (-416.833) [-415.704] (-415.316) -- 0:01:00
63000 -- (-419.006) [-417.644] (-417.667) (-416.783) * [-416.151] (-419.733) (-419.225) (-415.789) -- 0:00:59
63500 -- (-418.337) (-415.464) (-415.990) [-415.466] * (-418.275) (-420.821) (-419.193) [-416.035] -- 0:00:58
64000 -- [-416.838] (-415.250) (-415.989) (-415.829) * (-417.915) [-418.349] (-416.383) (-422.318) -- 0:00:58
64500 -- [-415.294] (-416.089) (-416.672) (-418.912) * (-426.184) (-416.850) (-415.626) [-418.112] -- 0:00:58
65000 -- (-415.436) (-415.130) [-420.603] (-418.477) * (-419.177) (-417.512) (-417.879) [-416.131] -- 0:00:57
Average standard deviation of split frequencies: 0.023601
65500 -- (-417.639) (-416.400) (-416.775) [-416.661] * (-414.920) [-416.074] (-414.809) (-420.006) -- 0:00:57
66000 -- (-416.847) (-416.197) (-416.979) [-415.022] * (-420.556) (-416.665) (-415.394) [-417.526] -- 0:00:56
66500 -- [-415.713] (-416.135) (-421.095) (-418.736) * (-415.852) (-416.626) (-416.545) [-418.221] -- 0:00:56
67000 -- (-415.676) (-416.393) (-419.221) [-419.493] * (-416.298) (-416.568) [-414.632] (-416.927) -- 0:00:55
67500 -- [-418.500] (-417.016) (-418.323) (-418.132) * (-418.121) [-417.792] (-414.766) (-415.458) -- 0:00:55
68000 -- (-418.686) [-416.262] (-420.123) (-416.831) * [-415.676] (-420.910) (-417.590) (-416.420) -- 0:00:54
68500 -- (-417.064) (-415.232) (-417.370) [-418.434] * [-417.815] (-420.688) (-416.361) (-416.613) -- 0:00:54
69000 -- (-421.054) (-418.262) (-416.103) [-417.005] * [-416.228] (-418.274) (-415.666) (-417.074) -- 0:00:53
69500 -- [-420.065] (-415.519) (-416.532) (-417.952) * [-418.690] (-416.501) (-417.278) (-416.763) -- 0:00:53
70000 -- (-418.371) [-420.437] (-415.968) (-416.106) * (-418.368) (-417.800) (-418.943) [-417.566] -- 0:00:53
Average standard deviation of split frequencies: 0.022821
70500 -- (-420.138) (-416.879) (-415.448) [-416.838] * (-417.345) (-417.917) [-416.908] (-420.622) -- 0:00:52
71000 -- [-416.079] (-420.337) (-417.024) (-416.566) * [-417.521] (-416.682) (-417.861) (-416.432) -- 0:00:52
71500 -- [-417.414] (-420.606) (-416.166) (-415.173) * [-416.533] (-418.627) (-418.990) (-418.263) -- 0:00:51
72000 -- (-418.647) [-416.624] (-415.539) (-415.180) * (-417.119) (-419.781) (-416.827) [-416.866] -- 0:00:51
72500 -- [-415.249] (-416.275) (-414.918) (-415.651) * [-416.771] (-418.928) (-415.623) (-417.635) -- 0:00:51
73000 -- [-415.652] (-416.878) (-416.856) (-415.816) * [-415.974] (-416.268) (-417.197) (-415.811) -- 0:00:50
73500 -- [-418.145] (-416.948) (-417.108) (-416.716) * (-415.450) (-418.055) [-418.762] (-415.667) -- 0:00:50
74000 -- (-417.152) [-415.765] (-415.754) (-416.559) * (-416.225) (-417.411) (-416.951) [-415.575] -- 0:00:50
74500 -- [-416.553] (-417.646) (-417.260) (-415.341) * [-414.993] (-416.951) (-425.834) (-419.384) -- 0:00:49
75000 -- (-417.593) (-415.559) [-416.355] (-416.601) * (-417.859) [-416.469] (-417.849) (-418.669) -- 0:00:49
Average standard deviation of split frequencies: 0.029773
75500 -- [-414.791] (-417.340) (-416.785) (-416.232) * (-421.096) (-416.991) [-417.343] (-416.402) -- 0:00:48
76000 -- (-416.873) (-416.178) (-416.301) [-415.145] * (-416.310) (-417.718) [-416.385] (-416.584) -- 0:00:48
76500 -- (-414.996) (-417.449) [-415.875] (-418.349) * (-415.338) [-415.850] (-419.633) (-416.047) -- 0:00:48
77000 -- [-416.128] (-417.018) (-417.723) (-416.568) * [-416.408] (-419.512) (-415.819) (-416.869) -- 0:00:47
77500 -- (-414.834) (-416.709) (-418.881) [-416.103] * (-418.401) [-414.926] (-417.254) (-418.004) -- 0:00:47
78000 -- (-417.577) (-419.518) (-419.021) [-415.628] * (-418.140) (-415.374) (-418.284) [-420.019] -- 0:00:59
78500 -- (-416.882) [-418.323] (-419.611) (-415.156) * (-416.530) (-416.713) [-418.230] (-421.008) -- 0:00:58
79000 -- (-417.462) (-416.472) [-418.025] (-423.632) * (-419.038) [-416.166] (-417.673) (-417.848) -- 0:00:58
79500 -- (-417.322) [-416.030] (-419.080) (-420.905) * (-416.397) [-415.776] (-416.161) (-417.507) -- 0:00:57
80000 -- [-417.076] (-415.638) (-415.280) (-420.482) * [-414.668] (-417.963) (-418.700) (-417.612) -- 0:00:57
Average standard deviation of split frequencies: 0.032559
80500 -- (-418.883) [-415.691] (-415.802) (-416.082) * (-415.688) [-415.945] (-416.519) (-419.978) -- 0:00:57
81000 -- (-416.146) (-416.432) (-416.869) [-416.369] * (-418.116) [-416.096] (-417.456) (-418.335) -- 0:00:56
81500 -- (-417.480) (-415.510) [-416.226] (-419.502) * (-417.407) [-415.830] (-419.212) (-416.547) -- 0:00:56
82000 -- (-416.643) (-417.905) (-415.291) [-417.941] * [-424.610] (-417.654) (-416.791) (-415.748) -- 0:00:55
82500 -- (-416.892) (-414.954) (-417.780) [-415.879] * (-415.902) (-419.292) (-415.392) [-417.132] -- 0:00:55
83000 -- (-415.336) [-416.855] (-415.753) (-415.298) * [-415.105] (-421.183) (-414.942) (-422.586) -- 0:00:55
83500 -- (-417.311) [-418.594] (-416.754) (-414.797) * (-415.589) (-415.525) (-419.268) [-419.284] -- 0:00:54
84000 -- [-415.468] (-418.599) (-417.004) (-416.981) * (-418.317) (-418.464) [-416.692] (-415.975) -- 0:00:54
84500 -- [-417.698] (-417.821) (-418.233) (-416.153) * (-415.210) (-415.451) (-416.167) [-414.819] -- 0:00:54
85000 -- (-421.190) (-416.167) (-419.823) [-418.031] * [-418.188] (-416.364) (-418.201) (-418.829) -- 0:00:53
Average standard deviation of split frequencies: 0.030982
85500 -- [-416.630] (-414.683) (-416.066) (-416.525) * (-416.330) (-418.621) [-417.631] (-416.736) -- 0:00:53
86000 -- (-417.646) (-415.402) [-415.079] (-417.096) * (-420.730) (-415.580) [-416.051] (-419.951) -- 0:00:53
86500 -- (-417.604) (-430.048) (-415.205) [-415.554] * (-419.660) [-415.617] (-420.984) (-416.363) -- 0:00:52
87000 -- [-417.706] (-419.348) (-416.015) (-415.429) * (-420.109) [-416.674] (-418.009) (-417.717) -- 0:00:52
87500 -- (-417.861) (-417.093) (-415.654) [-415.050] * (-418.651) (-417.550) [-417.594] (-418.939) -- 0:00:52
88000 -- (-416.806) (-420.057) (-415.860) [-416.413] * [-415.113] (-417.169) (-417.812) (-419.576) -- 0:00:51
88500 -- [-417.095] (-416.742) (-416.019) (-415.799) * (-415.081) (-419.128) [-416.317] (-418.055) -- 0:00:51
89000 -- (-417.201) [-416.910] (-414.712) (-417.752) * (-416.547) (-419.848) [-416.801] (-417.451) -- 0:00:51
89500 -- [-417.188] (-416.759) (-419.009) (-416.526) * (-416.476) [-421.792] (-416.692) (-417.464) -- 0:00:50
90000 -- (-421.081) (-418.151) [-415.757] (-416.371) * (-416.058) [-419.128] (-417.632) (-420.278) -- 0:00:50
Average standard deviation of split frequencies: 0.029613
90500 -- (-417.783) (-419.854) (-422.303) [-415.169] * (-415.558) [-421.841] (-417.501) (-416.696) -- 0:00:50
91000 -- (-417.074) (-416.250) (-420.504) [-416.406] * (-418.254) (-417.263) [-414.994] (-415.393) -- 0:00:49
91500 -- (-417.664) (-415.987) (-425.261) [-415.072] * (-418.843) (-417.112) [-420.240] (-416.594) -- 0:00:49
92000 -- (-415.756) (-420.474) (-416.286) [-416.949] * [-415.731] (-418.530) (-421.007) (-418.668) -- 0:00:49
92500 -- (-417.525) (-418.624) [-416.716] (-416.495) * (-416.781) (-417.118) (-420.522) [-416.890] -- 0:00:49
93000 -- (-419.760) (-414.688) (-416.849) [-418.894] * (-415.441) (-418.427) (-416.537) [-417.020] -- 0:00:48
93500 -- (-416.391) (-419.001) [-416.394] (-415.265) * (-418.399) (-422.124) (-416.097) [-415.984] -- 0:00:58
94000 -- (-416.247) (-418.754) (-416.117) [-416.609] * (-415.517) [-418.803] (-418.499) (-415.606) -- 0:00:57
94500 -- (-421.568) [-416.718] (-416.065) (-417.671) * (-417.707) (-419.645) (-417.179) [-414.978] -- 0:00:57
95000 -- (-424.283) [-415.045] (-420.170) (-416.872) * [-415.596] (-420.245) (-417.941) (-417.093) -- 0:00:57
Average standard deviation of split frequencies: 0.026657
95500 -- (-416.241) (-417.943) [-415.631] (-415.984) * (-419.774) [-420.457] (-416.568) (-417.205) -- 0:00:56
96000 -- (-417.989) (-417.258) (-419.680) [-416.001] * [-415.720] (-416.086) (-416.731) (-417.415) -- 0:00:56
96500 -- [-417.891] (-417.832) (-420.249) (-419.096) * (-420.586) (-418.251) (-418.209) [-415.258] -- 0:00:56
97000 -- (-415.644) [-415.403] (-420.491) (-421.013) * (-420.478) (-419.550) [-420.342] (-416.605) -- 0:00:55
97500 -- [-415.229] (-415.458) (-416.477) (-417.630) * (-417.125) (-416.277) [-417.465] (-415.915) -- 0:00:55
98000 -- (-416.977) (-415.246) (-418.607) [-417.046] * (-417.982) (-417.114) [-417.955] (-420.140) -- 0:00:55
98500 -- (-416.164) (-416.144) [-416.814] (-415.040) * [-416.338] (-417.768) (-415.812) (-415.640) -- 0:00:54
99000 -- [-414.974] (-416.419) (-419.824) (-417.177) * (-416.473) (-415.780) [-415.252] (-415.423) -- 0:00:54
99500 -- (-418.408) [-418.017] (-417.475) (-421.167) * (-417.585) (-417.727) (-416.797) [-418.009] -- 0:00:54
100000 -- (-418.270) (-416.703) [-415.166] (-417.664) * (-416.725) (-418.312) (-416.464) [-415.536] -- 0:00:54
Average standard deviation of split frequencies: 0.029199
100500 -- (-417.761) (-418.694) [-416.981] (-423.221) * (-416.857) [-415.555] (-415.945) (-417.085) -- 0:00:53
101000 -- (-416.249) [-415.967] (-416.034) (-417.174) * (-417.776) (-415.608) [-417.209] (-416.269) -- 0:00:53
101500 -- (-416.819) (-416.247) [-416.905] (-419.783) * (-415.862) (-416.415) (-415.983) [-415.628] -- 0:00:53
102000 -- (-416.849) (-419.511) (-415.043) [-415.101] * [-417.530] (-416.025) (-418.007) (-417.609) -- 0:00:52
102500 -- (-416.233) (-416.206) [-418.883] (-418.898) * (-416.596) (-415.620) [-421.485] (-426.062) -- 0:00:52
103000 -- (-419.105) (-418.385) (-418.200) [-420.594] * (-416.023) (-417.061) (-417.666) [-419.406] -- 0:00:52
103500 -- (-418.895) (-415.878) (-418.294) [-417.903] * [-416.211] (-423.321) (-417.866) (-417.456) -- 0:00:51
104000 -- (-417.692) (-415.521) [-415.737] (-417.760) * (-415.275) [-415.131] (-415.326) (-417.447) -- 0:00:51
104500 -- [-418.570] (-417.102) (-420.964) (-415.898) * (-417.816) [-415.756] (-415.384) (-418.907) -- 0:00:51
105000 -- [-414.843] (-415.823) (-416.559) (-418.104) * [-416.661] (-418.170) (-415.899) (-420.161) -- 0:00:51
Average standard deviation of split frequencies: 0.025413
105500 -- [-417.508] (-416.403) (-416.494) (-416.730) * (-420.112) (-423.681) (-416.816) [-415.790] -- 0:00:50
106000 -- (-416.202) (-419.000) [-418.164] (-418.819) * (-418.231) (-421.371) [-416.650] (-417.281) -- 0:00:50
106500 -- [-416.511] (-416.739) (-416.944) (-417.805) * (-416.952) (-417.835) (-415.843) [-415.805] -- 0:00:50
107000 -- (-417.322) (-419.101) [-418.702] (-415.150) * (-419.405) (-415.018) (-415.531) [-415.957] -- 0:00:50
107500 -- (-417.067) (-417.227) [-417.065] (-415.341) * (-422.234) (-418.887) (-416.166) [-415.516] -- 0:00:49
108000 -- (-422.935) (-415.709) (-416.460) [-415.833] * [-417.277] (-417.242) (-417.661) (-415.503) -- 0:00:49
108500 -- (-416.681) (-416.412) [-417.676] (-417.652) * (-417.672) [-417.032] (-417.771) (-415.100) -- 0:00:49
109000 -- [-419.055] (-416.191) (-416.878) (-415.104) * (-418.749) [-420.973] (-419.316) (-416.110) -- 0:00:57
109500 -- (-417.972) [-417.436] (-416.311) (-420.339) * (-421.405) [-420.004] (-418.394) (-416.890) -- 0:00:56
110000 -- (-420.495) [-418.308] (-415.598) (-418.866) * [-415.017] (-416.611) (-416.900) (-416.411) -- 0:00:56
Average standard deviation of split frequencies: 0.028248
110500 -- [-419.998] (-416.105) (-418.661) (-416.004) * [-417.167] (-416.082) (-418.578) (-415.415) -- 0:00:56
111000 -- (-418.893) (-417.300) (-418.231) [-418.177] * (-417.215) (-420.558) [-416.620] (-417.931) -- 0:00:56
111500 -- (-416.998) (-417.126) [-417.458] (-418.971) * (-420.823) (-418.558) [-418.415] (-417.720) -- 0:00:55
112000 -- (-418.914) (-416.317) (-415.400) [-416.383] * (-418.826) [-417.916] (-415.626) (-415.051) -- 0:00:55
112500 -- (-415.749) (-415.271) (-417.821) [-417.136] * (-418.106) [-415.388] (-415.874) (-415.137) -- 0:00:55
113000 -- (-419.303) (-414.901) [-416.724] (-419.578) * (-421.693) (-416.404) [-417.321] (-415.888) -- 0:00:54
113500 -- (-417.243) [-414.831] (-417.976) (-415.422) * [-415.494] (-417.325) (-418.557) (-415.869) -- 0:00:54
114000 -- (-416.165) (-416.350) (-415.262) [-416.758] * [-415.320] (-420.424) (-416.337) (-415.440) -- 0:00:54
114500 -- (-414.785) [-416.937] (-416.814) (-420.439) * (-416.292) (-415.478) (-417.047) [-417.269] -- 0:00:54
115000 -- (-416.174) (-417.859) (-422.164) [-421.499] * (-415.879) (-417.488) [-417.276] (-416.186) -- 0:00:53
Average standard deviation of split frequencies: 0.027995
115500 -- (-418.337) (-421.985) [-416.504] (-422.046) * (-416.962) (-418.843) (-419.340) [-417.361] -- 0:00:53
116000 -- [-415.479] (-419.116) (-415.676) (-415.793) * (-415.448) (-418.644) (-419.858) [-416.931] -- 0:00:53
116500 -- [-415.016] (-419.147) (-416.384) (-418.630) * (-416.424) (-415.220) (-418.266) [-416.120] -- 0:00:53
117000 -- (-415.751) (-421.867) (-416.070) [-415.377] * (-416.744) (-417.910) (-415.438) [-416.447] -- 0:00:52
117500 -- (-415.195) [-416.514] (-418.927) (-416.130) * (-419.335) [-415.503] (-417.888) (-416.731) -- 0:00:52
118000 -- (-417.945) (-417.735) (-418.074) [-415.699] * [-415.589] (-415.005) (-415.416) (-418.868) -- 0:00:52
118500 -- [-416.574] (-423.961) (-418.701) (-418.748) * (-416.244) (-420.503) [-416.246] (-416.242) -- 0:00:52
119000 -- (-416.607) (-419.049) (-415.665) [-415.547] * (-417.684) (-419.408) [-416.000] (-416.165) -- 0:00:51
119500 -- (-418.603) [-417.546] (-416.295) (-416.401) * (-421.071) [-415.262] (-416.177) (-416.568) -- 0:00:51
120000 -- (-418.901) (-416.607) [-416.849] (-416.144) * (-418.757) (-416.202) [-416.516] (-415.795) -- 0:00:51
Average standard deviation of split frequencies: 0.025882
120500 -- [-416.669] (-415.511) (-418.520) (-417.247) * (-419.473) (-417.920) [-415.002] (-415.817) -- 0:00:51
121000 -- [-416.239] (-414.700) (-421.894) (-417.244) * [-416.837] (-417.436) (-416.393) (-417.464) -- 0:00:50
121500 -- [-417.277] (-418.112) (-420.590) (-416.201) * [-421.050] (-416.540) (-417.203) (-416.472) -- 0:00:50
122000 -- (-419.658) (-418.806) (-420.090) [-417.667] * (-419.812) (-417.494) [-416.780] (-418.944) -- 0:00:50
122500 -- (-417.175) (-416.366) (-416.546) [-415.550] * [-420.071] (-418.216) (-417.216) (-418.079) -- 0:00:57
123000 -- [-415.479] (-415.048) (-415.187) (-415.332) * [-417.978] (-417.164) (-416.968) (-418.053) -- 0:00:57
123500 -- [-415.907] (-416.750) (-417.481) (-414.657) * (-415.443) [-419.166] (-415.478) (-416.636) -- 0:00:56
124000 -- [-416.843] (-417.612) (-416.043) (-417.199) * (-422.474) (-416.691) [-414.810] (-416.794) -- 0:00:56
124500 -- (-416.896) (-415.971) (-415.596) [-415.294] * [-418.559] (-419.909) (-420.797) (-415.247) -- 0:00:56
125000 -- [-417.132] (-417.043) (-416.239) (-415.048) * (-416.384) (-416.623) [-417.041] (-415.033) -- 0:00:56
Average standard deviation of split frequencies: 0.025150
125500 -- [-415.994] (-414.737) (-416.921) (-417.543) * (-422.838) (-420.585) (-415.305) [-416.341] -- 0:00:55
126000 -- [-417.569] (-419.212) (-418.106) (-416.540) * [-417.294] (-417.228) (-416.955) (-415.878) -- 0:00:55
126500 -- (-418.483) [-417.380] (-415.248) (-421.343) * (-416.863) [-418.283] (-415.321) (-421.271) -- 0:00:55
127000 -- (-416.669) (-415.873) [-417.821] (-417.580) * (-415.884) (-419.302) (-417.554) [-417.136] -- 0:00:54
127500 -- (-419.576) [-415.750] (-420.913) (-418.196) * (-418.688) [-415.214] (-419.760) (-416.703) -- 0:00:54
128000 -- (-415.516) [-415.299] (-418.268) (-417.250) * [-416.445] (-416.538) (-417.822) (-416.910) -- 0:00:54
128500 -- (-422.981) (-415.917) (-416.738) [-416.444] * (-420.189) (-415.547) (-418.990) [-417.998] -- 0:00:54
129000 -- (-417.227) (-418.405) (-415.422) [-415.909] * (-418.624) [-417.508] (-415.994) (-416.582) -- 0:00:54
129500 -- (-416.654) [-416.737] (-419.626) (-415.179) * (-420.487) (-417.532) [-415.130] (-416.005) -- 0:00:53
130000 -- (-422.138) (-417.040) (-416.305) [-418.265] * (-416.894) (-416.935) (-415.883) [-416.391] -- 0:00:53
Average standard deviation of split frequencies: 0.023250
130500 -- (-416.727) (-416.881) [-415.146] (-416.026) * (-416.608) (-417.579) [-415.069] (-416.246) -- 0:00:53
131000 -- (-415.773) [-417.328] (-417.864) (-416.509) * (-415.630) (-416.943) [-415.986] (-416.643) -- 0:00:53
131500 -- (-418.775) [-416.963] (-416.172) (-416.258) * (-418.330) (-420.252) (-416.931) [-416.758] -- 0:00:52
132000 -- (-415.530) [-415.966] (-415.997) (-416.667) * [-419.919] (-424.325) (-419.219) (-416.780) -- 0:00:52
132500 -- [-416.176] (-415.872) (-418.793) (-416.749) * (-420.329) (-418.895) [-418.031] (-417.760) -- 0:00:52
133000 -- (-416.273) (-420.010) (-417.731) [-417.044] * (-420.985) [-420.645] (-417.666) (-417.555) -- 0:00:52
133500 -- (-415.090) (-417.566) [-418.859] (-418.885) * (-418.410) [-418.593] (-416.351) (-415.894) -- 0:00:51
134000 -- (-416.789) (-415.542) [-416.052] (-417.154) * [-419.313] (-417.318) (-416.591) (-417.492) -- 0:00:51
134500 -- (-417.914) (-416.139) (-418.933) [-417.468] * [-417.269] (-416.166) (-417.119) (-417.132) -- 0:00:51
135000 -- (-417.150) (-416.538) [-416.052] (-418.362) * (-416.028) [-415.786] (-417.970) (-416.109) -- 0:00:51
Average standard deviation of split frequencies: 0.023856
135500 -- (-417.053) (-416.897) (-419.332) [-420.923] * [-417.869] (-420.186) (-417.364) (-418.404) -- 0:00:51
136000 -- [-419.148] (-416.412) (-417.604) (-417.588) * [-415.062] (-417.936) (-416.832) (-415.228) -- 0:00:50
136500 -- (-415.880) [-420.671] (-415.918) (-416.044) * (-415.129) (-418.792) [-416.648] (-420.936) -- 0:00:50
137000 -- (-417.115) (-416.115) [-415.007] (-414.831) * [-419.288] (-418.997) (-418.616) (-417.016) -- 0:00:50
137500 -- (-418.197) (-417.252) [-415.260] (-418.317) * (-416.900) [-418.826] (-416.731) (-418.166) -- 0:00:56
138000 -- (-416.861) [-417.895] (-415.035) (-418.181) * [-414.811] (-418.334) (-416.385) (-419.689) -- 0:00:56
138500 -- [-417.712] (-415.878) (-415.552) (-424.338) * (-416.447) (-418.491) [-415.967] (-421.714) -- 0:00:55
139000 -- (-420.241) [-416.504] (-416.324) (-418.502) * [-417.442] (-415.369) (-415.588) (-415.852) -- 0:00:55
139500 -- (-417.423) (-416.383) [-416.649] (-417.030) * (-417.374) [-418.016] (-415.807) (-416.492) -- 0:00:55
140000 -- [-417.513] (-417.048) (-417.613) (-416.548) * (-416.295) [-416.257] (-418.144) (-417.193) -- 0:00:55
Average standard deviation of split frequencies: 0.023459
140500 -- (-421.834) (-418.944) (-416.956) [-419.046] * [-416.123] (-416.336) (-415.491) (-415.538) -- 0:00:55
141000 -- [-416.652] (-416.885) (-421.278) (-417.504) * (-417.156) (-415.795) (-418.908) [-416.107] -- 0:00:54
141500 -- (-415.183) (-415.490) (-416.717) [-422.417] * (-424.917) (-416.878) [-415.572] (-416.128) -- 0:00:54
142000 -- (-416.338) (-419.083) (-415.554) [-415.310] * (-420.496) (-418.050) (-416.946) [-415.804] -- 0:00:54
142500 -- (-415.462) [-416.158] (-417.823) (-416.097) * (-417.903) (-416.818) [-415.493] (-416.475) -- 0:00:54
143000 -- (-417.297) (-419.392) (-415.327) [-415.203] * (-417.957) [-415.355] (-417.970) (-417.536) -- 0:00:53
143500 -- (-415.512) [-416.370] (-417.576) (-417.490) * (-418.030) (-416.597) (-419.009) [-418.559] -- 0:00:53
144000 -- [-415.315] (-416.498) (-416.376) (-417.227) * (-419.585) [-418.936] (-420.661) (-418.773) -- 0:00:53
144500 -- (-416.772) (-417.264) [-415.765] (-419.027) * (-415.877) (-418.482) (-414.997) [-417.564] -- 0:00:53
145000 -- [-418.160] (-416.745) (-415.138) (-420.125) * (-423.361) (-415.509) [-419.778] (-419.982) -- 0:00:53
Average standard deviation of split frequencies: 0.022602
145500 -- (-417.863) (-415.359) [-416.772] (-426.600) * (-416.620) (-416.464) (-416.651) [-418.928] -- 0:00:52
146000 -- [-416.397] (-415.628) (-417.015) (-414.838) * [-416.347] (-418.346) (-418.276) (-418.412) -- 0:00:52
146500 -- (-416.569) (-414.952) [-415.216] (-416.837) * (-417.243) (-416.137) (-416.787) [-416.229] -- 0:00:52
147000 -- (-419.788) [-415.465] (-415.157) (-420.608) * [-417.558] (-416.944) (-419.917) (-416.242) -- 0:00:52
147500 -- (-419.812) (-415.469) (-415.854) [-418.146] * (-419.627) (-416.045) (-418.133) [-419.407] -- 0:00:52
148000 -- (-417.822) (-416.643) (-416.776) [-415.330] * (-416.774) (-417.375) [-419.886] (-417.033) -- 0:00:51
148500 -- (-415.737) (-418.587) [-416.239] (-414.787) * (-417.851) (-416.164) [-417.070] (-417.538) -- 0:00:51
149000 -- (-417.711) (-417.247) [-414.865] (-414.912) * (-417.724) (-416.304) [-416.625] (-415.995) -- 0:00:51
149500 -- (-415.797) (-417.810) [-417.102] (-416.599) * (-418.390) [-417.236] (-416.533) (-415.445) -- 0:00:51
150000 -- [-417.324] (-418.408) (-416.499) (-415.590) * (-418.773) [-419.593] (-417.609) (-420.441) -- 0:00:51
Average standard deviation of split frequencies: 0.021380
150500 -- [-416.101] (-417.552) (-417.663) (-415.316) * (-418.114) (-418.611) [-418.179] (-417.517) -- 0:00:50
151000 -- (-417.811) (-415.125) [-418.193] (-416.131) * (-420.666) (-418.342) [-418.569] (-422.274) -- 0:00:50
151500 -- (-415.609) (-417.192) [-416.842] (-417.099) * (-415.348) (-416.250) [-417.536] (-417.645) -- 0:00:50
152000 -- [-418.591] (-415.774) (-418.205) (-416.226) * (-416.797) (-417.287) [-415.770] (-417.454) -- 0:00:50
152500 -- (-419.403) (-417.345) [-415.255] (-417.219) * (-416.938) (-419.276) [-416.343] (-421.086) -- 0:00:50
153000 -- [-415.983] (-417.586) (-415.304) (-419.740) * (-417.931) (-415.398) (-416.545) [-419.601] -- 0:00:49
153500 -- (-417.373) (-415.789) [-418.419] (-415.602) * (-416.360) (-416.810) (-419.786) [-416.219] -- 0:00:49
154000 -- (-418.987) (-414.890) (-416.527) [-414.843] * (-417.635) [-415.457] (-416.864) (-415.652) -- 0:00:54
154500 -- (-418.043) [-417.100] (-416.575) (-417.044) * (-417.005) (-416.762) [-414.870] (-416.860) -- 0:00:54
155000 -- (-416.210) (-417.882) (-415.606) [-417.418] * (-417.036) [-417.562] (-416.899) (-420.992) -- 0:00:54
Average standard deviation of split frequencies: 0.019810
155500 -- (-420.013) [-417.606] (-416.303) (-414.895) * (-419.968) (-416.481) [-419.855] (-416.639) -- 0:00:54
156000 -- (-416.463) [-416.606] (-417.364) (-415.779) * [-419.695] (-416.435) (-421.964) (-416.301) -- 0:00:54
156500 -- [-417.271] (-417.320) (-416.652) (-415.594) * [-420.191] (-417.329) (-416.437) (-415.721) -- 0:00:53
157000 -- (-417.946) [-420.380] (-417.509) (-415.197) * (-417.770) (-416.288) [-417.715] (-418.038) -- 0:00:53
157500 -- [-416.768] (-420.170) (-415.584) (-416.655) * (-415.353) (-417.825) (-418.491) [-416.015] -- 0:00:53
158000 -- (-417.847) (-417.951) (-420.106) [-424.022] * [-416.824] (-416.674) (-417.749) (-416.288) -- 0:00:53
158500 -- (-416.054) (-415.675) [-415.818] (-422.978) * (-417.316) (-421.316) [-416.028] (-417.730) -- 0:00:53
159000 -- (-419.434) (-415.876) [-417.135] (-415.734) * [-417.764] (-418.185) (-423.564) (-416.533) -- 0:00:52
159500 -- (-418.863) (-415.472) [-416.176] (-418.470) * [-414.780] (-420.382) (-419.920) (-416.492) -- 0:00:52
160000 -- (-420.187) [-415.428] (-419.349) (-418.675) * (-416.209) (-416.413) [-417.425] (-417.255) -- 0:00:52
Average standard deviation of split frequencies: 0.021919
160500 -- (-423.666) [-417.337] (-416.875) (-421.660) * (-417.259) [-419.911] (-419.741) (-416.631) -- 0:00:52
161000 -- (-416.541) [-416.578] (-416.028) (-418.266) * (-417.503) (-415.552) (-417.469) [-416.371] -- 0:00:52
161500 -- (-416.712) (-416.131) (-417.248) [-421.833] * [-418.713] (-420.486) (-417.530) (-418.616) -- 0:00:51
162000 -- [-417.135] (-420.553) (-416.806) (-416.675) * (-416.022) [-417.858] (-415.248) (-419.181) -- 0:00:51
162500 -- (-417.914) (-416.030) [-416.743] (-416.729) * (-418.132) (-420.089) [-416.283] (-419.959) -- 0:00:51
163000 -- (-416.666) (-417.004) (-418.244) [-418.476] * (-417.103) [-417.990] (-419.378) (-419.561) -- 0:00:51
163500 -- (-419.753) (-415.725) (-419.248) [-422.730] * (-415.611) [-416.640] (-418.269) (-421.535) -- 0:00:51
164000 -- (-415.900) (-416.324) [-419.843] (-417.369) * (-417.180) [-416.111] (-420.626) (-417.692) -- 0:00:50
164500 -- (-415.834) [-415.592] (-417.005) (-418.372) * (-415.914) (-415.744) [-418.878] (-415.980) -- 0:00:50
165000 -- (-419.194) [-417.407] (-415.977) (-415.698) * [-415.703] (-416.080) (-417.527) (-415.068) -- 0:00:50
Average standard deviation of split frequencies: 0.019879
165500 -- (-415.116) (-419.141) (-417.807) [-415.510] * [-415.130] (-416.710) (-417.043) (-415.524) -- 0:00:50
166000 -- (-419.331) (-418.738) [-419.716] (-415.675) * (-415.078) [-417.248] (-417.649) (-417.535) -- 0:00:50
166500 -- (-417.192) [-414.840] (-415.430) (-416.150) * (-418.423) (-417.392) [-415.291] (-418.523) -- 0:00:50
167000 -- [-417.266] (-416.632) (-415.582) (-421.865) * (-418.405) [-418.590] (-416.214) (-415.538) -- 0:00:54
167500 -- [-419.076] (-415.744) (-416.635) (-418.565) * (-416.745) (-416.448) (-414.769) [-415.174] -- 0:00:54
168000 -- (-418.859) (-416.568) [-417.160] (-420.193) * (-418.777) (-417.565) [-417.702] (-414.642) -- 0:00:54
168500 -- [-417.398] (-417.995) (-416.072) (-414.851) * (-422.800) (-416.875) [-415.546] (-415.554) -- 0:00:54
169000 -- (-418.119) (-416.981) (-417.425) [-420.275] * (-419.141) (-417.609) (-415.752) [-419.128] -- 0:00:54
169500 -- (-415.922) [-417.532] (-415.743) (-416.440) * (-416.971) [-415.948] (-419.413) (-417.033) -- 0:00:53
170000 -- [-416.855] (-416.651) (-419.165) (-418.809) * [-417.165] (-420.649) (-416.753) (-415.472) -- 0:00:53
Average standard deviation of split frequencies: 0.020797
170500 -- (-416.977) (-419.204) [-417.032] (-418.319) * (-414.864) (-419.061) [-416.746] (-420.367) -- 0:00:53
171000 -- (-420.942) [-416.935] (-417.927) (-415.383) * [-419.847] (-416.074) (-416.600) (-416.879) -- 0:00:53
171500 -- [-416.526] (-416.969) (-419.082) (-415.279) * (-417.540) (-418.082) [-418.856] (-418.582) -- 0:00:53
172000 -- (-415.926) [-415.889] (-417.630) (-417.021) * (-416.900) (-414.843) (-417.467) [-416.258] -- 0:00:52
172500 -- [-415.881] (-417.469) (-417.868) (-419.375) * (-417.822) (-418.269) (-415.623) [-415.285] -- 0:00:52
173000 -- (-416.923) [-417.554] (-416.056) (-417.534) * (-419.585) (-419.049) [-415.674] (-417.862) -- 0:00:52
173500 -- (-417.515) (-417.699) [-418.851] (-415.511) * [-417.074] (-419.242) (-420.431) (-418.345) -- 0:00:52
174000 -- (-417.140) (-416.362) [-421.337] (-415.832) * (-416.768) (-420.325) [-425.864] (-418.547) -- 0:00:52
174500 -- (-419.660) (-418.763) [-415.509] (-417.183) * (-425.301) (-420.692) (-418.269) [-416.576] -- 0:00:52
175000 -- (-415.389) (-417.239) (-417.894) [-416.212] * (-415.322) (-418.375) (-417.074) [-418.149] -- 0:00:51
Average standard deviation of split frequencies: 0.018749
175500 -- [-415.670] (-415.479) (-414.876) (-416.440) * [-415.395] (-418.813) (-416.336) (-416.064) -- 0:00:51
176000 -- (-415.462) [-415.529] (-416.057) (-421.139) * [-421.018] (-415.496) (-415.794) (-417.057) -- 0:00:51
176500 -- (-418.751) (-417.738) [-417.705] (-417.608) * (-418.751) (-416.336) (-419.182) [-417.038] -- 0:00:51
177000 -- (-417.382) (-418.385) (-415.864) [-414.928] * (-416.571) (-418.804) [-415.847] (-414.995) -- 0:00:51
177500 -- (-416.812) [-415.756] (-415.367) (-418.855) * (-420.712) (-415.969) [-418.485] (-417.946) -- 0:00:50
178000 -- [-416.047] (-416.088) (-416.608) (-418.210) * (-414.984) (-418.425) (-416.742) [-423.235] -- 0:00:50
178500 -- [-418.356] (-419.544) (-419.307) (-414.986) * [-415.508] (-417.299) (-414.940) (-422.060) -- 0:00:50
179000 -- [-416.649] (-415.286) (-420.603) (-418.423) * [-420.749] (-422.038) (-417.081) (-417.142) -- 0:00:50
179500 -- (-415.232) [-416.406] (-418.937) (-416.839) * [-418.415] (-416.247) (-416.343) (-415.397) -- 0:00:50
180000 -- [-416.047] (-421.189) (-421.760) (-415.837) * (-424.172) (-415.256) (-415.894) [-414.997] -- 0:00:50
Average standard deviation of split frequencies: 0.018265
180500 -- [-415.338] (-420.016) (-418.099) (-419.844) * (-419.896) [-416.488] (-417.698) (-416.663) -- 0:00:49
181000 -- (-415.222) (-422.053) [-417.456] (-418.336) * [-418.974] (-418.229) (-422.865) (-415.454) -- 0:00:54
181500 -- [-414.931] (-417.545) (-418.257) (-416.750) * (-419.809) (-415.804) (-417.036) [-417.233] -- 0:00:54
182000 -- (-414.954) (-418.903) [-418.709] (-416.942) * (-415.686) [-416.895] (-419.749) (-417.039) -- 0:00:53
182500 -- (-418.217) (-417.713) (-416.342) [-416.908] * (-418.491) (-416.866) (-415.650) [-419.295] -- 0:00:53
183000 -- (-415.352) (-419.862) (-415.419) [-421.002] * (-419.625) [-418.748] (-416.469) (-418.466) -- 0:00:53
183500 -- (-416.941) (-418.180) [-415.318] (-416.820) * (-417.357) (-416.398) [-415.870] (-418.016) -- 0:00:53
184000 -- [-416.289] (-416.125) (-417.562) (-416.796) * [-417.638] (-417.586) (-417.381) (-417.479) -- 0:00:53
184500 -- (-415.042) [-419.015] (-417.770) (-416.111) * (-416.325) (-415.055) (-418.551) [-418.737] -- 0:00:53
185000 -- [-417.250] (-421.706) (-418.321) (-417.936) * (-416.391) [-416.734] (-418.337) (-416.156) -- 0:00:52
Average standard deviation of split frequencies: 0.018141
185500 -- [-417.826] (-415.405) (-417.733) (-415.358) * (-416.437) [-416.288] (-417.066) (-417.134) -- 0:00:52
186000 -- [-415.405] (-415.537) (-419.203) (-416.293) * (-415.893) (-417.355) (-415.750) [-416.789] -- 0:00:52
186500 -- (-417.737) (-416.518) [-418.807] (-418.474) * [-417.419] (-422.649) (-416.385) (-416.490) -- 0:00:52
187000 -- (-415.584) (-416.147) (-417.345) [-417.086] * [-415.627] (-416.964) (-418.135) (-418.933) -- 0:00:52
187500 -- (-419.533) (-415.930) [-416.806] (-421.883) * (-416.837) (-420.116) [-416.009] (-418.924) -- 0:00:52
188000 -- (-415.843) (-415.905) (-422.771) [-419.568] * [-417.662] (-419.867) (-419.300) (-416.397) -- 0:00:51
188500 -- (-415.856) (-415.602) (-420.026) [-415.855] * (-421.241) (-418.234) (-418.826) [-416.543] -- 0:00:51
189000 -- [-418.263] (-417.883) (-417.609) (-419.818) * (-418.336) (-416.006) (-422.873) [-415.353] -- 0:00:51
189500 -- [-418.491] (-415.192) (-417.676) (-418.649) * (-415.966) (-416.403) [-420.646] (-416.237) -- 0:00:51
190000 -- (-420.124) (-414.906) (-417.844) [-417.398] * (-416.487) (-416.455) (-420.370) [-417.266] -- 0:00:51
Average standard deviation of split frequencies: 0.018088
190500 -- (-421.643) (-418.218) [-417.141] (-415.675) * [-417.716] (-415.367) (-414.891) (-415.903) -- 0:00:50
191000 -- [-415.981] (-419.350) (-417.729) (-415.550) * [-417.721] (-415.484) (-416.027) (-417.853) -- 0:00:50
191500 -- (-417.804) (-418.084) [-416.485] (-416.616) * (-418.722) [-415.410] (-415.513) (-415.531) -- 0:00:50
192000 -- (-416.271) (-416.338) [-417.591] (-416.841) * (-415.559) (-415.901) (-417.479) [-417.714] -- 0:00:50
192500 -- [-417.934] (-418.112) (-415.891) (-416.191) * (-418.530) (-425.386) (-416.474) [-416.425] -- 0:00:50
193000 -- (-416.823) (-420.006) [-417.473] (-417.099) * (-421.944) (-415.423) [-415.185] (-416.340) -- 0:00:50
193500 -- (-416.491) (-417.707) (-418.393) [-415.590] * (-424.001) (-416.706) (-416.274) [-417.411] -- 0:00:50
194000 -- [-418.292] (-415.447) (-415.676) (-417.233) * (-416.397) (-417.215) (-419.491) [-416.148] -- 0:00:49
194500 -- (-416.194) [-416.314] (-415.193) (-418.015) * (-421.883) (-418.359) [-416.044] (-415.100) -- 0:00:49
195000 -- (-416.306) [-417.501] (-417.778) (-417.545) * (-416.634) (-420.641) [-415.097] (-417.140) -- 0:00:49
Average standard deviation of split frequencies: 0.018988
195500 -- (-416.633) (-415.963) (-417.424) [-418.304] * (-415.619) (-416.777) [-415.417] (-417.162) -- 0:00:49
196000 -- (-417.729) (-416.248) [-417.410] (-415.545) * [-414.792] (-416.135) (-419.071) (-417.803) -- 0:00:49
196500 -- (-418.498) (-418.986) [-415.583] (-419.312) * (-420.126) [-415.979] (-420.732) (-415.272) -- 0:00:53
197000 -- (-417.030) [-416.068] (-416.008) (-417.980) * [-420.037] (-418.237) (-416.458) (-416.630) -- 0:00:52
197500 -- (-415.539) (-417.318) [-415.902] (-417.358) * [-416.319] (-419.577) (-415.632) (-419.498) -- 0:00:52
198000 -- (-414.759) (-416.694) (-421.937) [-416.696] * [-417.666] (-416.782) (-416.888) (-419.385) -- 0:00:52
198500 -- (-416.628) (-421.877) [-416.281] (-415.366) * (-416.391) [-418.643] (-417.625) (-418.489) -- 0:00:52
199000 -- (-416.181) (-420.564) [-415.310] (-418.141) * (-418.998) (-417.589) [-417.660] (-421.189) -- 0:00:52
199500 -- [-416.084] (-417.721) (-416.611) (-417.918) * (-418.241) (-418.915) (-417.164) [-417.077] -- 0:00:52
200000 -- (-416.892) [-417.858] (-416.122) (-421.143) * (-417.229) (-418.866) (-418.059) [-416.948] -- 0:00:51
Average standard deviation of split frequencies: 0.020277
200500 -- (-418.070) [-418.086] (-416.866) (-415.128) * (-416.155) (-421.752) [-415.695] (-420.254) -- 0:00:51
201000 -- [-416.986] (-417.012) (-419.800) (-416.040) * (-416.471) [-416.481] (-418.292) (-418.558) -- 0:00:51
201500 -- (-423.290) (-419.585) [-417.944] (-416.990) * (-418.784) [-416.767] (-417.092) (-420.670) -- 0:00:51
202000 -- [-423.609] (-418.270) (-420.591) (-416.624) * (-418.339) [-415.511] (-415.708) (-416.058) -- 0:00:51
202500 -- (-417.424) (-418.665) [-418.973] (-416.152) * [-416.944] (-416.670) (-416.985) (-415.530) -- 0:00:51
203000 -- [-416.522] (-419.574) (-417.213) (-415.719) * (-415.323) (-420.748) (-415.264) [-415.868] -- 0:00:51
203500 -- [-418.892] (-417.063) (-420.527) (-417.515) * [-415.438] (-424.774) (-416.042) (-418.737) -- 0:00:50
204000 -- (-418.415) (-420.101) [-416.463] (-420.087) * (-417.383) [-417.846] (-417.635) (-415.296) -- 0:00:50
204500 -- (-417.021) (-419.133) (-415.540) [-417.911] * (-415.313) (-415.621) (-415.542) [-414.744] -- 0:00:50
205000 -- (-420.754) (-417.249) [-415.239] (-416.587) * (-417.261) (-416.805) (-415.471) [-416.105] -- 0:00:50
Average standard deviation of split frequencies: 0.019511
205500 -- (-419.731) [-417.552] (-416.671) (-419.519) * (-416.902) [-415.406] (-416.510) (-417.346) -- 0:00:50
206000 -- (-417.369) (-417.887) (-417.539) [-415.183] * (-417.319) [-417.369] (-417.405) (-417.227) -- 0:00:50
206500 -- (-418.753) (-418.185) (-417.382) [-417.195] * [-418.273] (-416.282) (-416.804) (-415.765) -- 0:00:49
207000 -- (-417.729) [-417.424] (-415.219) (-416.099) * (-417.939) (-417.303) [-416.565] (-416.825) -- 0:00:49
207500 -- (-416.600) (-417.884) [-415.885] (-415.186) * [-416.491] (-415.749) (-419.333) (-417.766) -- 0:00:49
208000 -- [-417.623] (-418.271) (-419.680) (-418.029) * [-416.156] (-420.000) (-416.524) (-417.569) -- 0:00:49
208500 -- [-416.658] (-415.466) (-416.306) (-416.735) * (-418.790) (-416.486) [-415.614] (-415.977) -- 0:00:49
209000 -- [-418.843] (-418.593) (-417.015) (-416.556) * (-417.243) [-416.350] (-417.751) (-418.818) -- 0:00:49
209500 -- (-415.802) (-422.336) (-415.795) [-417.003] * (-418.463) (-414.954) [-417.081] (-416.389) -- 0:00:49
210000 -- (-418.593) (-424.718) (-416.224) [-414.839] * [-417.777] (-415.250) (-420.303) (-417.460) -- 0:00:48
Average standard deviation of split frequencies: 0.020512
210500 -- (-419.293) [-423.624] (-418.121) (-421.923) * (-416.233) (-420.908) [-418.430] (-418.863) -- 0:00:48
211000 -- (-416.933) [-418.894] (-419.407) (-417.519) * (-418.304) (-415.202) [-417.439] (-420.856) -- 0:00:48
211500 -- (-421.395) (-418.738) (-418.663) [-416.608] * (-415.383) (-419.792) (-417.222) [-417.792] -- 0:00:48
212000 -- (-417.919) (-417.713) (-419.179) [-418.509] * (-416.953) (-416.100) (-418.526) [-415.165] -- 0:00:48
212500 -- (-417.304) (-417.531) [-416.288] (-416.265) * (-422.271) (-417.937) (-417.308) [-415.867] -- 0:00:48
213000 -- [-415.396] (-417.490) (-417.762) (-415.350) * (-419.058) [-417.757] (-415.350) (-417.945) -- 0:00:48
213500 -- (-416.074) [-416.226] (-418.639) (-419.184) * [-416.454] (-419.439) (-416.768) (-416.833) -- 0:00:51
214000 -- (-415.533) (-416.270) (-418.616) [-416.409] * (-418.340) (-419.458) (-417.223) [-417.709] -- 0:00:51
214500 -- (-418.633) (-416.629) [-417.822] (-416.543) * (-415.407) (-418.080) [-416.286] (-415.263) -- 0:00:51
215000 -- [-417.506] (-416.061) (-420.571) (-415.613) * [-418.052] (-418.524) (-417.283) (-415.212) -- 0:00:51
Average standard deviation of split frequencies: 0.021696
215500 -- (-417.228) [-418.661] (-415.765) (-417.479) * (-416.408) (-415.904) [-419.003] (-414.596) -- 0:00:50
216000 -- (-416.246) (-419.063) (-418.113) [-415.462] * (-417.215) (-416.730) (-417.821) [-416.962] -- 0:00:50
216500 -- (-417.253) (-416.431) (-415.069) [-415.650] * [-422.871] (-415.867) (-417.447) (-415.893) -- 0:00:50
217000 -- (-415.717) (-415.283) (-416.015) [-416.329] * (-415.624) (-414.849) (-416.590) [-417.273] -- 0:00:50
217500 -- (-415.849) [-418.069] (-417.959) (-415.864) * (-417.633) (-422.081) (-422.080) [-418.031] -- 0:00:50
218000 -- (-416.009) [-416.696] (-418.452) (-418.812) * (-415.229) [-418.444] (-418.753) (-416.289) -- 0:00:50
218500 -- [-415.938] (-416.812) (-417.179) (-420.640) * (-416.781) (-416.748) (-415.102) [-415.275] -- 0:00:50
219000 -- (-416.110) (-415.242) (-421.020) [-416.121] * [-417.472] (-418.069) (-420.417) (-416.547) -- 0:00:49
219500 -- (-416.855) [-418.386] (-418.504) (-415.107) * (-417.808) [-417.916] (-417.331) (-417.130) -- 0:00:49
220000 -- (-417.069) (-415.806) (-418.180) [-415.470] * (-416.071) (-419.212) (-416.237) [-415.359] -- 0:00:49
Average standard deviation of split frequencies: 0.021111
220500 -- (-416.713) [-415.214] (-418.835) (-417.748) * [-416.242] (-416.386) (-416.619) (-416.148) -- 0:00:49
221000 -- (-421.881) (-414.825) [-415.979] (-416.383) * (-415.028) (-419.474) [-418.874] (-415.418) -- 0:00:49
221500 -- (-422.993) (-420.278) (-416.968) [-416.393] * (-419.690) (-416.734) [-416.938] (-416.484) -- 0:00:49
222000 -- (-418.984) [-419.534] (-415.537) (-417.827) * (-418.205) [-416.111] (-417.493) (-417.318) -- 0:00:49
222500 -- (-417.121) (-418.466) [-415.423] (-416.819) * (-417.807) (-416.702) [-416.641] (-415.493) -- 0:00:48
223000 -- (-418.687) (-417.494) [-416.389] (-417.298) * [-418.548] (-416.289) (-415.492) (-417.129) -- 0:00:48
223500 -- (-421.557) (-417.586) [-417.485] (-417.431) * (-418.094) (-414.828) (-416.440) [-417.646] -- 0:00:48
224000 -- [-415.264] (-418.685) (-416.645) (-416.160) * (-419.341) (-416.858) [-418.400] (-415.939) -- 0:00:48
224500 -- [-415.438] (-416.772) (-418.633) (-418.446) * [-416.492] (-416.625) (-416.934) (-418.240) -- 0:00:48
225000 -- (-417.261) [-416.947] (-421.695) (-415.389) * [-417.109] (-418.416) (-416.353) (-418.949) -- 0:00:48
Average standard deviation of split frequencies: 0.021717
225500 -- (-416.663) (-418.966) (-419.998) [-416.733] * [-417.599] (-419.803) (-417.147) (-419.606) -- 0:00:48
226000 -- (-417.277) (-415.762) [-418.381] (-417.185) * (-416.585) (-416.844) (-420.496) [-416.160] -- 0:00:47
226500 -- (-418.845) (-417.088) (-416.996) [-416.300] * [-416.246] (-416.049) (-416.356) (-416.661) -- 0:00:47
227000 -- (-417.931) (-419.310) [-418.325] (-415.235) * (-420.585) (-420.096) [-416.176] (-416.691) -- 0:00:47
227500 -- [-418.505] (-416.096) (-417.140) (-417.908) * (-417.513) [-415.120] (-414.986) (-417.560) -- 0:00:47
228000 -- [-416.335] (-416.104) (-415.017) (-415.194) * (-418.546) (-417.169) (-417.632) [-416.630] -- 0:00:47
228500 -- (-416.323) (-415.748) (-415.620) [-418.381] * [-415.384] (-417.491) (-420.454) (-415.654) -- 0:00:47
229000 -- (-417.949) (-414.938) (-417.622) [-416.860] * [-416.314] (-416.095) (-419.127) (-417.597) -- 0:00:47
229500 -- (-423.815) (-418.230) (-415.443) [-419.298] * (-417.003) [-415.950] (-423.359) (-418.632) -- 0:00:47
230000 -- (-415.356) [-419.788] (-418.529) (-418.792) * (-419.135) (-421.270) [-416.592] (-416.075) -- 0:00:46
Average standard deviation of split frequencies: 0.020076
230500 -- [-417.297] (-416.324) (-418.399) (-417.099) * (-418.175) [-425.334] (-418.041) (-415.996) -- 0:00:50
231000 -- (-416.483) (-420.129) [-416.324] (-418.626) * (-416.334) (-422.019) (-416.961) [-416.552] -- 0:00:49
231500 -- [-414.799] (-417.540) (-415.750) (-416.032) * [-419.775] (-418.741) (-419.670) (-418.631) -- 0:00:49
232000 -- [-414.788] (-416.928) (-419.098) (-415.395) * [-416.732] (-427.418) (-418.682) (-417.160) -- 0:00:49
232500 -- (-416.297) [-415.540] (-417.435) (-415.553) * (-415.933) (-415.569) (-419.838) [-415.217] -- 0:00:49
233000 -- (-419.720) [-415.574] (-418.051) (-417.175) * (-424.304) [-416.672] (-418.217) (-416.075) -- 0:00:49
233500 -- (-417.616) (-417.763) (-417.910) [-417.174] * (-416.209) [-419.540] (-417.576) (-415.009) -- 0:00:49
234000 -- (-419.662) (-417.788) (-418.621) [-415.773] * [-417.582] (-416.082) (-418.363) (-415.054) -- 0:00:49
234500 -- (-416.973) (-418.065) (-418.957) [-415.963] * (-415.935) (-419.774) (-417.482) [-415.141] -- 0:00:48
235000 -- [-417.681] (-417.772) (-416.875) (-415.915) * [-417.472] (-417.590) (-423.238) (-414.898) -- 0:00:48
Average standard deviation of split frequencies: 0.020224
235500 -- (-415.812) (-419.099) (-416.434) [-415.258] * (-417.754) (-418.082) [-419.208] (-416.231) -- 0:00:48
236000 -- (-420.598) (-416.832) (-415.725) [-417.705] * (-415.921) (-417.709) [-415.452] (-416.165) -- 0:00:48
236500 -- (-419.260) (-415.545) (-417.515) [-417.236] * (-428.235) (-419.570) (-419.113) [-414.907] -- 0:00:48
237000 -- (-415.862) [-417.118] (-415.306) (-418.998) * (-416.742) [-416.092] (-416.077) (-416.434) -- 0:00:48
237500 -- (-416.498) (-415.210) (-417.069) [-415.462] * [-415.313] (-417.559) (-415.401) (-419.531) -- 0:00:48
238000 -- [-415.633] (-415.011) (-417.687) (-419.471) * (-416.191) [-417.265] (-414.816) (-415.980) -- 0:00:48
238500 -- (-414.772) (-417.058) (-415.968) [-418.336] * (-417.123) [-420.257] (-417.212) (-418.330) -- 0:00:47
239000 -- (-415.916) [-415.524] (-417.372) (-417.914) * (-418.573) (-424.332) [-416.716] (-415.288) -- 0:00:47
239500 -- (-416.354) (-415.526) (-416.645) [-416.863] * [-416.447] (-421.084) (-416.048) (-419.989) -- 0:00:47
240000 -- [-416.606] (-416.004) (-417.508) (-419.469) * (-417.263) (-417.899) (-418.112) [-423.757] -- 0:00:47
Average standard deviation of split frequencies: 0.018717
240500 -- (-416.975) [-417.973] (-416.903) (-416.508) * (-414.830) (-420.345) (-415.856) [-416.557] -- 0:00:47
241000 -- (-416.579) [-417.869] (-416.248) (-417.574) * [-416.107] (-421.312) (-415.632) (-416.958) -- 0:00:47
241500 -- (-416.223) (-415.452) (-415.764) [-415.342] * (-416.543) (-420.107) [-415.919] (-415.425) -- 0:00:47
242000 -- [-415.306] (-415.436) (-416.045) (-422.242) * (-418.747) [-420.431] (-415.331) (-417.552) -- 0:00:46
242500 -- (-420.391) [-416.564] (-420.532) (-420.559) * [-417.077] (-422.753) (-415.309) (-419.045) -- 0:00:46
243000 -- [-419.408] (-417.329) (-418.891) (-418.738) * (-415.569) (-420.298) [-416.630] (-418.283) -- 0:00:46
243500 -- (-418.270) (-416.626) (-416.362) [-416.438] * [-417.991] (-415.895) (-418.599) (-417.593) -- 0:00:46
244000 -- (-416.757) [-416.986] (-415.514) (-417.111) * (-417.441) (-420.424) [-415.738] (-420.717) -- 0:00:46
244500 -- (-416.882) [-417.009] (-419.445) (-418.149) * (-416.034) (-416.146) (-418.043) [-417.468] -- 0:00:46
245000 -- [-418.210] (-415.329) (-415.600) (-416.828) * [-417.356] (-416.552) (-417.566) (-422.298) -- 0:00:46
Average standard deviation of split frequencies: 0.016908
245500 -- (-422.914) (-417.833) [-423.826] (-416.836) * (-416.092) (-416.449) (-415.676) [-420.412] -- 0:00:46
246000 -- [-417.253] (-416.569) (-418.216) (-416.228) * (-416.975) [-418.143] (-418.300) (-420.511) -- 0:00:45
246500 -- (-415.590) [-415.824] (-416.605) (-420.488) * (-416.239) [-416.657] (-416.478) (-416.286) -- 0:00:45
247000 -- (-418.222) [-420.033] (-414.839) (-420.012) * (-415.303) (-417.547) [-415.895] (-416.325) -- 0:00:45
247500 -- (-416.496) [-416.912] (-416.403) (-422.287) * [-415.605] (-418.982) (-416.683) (-418.004) -- 0:00:45
248000 -- (-417.723) [-416.810] (-422.540) (-420.082) * (-415.865) [-416.223] (-415.943) (-415.424) -- 0:00:48
248500 -- (-418.212) (-418.304) [-415.515] (-416.034) * (-417.034) (-418.841) (-415.567) [-418.582] -- 0:00:48
249000 -- (-416.641) [-417.309] (-417.687) (-419.200) * [-415.843] (-417.014) (-415.246) (-417.816) -- 0:00:48
249500 -- (-415.558) (-417.864) (-419.799) [-417.136] * (-418.002) (-416.115) [-416.533] (-415.524) -- 0:00:48
250000 -- (-420.835) (-416.368) (-416.831) [-416.534] * (-416.445) (-416.223) [-415.995] (-414.914) -- 0:00:48
Average standard deviation of split frequencies: 0.015358
250500 -- (-424.816) (-418.109) (-417.166) [-417.247] * (-417.249) (-415.079) [-416.567] (-415.244) -- 0:00:47
251000 -- (-417.483) (-415.082) [-415.530] (-416.886) * (-415.234) (-416.189) [-416.243] (-415.869) -- 0:00:47
251500 -- [-416.382] (-418.222) (-420.978) (-419.463) * (-417.729) [-416.632] (-417.721) (-417.721) -- 0:00:47
252000 -- (-415.541) [-416.612] (-428.157) (-416.240) * (-415.829) [-420.974] (-417.710) (-418.388) -- 0:00:47
252500 -- (-416.061) (-416.289) (-426.226) [-417.624] * [-415.637] (-417.540) (-420.863) (-416.235) -- 0:00:47
253000 -- (-415.134) (-418.149) (-422.937) [-416.787] * [-417.513] (-417.979) (-417.502) (-415.864) -- 0:00:47
253500 -- (-416.586) (-418.101) [-420.085] (-416.469) * (-415.373) (-418.022) [-415.879] (-416.503) -- 0:00:47
254000 -- [-416.984] (-418.846) (-418.023) (-416.160) * (-415.574) (-418.577) (-418.001) [-418.921] -- 0:00:46
254500 -- [-421.369] (-416.529) (-418.563) (-416.448) * (-417.421) (-418.403) [-416.691] (-418.021) -- 0:00:46
255000 -- (-414.852) (-416.529) [-416.887] (-418.182) * (-421.909) (-416.451) (-417.472) [-416.955] -- 0:00:46
Average standard deviation of split frequencies: 0.014190
255500 -- [-418.099] (-415.531) (-417.217) (-416.145) * (-418.044) (-418.394) [-415.849] (-417.200) -- 0:00:46
256000 -- [-415.458] (-417.668) (-420.752) (-415.971) * [-416.958] (-418.065) (-418.179) (-416.056) -- 0:00:46
256500 -- [-418.082] (-419.076) (-417.486) (-414.785) * [-416.594] (-417.339) (-420.312) (-416.202) -- 0:00:46
257000 -- (-417.538) (-418.724) (-419.050) [-415.913] * (-418.095) (-417.379) [-420.157] (-415.458) -- 0:00:46
257500 -- (-415.431) [-418.707] (-417.804) (-416.312) * (-416.504) (-425.518) [-417.806] (-417.093) -- 0:00:46
258000 -- (-416.767) (-417.866) (-417.684) [-414.814] * [-418.184] (-425.340) (-416.281) (-417.038) -- 0:00:46
258500 -- [-416.544] (-417.261) (-415.164) (-416.891) * (-421.050) [-416.512] (-418.301) (-415.594) -- 0:00:45
259000 -- (-415.102) (-417.433) [-416.342] (-415.589) * (-416.724) (-420.907) (-418.978) [-418.142] -- 0:00:45
259500 -- (-415.936) (-416.797) [-415.874] (-421.618) * (-418.132) (-415.815) [-415.734] (-415.676) -- 0:00:45
260000 -- (-416.057) [-416.603] (-415.664) (-419.000) * (-416.363) (-414.727) (-417.394) [-415.681] -- 0:00:45
Average standard deviation of split frequencies: 0.013162
260500 -- (-415.126) (-415.475) [-416.979] (-421.450) * (-416.357) (-416.491) (-421.592) [-415.794] -- 0:00:45
261000 -- (-415.564) (-418.449) (-417.299) [-418.438] * (-418.873) (-417.302) [-414.595] (-417.725) -- 0:00:45
261500 -- (-415.873) (-416.152) (-420.173) [-418.608] * (-417.722) (-416.710) [-415.480] (-418.028) -- 0:00:45
262000 -- [-417.578] (-416.404) (-417.089) (-416.271) * (-418.137) (-415.939) [-417.899] (-420.753) -- 0:00:45
262500 -- [-415.187] (-417.101) (-420.313) (-415.498) * (-416.342) (-416.592) [-415.798] (-415.956) -- 0:00:44
263000 -- (-417.880) [-418.630] (-415.128) (-419.052) * (-416.408) (-414.965) [-417.041] (-416.444) -- 0:00:44
263500 -- (-420.082) [-414.829] (-417.769) (-416.123) * (-415.370) [-416.926] (-418.920) (-416.502) -- 0:00:44
264000 -- (-416.669) (-416.166) (-415.897) [-417.621] * [-415.070] (-416.824) (-415.857) (-428.827) -- 0:00:44
264500 -- [-416.587] (-418.000) (-415.201) (-416.866) * (-424.144) [-417.733] (-417.625) (-419.974) -- 0:00:44
265000 -- (-417.980) (-417.947) (-418.735) [-414.938] * (-422.155) (-417.871) [-416.024] (-415.356) -- 0:00:47
Average standard deviation of split frequencies: 0.013488
265500 -- (-416.384) (-415.534) (-417.173) [-416.800] * (-421.340) (-419.641) (-415.833) [-415.994] -- 0:00:47
266000 -- [-418.392] (-415.324) (-417.058) (-417.017) * (-416.028) [-416.653] (-421.795) (-418.541) -- 0:00:46
266500 -- (-417.094) (-415.366) (-420.423) [-417.398] * [-416.793] (-415.192) (-415.427) (-417.792) -- 0:00:46
267000 -- (-415.693) [-418.758] (-417.840) (-419.420) * (-415.179) (-416.934) [-415.569] (-416.205) -- 0:00:46
267500 -- (-421.875) [-416.919] (-417.582) (-418.078) * (-416.950) (-414.979) (-420.499) [-415.888] -- 0:00:46
268000 -- (-414.934) (-415.788) (-418.020) [-418.310] * [-416.344] (-415.992) (-416.340) (-414.954) -- 0:00:46
268500 -- (-416.951) (-418.215) [-415.709] (-420.415) * [-417.073] (-416.353) (-418.895) (-416.228) -- 0:00:46
269000 -- [-415.574] (-417.907) (-419.578) (-420.543) * (-416.940) [-415.823] (-416.564) (-418.097) -- 0:00:46
269500 -- [-416.562] (-419.602) (-415.288) (-418.119) * (-416.762) (-416.198) [-416.191] (-416.272) -- 0:00:46
270000 -- (-417.482) [-419.060] (-417.592) (-415.761) * (-415.649) [-414.712] (-416.982) (-415.382) -- 0:00:45
Average standard deviation of split frequencies: 0.012191
270500 -- (-415.705) [-418.120] (-418.406) (-415.713) * (-418.712) (-417.289) (-418.457) [-416.408] -- 0:00:45
271000 -- (-415.291) [-416.436] (-415.812) (-417.965) * (-416.835) (-416.924) (-420.432) [-418.236] -- 0:00:45
271500 -- (-416.758) (-420.591) (-415.080) [-416.479] * (-415.106) (-418.714) (-418.866) [-416.767] -- 0:00:45
272000 -- [-417.043] (-416.191) (-416.148) (-417.026) * [-416.602] (-415.887) (-421.887) (-417.969) -- 0:00:45
272500 -- (-415.602) [-415.556] (-417.417) (-418.595) * [-416.388] (-417.382) (-415.594) (-420.748) -- 0:00:45
273000 -- (-420.302) (-417.570) [-416.913] (-416.998) * (-415.725) (-419.370) (-420.171) [-415.179] -- 0:00:45
273500 -- (-415.053) [-416.019] (-416.278) (-418.300) * (-416.741) (-416.836) (-418.286) [-417.798] -- 0:00:45
274000 -- (-416.814) [-418.695] (-416.560) (-426.516) * [-416.243] (-416.595) (-417.919) (-417.822) -- 0:00:45
274500 -- (-415.897) (-415.489) [-419.888] (-419.631) * (-415.486) [-415.224] (-416.458) (-418.359) -- 0:00:44
275000 -- (-415.198) (-415.843) [-418.397] (-418.751) * (-414.968) [-417.660] (-416.584) (-417.260) -- 0:00:44
Average standard deviation of split frequencies: 0.011956
275500 -- [-417.185] (-415.833) (-417.465) (-416.762) * (-414.736) (-419.330) (-416.638) [-415.318] -- 0:00:44
276000 -- (-417.712) (-418.794) (-418.097) [-416.797] * (-415.550) (-416.813) [-416.774] (-416.941) -- 0:00:44
276500 -- [-417.224] (-415.616) (-420.890) (-418.017) * (-416.255) (-417.349) [-418.618] (-416.279) -- 0:00:44
277000 -- (-415.123) (-420.856) (-421.628) [-415.118] * (-416.401) (-416.856) (-415.848) [-415.140] -- 0:00:44
277500 -- [-415.404] (-416.734) (-415.984) (-420.323) * (-416.951) [-415.945] (-415.832) (-415.011) -- 0:00:44
278000 -- (-415.367) [-420.867] (-415.385) (-420.805) * (-419.974) [-418.246] (-418.227) (-418.217) -- 0:00:44
278500 -- (-418.128) (-416.966) [-418.518] (-415.099) * (-419.027) (-415.620) [-417.490] (-419.742) -- 0:00:44
279000 -- (-417.771) (-416.078) [-415.093] (-415.352) * (-419.702) [-417.637] (-417.629) (-414.828) -- 0:00:43
279500 -- (-415.130) [-416.042] (-415.814) (-418.127) * (-419.700) (-418.404) (-416.803) [-415.057] -- 0:00:43
280000 -- (-417.174) (-416.096) [-416.517] (-421.266) * (-416.285) (-417.182) [-418.464] (-415.560) -- 0:00:43
Average standard deviation of split frequencies: 0.012745
280500 -- (-417.626) (-418.075) [-414.899] (-418.711) * (-415.515) (-417.267) (-419.080) [-416.498] -- 0:00:43
281000 -- [-416.054] (-422.829) (-416.236) (-422.280) * [-421.788] (-415.714) (-417.810) (-415.632) -- 0:00:43
281500 -- [-415.257] (-416.283) (-420.118) (-419.605) * (-416.510) [-416.400] (-415.353) (-416.286) -- 0:00:43
282000 -- [-417.346] (-416.800) (-417.992) (-416.560) * (-416.823) (-416.530) [-419.781] (-415.604) -- 0:00:45
282500 -- (-421.588) (-417.854) (-415.708) [-416.425] * [-419.707] (-417.071) (-417.745) (-417.621) -- 0:00:45
283000 -- (-417.304) (-415.687) (-416.324) [-415.383] * (-416.334) [-416.753] (-420.035) (-419.124) -- 0:00:45
283500 -- (-416.958) (-416.187) [-415.577] (-415.063) * (-417.421) (-416.663) [-415.915] (-417.179) -- 0:00:45
284000 -- (-417.338) (-418.546) (-419.325) [-419.354] * [-415.567] (-416.042) (-415.745) (-416.871) -- 0:00:45
284500 -- (-424.785) (-416.723) (-418.363) [-415.976] * (-415.571) [-417.328] (-421.957) (-416.401) -- 0:00:45
285000 -- [-419.254] (-416.462) (-416.047) (-416.524) * (-416.911) (-415.492) (-416.191) [-415.726] -- 0:00:45
Average standard deviation of split frequencies: 0.011172
285500 -- (-416.441) (-416.140) [-416.329] (-416.690) * (-416.141) [-416.826] (-429.533) (-415.941) -- 0:00:45
286000 -- (-416.780) [-414.725] (-414.637) (-418.870) * (-419.923) [-415.086] (-421.743) (-416.152) -- 0:00:44
286500 -- (-415.562) [-416.030] (-415.198) (-417.214) * (-416.995) (-415.445) (-416.785) [-418.187] -- 0:00:44
287000 -- [-415.069] (-420.375) (-415.165) (-419.897) * (-418.312) (-417.806) (-416.064) [-416.788] -- 0:00:44
287500 -- (-420.836) (-418.216) [-415.724] (-419.235) * [-421.240] (-417.078) (-416.231) (-416.036) -- 0:00:44
288000 -- (-422.894) (-418.246) (-415.513) [-418.890] * (-418.251) (-416.996) (-417.632) [-415.367] -- 0:00:44
288500 -- [-418.237] (-422.718) (-418.172) (-418.816) * (-418.036) (-416.279) [-421.352] (-420.716) -- 0:00:44
289000 -- (-415.755) [-416.069] (-418.543) (-414.846) * (-416.122) (-416.474) (-419.823) [-416.368] -- 0:00:44
289500 -- [-416.287] (-417.971) (-418.545) (-418.531) * [-417.163] (-417.442) (-415.996) (-415.979) -- 0:00:44
290000 -- [-418.535] (-420.538) (-416.042) (-417.514) * (-415.738) (-418.748) [-416.922] (-415.480) -- 0:00:44
Average standard deviation of split frequencies: 0.010971
290500 -- (-416.035) (-416.350) (-417.497) [-415.285] * (-418.774) [-415.945] (-417.934) (-417.029) -- 0:00:43
291000 -- (-415.961) (-415.824) [-418.416] (-417.077) * (-416.671) (-418.225) (-419.856) [-416.443] -- 0:00:43
291500 -- (-414.760) (-417.850) [-416.874] (-417.039) * (-416.020) (-417.553) (-418.982) [-416.979] -- 0:00:43
292000 -- (-419.288) (-422.035) [-415.418] (-418.660) * (-418.833) [-415.942] (-417.009) (-421.950) -- 0:00:43
292500 -- (-420.447) [-416.523] (-418.837) (-421.155) * (-419.074) (-415.343) [-418.093] (-419.236) -- 0:00:43
293000 -- (-418.435) (-416.077) (-416.471) [-414.964] * (-419.170) (-415.918) (-416.452) [-419.171] -- 0:00:43
293500 -- (-416.833) (-419.881) [-415.442] (-417.593) * (-416.732) [-417.661] (-418.530) (-416.834) -- 0:00:43
294000 -- (-415.857) (-417.756) (-415.169) [-415.140] * (-417.231) (-416.449) (-417.636) [-418.484] -- 0:00:43
294500 -- (-414.846) (-423.040) (-417.106) [-416.529] * (-419.200) (-419.450) [-416.355] (-416.028) -- 0:00:43
295000 -- (-417.947) (-416.138) [-416.321] (-416.143) * (-416.327) (-415.668) (-419.483) [-416.793] -- 0:00:43
Average standard deviation of split frequencies: 0.009274
295500 -- (-417.285) [-418.642] (-419.414) (-420.143) * [-415.219] (-415.659) (-415.421) (-419.798) -- 0:00:42
296000 -- (-415.806) [-416.213] (-417.088) (-414.851) * [-417.292] (-418.321) (-417.506) (-416.314) -- 0:00:42
296500 -- (-418.780) [-414.623] (-415.407) (-417.204) * (-419.594) [-416.345] (-418.591) (-417.136) -- 0:00:42
297000 -- [-418.025] (-421.993) (-417.526) (-417.687) * (-417.599) [-416.736] (-416.422) (-418.805) -- 0:00:42
297500 -- (-419.817) (-424.955) (-415.209) [-417.188] * (-415.888) (-416.765) [-417.300] (-417.999) -- 0:00:42
298000 -- (-415.547) (-424.193) (-420.725) [-415.347] * [-417.432] (-416.043) (-415.741) (-418.941) -- 0:00:42
298500 -- [-417.657] (-416.696) (-414.892) (-415.361) * (-416.064) [-419.272] (-416.170) (-415.518) -- 0:00:42
299000 -- (-419.462) (-416.644) [-416.858] (-415.635) * (-415.981) [-415.416] (-415.902) (-417.718) -- 0:00:44
299500 -- (-417.873) (-416.907) (-415.608) [-416.576] * (-416.078) (-416.671) (-416.084) [-416.729] -- 0:00:44
300000 -- [-415.400] (-416.084) (-415.018) (-416.234) * (-422.215) [-418.387] (-415.273) (-416.300) -- 0:00:44
Average standard deviation of split frequencies: 0.008669
300500 -- [-414.981] (-417.110) (-415.240) (-417.802) * (-421.342) (-415.564) [-416.611] (-416.141) -- 0:00:44
301000 -- (-418.171) [-415.507] (-419.172) (-416.819) * (-417.365) [-415.329] (-420.112) (-422.018) -- 0:00:44
301500 -- (-417.763) [-422.130] (-417.093) (-417.214) * (-418.526) (-415.414) [-417.776] (-418.961) -- 0:00:44
302000 -- [-417.738] (-419.527) (-417.679) (-417.353) * [-417.220] (-418.482) (-415.846) (-421.505) -- 0:00:43
302500 -- (-421.798) (-415.768) [-416.474] (-415.873) * [-417.406] (-418.946) (-415.114) (-416.415) -- 0:00:43
303000 -- (-417.717) [-415.029] (-415.616) (-415.617) * [-415.281] (-417.049) (-419.752) (-422.965) -- 0:00:43
303500 -- (-422.742) (-422.213) [-414.858] (-418.234) * (-417.935) (-416.457) [-416.455] (-416.741) -- 0:00:43
304000 -- (-418.536) (-419.675) [-415.418] (-415.561) * (-417.725) (-420.639) [-415.973] (-416.729) -- 0:00:43
304500 -- (-416.584) (-420.627) [-416.222] (-419.747) * (-417.851) (-420.701) [-418.059] (-416.942) -- 0:00:43
305000 -- (-415.715) (-420.384) [-417.352] (-418.307) * (-418.745) [-419.185] (-420.313) (-416.086) -- 0:00:43
Average standard deviation of split frequencies: 0.009500
305500 -- (-418.349) [-415.627] (-422.055) (-419.683) * [-416.985] (-416.205) (-417.131) (-416.162) -- 0:00:43
306000 -- [-419.587] (-416.446) (-417.474) (-415.983) * (-414.868) (-417.696) [-419.711] (-416.210) -- 0:00:43
306500 -- (-416.892) (-419.593) (-415.455) [-415.945] * (-416.103) [-414.979] (-423.449) (-415.789) -- 0:00:42
307000 -- (-418.784) (-415.612) [-417.676] (-416.857) * (-418.482) [-415.556] (-422.920) (-418.416) -- 0:00:42
307500 -- [-415.351] (-418.276) (-419.466) (-417.287) * [-417.524] (-416.603) (-416.678) (-417.116) -- 0:00:42
308000 -- [-418.544] (-415.926) (-417.883) (-419.642) * (-420.386) (-416.504) [-416.437] (-422.099) -- 0:00:42
308500 -- (-420.140) (-416.422) [-419.203] (-418.088) * (-417.695) (-415.493) (-418.280) [-416.578] -- 0:00:42
309000 -- [-417.780] (-417.556) (-416.981) (-415.301) * [-416.157] (-416.031) (-417.348) (-415.572) -- 0:00:42
309500 -- (-415.314) [-421.348] (-416.871) (-415.685) * (-415.654) [-416.579] (-415.440) (-416.085) -- 0:00:42
310000 -- [-415.271] (-418.694) (-420.483) (-417.787) * [-419.409] (-418.654) (-417.219) (-417.255) -- 0:00:42
Average standard deviation of split frequencies: 0.009640
310500 -- [-421.384] (-416.939) (-425.118) (-414.961) * [-416.034] (-417.567) (-417.805) (-421.172) -- 0:00:42
311000 -- (-418.577) (-419.901) (-418.576) [-415.188] * [-418.015] (-417.645) (-414.857) (-417.014) -- 0:00:42
311500 -- [-416.735] (-422.567) (-419.443) (-415.255) * (-420.150) (-418.208) (-415.399) [-417.630] -- 0:00:41
312000 -- (-419.045) (-414.594) (-420.954) [-415.632] * (-415.660) (-416.935) (-417.021) [-415.913] -- 0:00:41
312500 -- (-418.066) (-418.573) (-415.754) [-417.917] * (-417.975) (-418.049) (-416.753) [-417.169] -- 0:00:41
313000 -- (-417.648) [-419.332] (-418.588) (-419.337) * (-416.712) (-417.262) [-415.534] (-420.502) -- 0:00:41
313500 -- (-417.482) [-417.617] (-420.246) (-418.050) * (-415.043) (-418.153) [-415.030] (-416.369) -- 0:00:41
314000 -- (-419.980) (-420.657) (-418.388) [-417.533] * (-415.448) (-415.280) [-416.439] (-416.021) -- 0:00:41
314500 -- (-417.035) (-415.625) [-416.760] (-415.516) * [-417.784] (-417.223) (-418.465) (-419.498) -- 0:00:41
315000 -- (-420.416) [-416.814] (-417.056) (-416.453) * (-415.100) (-416.220) (-419.938) [-416.996] -- 0:00:41
Average standard deviation of split frequencies: 0.009828
315500 -- (-418.103) (-417.226) [-416.116] (-417.508) * (-418.446) (-415.248) [-419.389] (-415.815) -- 0:00:41
316000 -- (-419.163) (-422.918) [-420.233] (-416.669) * (-417.410) (-414.983) (-415.376) [-418.491] -- 0:00:43
316500 -- (-416.605) [-417.430] (-421.378) (-417.991) * (-418.495) (-418.349) (-415.579) [-418.469] -- 0:00:43
317000 -- (-417.591) [-416.370] (-416.662) (-417.762) * (-420.042) (-415.648) (-416.266) [-419.738] -- 0:00:43
317500 -- (-415.277) [-415.552] (-416.859) (-420.430) * [-418.211] (-420.743) (-416.578) (-417.623) -- 0:00:42
318000 -- (-416.710) (-414.672) [-418.100] (-417.165) * [-417.644] (-419.379) (-417.734) (-415.694) -- 0:00:42
318500 -- (-414.920) (-416.413) (-419.489) [-416.817] * (-420.990) [-419.481] (-419.089) (-417.593) -- 0:00:42
319000 -- (-418.142) (-416.906) [-419.242] (-416.094) * (-418.227) (-419.427) (-416.572) [-418.496] -- 0:00:42
319500 -- [-417.490] (-415.389) (-418.020) (-423.079) * [-415.759] (-415.125) (-415.847) (-417.009) -- 0:00:42
320000 -- (-416.750) [-418.895] (-417.309) (-418.809) * [-414.982] (-416.273) (-416.491) (-419.014) -- 0:00:42
Average standard deviation of split frequencies: 0.009280
320500 -- (-417.338) (-417.801) (-419.789) [-415.806] * [-416.816] (-415.603) (-415.755) (-415.793) -- 0:00:42
321000 -- (-417.750) [-416.417] (-417.564) (-416.061) * (-414.845) (-416.545) [-416.319] (-417.229) -- 0:00:42
321500 -- (-416.977) (-420.388) (-418.013) [-416.473] * [-415.369] (-418.122) (-416.876) (-415.858) -- 0:00:42
322000 -- (-415.578) [-415.513] (-418.502) (-416.889) * (-416.620) (-415.740) [-416.229] (-416.421) -- 0:00:42
322500 -- [-417.165] (-419.657) (-414.951) (-418.063) * (-419.446) [-416.497] (-416.525) (-419.889) -- 0:00:42
323000 -- (-418.644) (-417.627) [-415.711] (-417.474) * (-419.154) (-416.462) (-417.218) [-417.109] -- 0:00:41
323500 -- [-418.536] (-416.920) (-415.733) (-417.692) * (-419.173) (-416.361) [-417.450] (-420.535) -- 0:00:41
324000 -- (-418.795) [-415.417] (-420.774) (-418.761) * [-415.708] (-417.192) (-417.451) (-415.626) -- 0:00:41
324500 -- (-418.534) (-417.729) [-416.001] (-416.223) * (-415.998) (-420.080) (-417.954) [-416.405] -- 0:00:41
325000 -- [-416.622] (-415.416) (-418.589) (-420.000) * (-418.662) (-417.931) (-419.415) [-416.161] -- 0:00:41
Average standard deviation of split frequencies: 0.009761
325500 -- (-416.952) [-417.277] (-416.386) (-416.720) * (-414.978) (-416.538) (-419.705) [-416.475] -- 0:00:41
326000 -- (-416.384) (-416.739) [-418.469] (-417.697) * (-418.347) (-419.063) (-415.531) [-418.230] -- 0:00:41
326500 -- (-417.584) (-418.797) (-415.763) [-417.238] * [-416.662] (-415.573) (-418.006) (-417.575) -- 0:00:41
327000 -- [-419.297] (-419.986) (-415.637) (-419.359) * (-414.775) (-418.927) [-417.736] (-417.200) -- 0:00:41
327500 -- [-415.331] (-416.847) (-421.739) (-419.303) * (-419.056) (-421.711) (-417.855) [-416.229] -- 0:00:41
328000 -- (-416.810) [-416.005] (-416.620) (-416.720) * [-418.444] (-417.361) (-417.609) (-423.443) -- 0:00:40
328500 -- (-417.751) [-420.075] (-415.985) (-420.241) * (-419.036) (-419.837) (-415.776) [-418.591] -- 0:00:40
329000 -- (-417.665) (-419.178) (-416.066) [-417.870] * (-422.969) [-418.797] (-415.559) (-416.080) -- 0:00:40
329500 -- [-418.733] (-419.374) (-416.290) (-414.940) * (-416.591) (-415.295) (-418.723) [-417.899] -- 0:00:40
330000 -- (-416.004) [-415.040] (-419.091) (-414.799) * [-417.090] (-417.290) (-417.845) (-418.744) -- 0:00:40
Average standard deviation of split frequencies: 0.009534
330500 -- (-417.038) (-415.774) [-419.332] (-418.845) * (-415.489) [-417.565] (-418.354) (-418.766) -- 0:00:40
331000 -- (-417.258) (-416.907) (-415.636) [-419.649] * [-416.016] (-415.183) (-420.836) (-415.246) -- 0:00:40
331500 -- (-415.938) (-416.965) (-417.095) [-415.027] * (-418.649) [-415.125] (-418.594) (-416.425) -- 0:00:40
332000 -- (-417.747) (-417.898) [-421.650] (-417.260) * (-416.272) [-417.765] (-415.649) (-417.816) -- 0:00:40
332500 -- [-418.269] (-414.987) (-419.024) (-417.939) * (-417.592) (-418.202) [-415.188] (-416.459) -- 0:00:42
333000 -- (-415.970) [-417.754] (-419.791) (-418.164) * (-416.706) [-418.060] (-416.839) (-416.388) -- 0:00:42
333500 -- [-414.866] (-416.348) (-417.651) (-417.967) * [-417.139] (-416.462) (-420.369) (-415.102) -- 0:00:41
334000 -- [-417.605] (-416.434) (-417.480) (-415.010) * [-415.623] (-417.119) (-415.856) (-418.724) -- 0:00:41
334500 -- [-416.328] (-417.501) (-421.257) (-415.178) * (-416.304) (-417.369) (-414.870) [-420.042] -- 0:00:41
335000 -- (-417.614) (-416.854) (-417.116) [-418.504] * [-418.498] (-418.623) (-419.603) (-419.058) -- 0:00:41
Average standard deviation of split frequencies: 0.009382
335500 -- (-416.155) [-415.434] (-415.631) (-418.034) * (-417.777) [-419.990] (-416.129) (-417.920) -- 0:00:41
336000 -- (-417.816) (-416.004) [-417.494] (-418.642) * (-417.824) [-417.084] (-417.787) (-417.586) -- 0:00:41
336500 -- [-415.755] (-422.642) (-418.196) (-419.281) * [-417.025] (-417.169) (-421.005) (-416.726) -- 0:00:41
337000 -- (-418.543) (-416.837) (-419.455) [-419.625] * [-420.044] (-418.415) (-416.908) (-415.670) -- 0:00:41
337500 -- (-415.344) (-416.979) (-415.236) [-415.620] * (-417.915) (-416.414) [-416.477] (-415.071) -- 0:00:41
338000 -- (-416.430) [-417.186] (-415.160) (-416.221) * (-416.966) (-415.663) (-419.146) [-415.380] -- 0:00:41
338500 -- [-416.608] (-419.369) (-415.950) (-417.217) * (-419.748) (-416.632) (-416.560) [-416.378] -- 0:00:41
339000 -- [-415.269] (-419.604) (-415.690) (-415.604) * [-414.915] (-415.986) (-414.839) (-415.011) -- 0:00:40
339500 -- (-414.884) (-416.967) (-416.746) [-415.250] * (-416.336) (-416.800) [-417.064] (-415.950) -- 0:00:40
340000 -- (-415.171) [-415.686] (-415.732) (-416.037) * (-419.668) (-418.475) (-416.195) [-418.484] -- 0:00:40
Average standard deviation of split frequencies: 0.009946
340500 -- (-415.072) [-418.670] (-420.258) (-418.570) * (-420.824) [-418.439] (-415.430) (-415.913) -- 0:00:40
341000 -- (-417.296) (-414.950) (-424.286) [-417.467] * (-420.882) [-417.420] (-415.723) (-420.959) -- 0:00:40
341500 -- (-416.528) (-418.930) (-416.788) [-418.735] * (-417.901) [-416.757] (-415.514) (-416.068) -- 0:00:40
342000 -- [-417.462] (-416.911) (-416.565) (-415.993) * (-419.746) (-418.811) [-417.556] (-417.274) -- 0:00:40
342500 -- [-419.137] (-417.844) (-415.201) (-415.769) * (-417.645) [-417.534] (-417.502) (-415.801) -- 0:00:40
343000 -- [-416.092] (-417.210) (-415.311) (-417.687) * (-415.587) [-415.035] (-419.053) (-419.332) -- 0:00:40
343500 -- (-416.541) (-417.447) [-415.289] (-414.922) * [-415.085] (-417.261) (-416.002) (-420.286) -- 0:00:40
344000 -- [-417.642] (-418.710) (-414.934) (-418.091) * (-418.629) (-417.625) (-415.388) [-417.072] -- 0:00:40
344500 -- [-416.162] (-417.942) (-416.827) (-419.123) * [-416.116] (-418.098) (-419.577) (-415.684) -- 0:00:39
345000 -- (-417.634) [-416.484] (-416.150) (-420.846) * [-417.826] (-418.449) (-417.193) (-417.377) -- 0:00:39
Average standard deviation of split frequencies: 0.010499
345500 -- (-420.033) (-417.564) [-418.273] (-415.269) * (-418.321) (-416.384) (-417.284) [-416.825] -- 0:00:39
346000 -- (-416.530) [-415.832] (-418.106) (-415.053) * (-416.914) (-415.753) [-419.313] (-417.910) -- 0:00:39
346500 -- (-419.094) [-417.791] (-418.047) (-422.368) * [-416.864] (-419.465) (-415.884) (-417.103) -- 0:00:39
347000 -- (-418.780) (-418.995) [-418.261] (-416.189) * (-416.633) [-416.560] (-418.242) (-416.301) -- 0:00:39
347500 -- (-419.016) (-418.968) [-418.938] (-416.938) * [-415.259] (-418.278) (-420.161) (-415.435) -- 0:00:39
348000 -- (-416.569) [-416.466] (-414.667) (-417.574) * [-415.604] (-417.021) (-416.716) (-416.566) -- 0:00:39
348500 -- [-415.284] (-420.463) (-415.630) (-415.100) * (-415.799) [-416.226] (-421.016) (-421.973) -- 0:00:39
349000 -- [-416.294] (-416.054) (-416.933) (-415.530) * (-416.213) (-416.018) (-420.325) [-415.979] -- 0:00:39
349500 -- [-417.183] (-416.613) (-420.287) (-421.500) * [-416.871] (-415.566) (-418.625) (-419.355) -- 0:00:39
350000 -- (-422.495) [-417.657] (-416.753) (-416.665) * (-416.848) [-416.567] (-416.419) (-416.700) -- 0:00:40
Average standard deviation of split frequencies: 0.011308
350500 -- (-414.850) [-417.608] (-421.551) (-419.040) * (-419.724) (-417.136) [-417.466] (-417.904) -- 0:00:40
351000 -- (-416.363) [-415.897] (-416.894) (-416.188) * (-418.572) [-418.308] (-416.717) (-416.243) -- 0:00:40
351500 -- (-418.089) [-419.811] (-415.937) (-418.703) * (-415.683) (-416.092) (-415.855) [-415.573] -- 0:00:40
352000 -- [-416.552] (-417.013) (-417.027) (-417.097) * [-417.066] (-420.279) (-415.914) (-419.371) -- 0:00:40
352500 -- (-417.504) (-418.213) (-416.861) [-417.451] * (-416.760) (-417.378) [-415.674] (-414.862) -- 0:00:40
353000 -- (-416.224) (-415.608) [-415.633] (-418.765) * (-417.251) (-419.349) [-419.022] (-415.496) -- 0:00:40
353500 -- [-418.229] (-417.792) (-417.241) (-418.988) * (-415.158) (-417.569) (-417.658) [-415.529] -- 0:00:40
354000 -- [-416.877] (-415.240) (-415.984) (-416.518) * (-415.406) (-416.565) (-418.136) [-414.984] -- 0:00:40
354500 -- (-415.874) (-414.778) [-415.740] (-416.502) * (-418.404) [-418.612] (-418.125) (-415.068) -- 0:00:40
355000 -- [-416.124] (-415.881) (-416.780) (-416.743) * (-415.583) (-414.955) [-420.992] (-417.400) -- 0:00:39
Average standard deviation of split frequencies: 0.010048
355500 -- (-419.867) (-421.334) [-419.515] (-417.216) * (-416.014) [-418.146] (-416.828) (-415.980) -- 0:00:39
356000 -- [-415.032] (-416.484) (-416.983) (-416.320) * (-416.637) (-415.361) (-415.825) [-415.851] -- 0:00:39
356500 -- [-417.183] (-415.508) (-416.903) (-415.723) * (-415.178) [-420.254] (-416.720) (-419.460) -- 0:00:39
357000 -- (-416.455) [-417.729] (-416.691) (-416.294) * [-416.652] (-417.525) (-417.502) (-415.994) -- 0:00:39
357500 -- (-415.869) (-417.665) (-417.225) [-416.213] * (-418.864) [-415.871] (-418.073) (-415.823) -- 0:00:39
358000 -- [-416.941] (-416.572) (-418.809) (-416.452) * [-417.224] (-416.589) (-416.938) (-417.905) -- 0:00:39
358500 -- (-416.035) (-417.496) (-418.598) [-417.131] * (-418.706) (-421.348) [-415.426] (-420.204) -- 0:00:39
359000 -- [-417.927] (-419.439) (-414.922) (-416.308) * [-417.437] (-423.843) (-420.234) (-415.571) -- 0:00:39
359500 -- (-418.134) [-417.207] (-414.825) (-414.943) * (-415.592) [-419.437] (-415.315) (-415.527) -- 0:00:39
360000 -- [-415.278] (-417.650) (-415.916) (-415.694) * (-414.902) (-416.032) (-415.105) [-415.073] -- 0:00:39
Average standard deviation of split frequencies: 0.009764
360500 -- [-414.987] (-415.830) (-416.897) (-416.291) * (-416.335) (-417.987) [-415.659] (-417.641) -- 0:00:39
361000 -- (-415.938) (-415.219) [-420.062] (-417.052) * (-416.398) (-416.866) (-418.462) [-416.980] -- 0:00:38
361500 -- (-414.764) [-416.706] (-416.378) (-416.947) * (-416.224) (-417.958) (-417.904) [-416.413] -- 0:00:38
362000 -- [-417.462] (-417.654) (-415.956) (-418.115) * (-417.159) (-416.334) [-416.972] (-419.114) -- 0:00:38
362500 -- [-420.479] (-420.974) (-417.312) (-418.273) * (-416.849) [-418.286] (-415.236) (-417.319) -- 0:00:38
363000 -- (-416.448) (-416.911) [-415.021] (-415.962) * [-415.858] (-415.875) (-415.834) (-416.565) -- 0:00:38
363500 -- [-418.901] (-414.964) (-416.366) (-421.868) * [-417.659] (-416.070) (-417.002) (-415.190) -- 0:00:38
364000 -- [-416.711] (-416.548) (-417.650) (-415.877) * (-417.436) (-419.109) [-415.348] (-415.080) -- 0:00:38
364500 -- [-417.820] (-416.773) (-419.057) (-418.256) * (-417.394) (-420.021) [-415.419] (-415.663) -- 0:00:38
365000 -- [-417.772] (-420.132) (-415.729) (-416.839) * (-416.898) [-418.743] (-419.849) (-415.502) -- 0:00:38
Average standard deviation of split frequencies: 0.010447
365500 -- [-416.503] (-416.082) (-415.354) (-416.897) * (-416.601) [-417.781] (-418.041) (-417.313) -- 0:00:38
366000 -- (-418.018) (-417.211) [-419.968] (-416.482) * (-417.286) [-417.958] (-415.987) (-417.531) -- 0:00:38
366500 -- (-416.362) [-419.310] (-416.441) (-418.338) * (-416.055) [-416.723] (-417.011) (-419.767) -- 0:00:39
367000 -- (-422.548) (-415.926) [-417.870] (-416.663) * (-416.378) (-415.081) (-420.542) [-415.521] -- 0:00:39
367500 -- (-416.774) (-416.404) [-415.006] (-416.720) * (-416.265) (-416.183) [-416.724] (-418.791) -- 0:00:39
368000 -- (-419.070) (-417.768) (-415.076) [-416.965] * (-419.024) (-417.807) (-417.680) [-416.864] -- 0:00:39
368500 -- (-415.909) [-417.633] (-415.605) (-417.583) * (-418.507) (-415.802) (-415.787) [-415.543] -- 0:00:39
369000 -- (-416.745) [-416.831] (-417.757) (-418.879) * (-414.982) (-415.382) [-419.391] (-416.765) -- 0:00:39
369500 -- (-415.701) (-415.969) (-419.694) [-418.594] * (-416.968) (-417.291) (-417.585) [-417.989] -- 0:00:39
370000 -- (-415.510) [-414.763] (-416.722) (-418.342) * (-415.630) (-418.696) [-418.742] (-416.142) -- 0:00:39
Average standard deviation of split frequencies: 0.009426
370500 -- (-416.629) (-414.760) [-416.356] (-416.971) * (-416.411) (-416.131) (-418.865) [-418.873] -- 0:00:39
371000 -- (-415.608) (-415.862) [-417.171] (-418.915) * [-416.357] (-416.339) (-415.658) (-419.380) -- 0:00:38
371500 -- (-417.902) (-415.804) [-420.340] (-414.986) * (-417.649) (-416.879) (-417.685) [-417.395] -- 0:00:38
372000 -- (-416.434) [-417.040] (-416.367) (-415.993) * (-417.752) [-417.168] (-417.483) (-415.517) -- 0:00:38
372500 -- (-416.926) (-416.379) [-415.907] (-417.041) * (-417.118) (-416.407) [-415.158] (-417.546) -- 0:00:38
373000 -- (-414.930) (-419.327) [-415.223] (-416.789) * (-420.789) (-419.652) (-415.250) [-414.930] -- 0:00:38
373500 -- (-418.039) (-417.917) (-416.077) [-416.016] * (-418.455) [-419.983] (-419.562) (-417.280) -- 0:00:38
374000 -- (-416.243) (-415.429) (-418.140) [-415.331] * [-419.637] (-417.221) (-418.764) (-415.513) -- 0:00:38
374500 -- [-418.815] (-418.979) (-419.502) (-421.589) * (-417.399) (-416.152) (-417.797) [-417.987] -- 0:00:38
375000 -- [-415.500] (-416.879) (-418.912) (-417.784) * (-415.026) (-416.269) [-417.192] (-418.946) -- 0:00:38
Average standard deviation of split frequencies: 0.009735
375500 -- [-417.204] (-417.464) (-415.339) (-418.891) * (-418.234) [-415.099] (-414.931) (-417.715) -- 0:00:38
376000 -- (-416.253) [-418.540] (-416.043) (-418.845) * [-417.892] (-417.731) (-420.102) (-417.300) -- 0:00:38
376500 -- [-415.069] (-421.021) (-415.428) (-417.350) * (-415.452) [-415.240] (-415.770) (-417.964) -- 0:00:38
377000 -- (-415.041) (-417.034) [-415.580] (-417.063) * (-416.109) (-415.334) (-415.706) [-416.043] -- 0:00:38
377500 -- (-415.543) [-419.431] (-415.240) (-416.905) * (-416.043) (-415.981) [-416.841] (-415.763) -- 0:00:37
378000 -- (-416.636) [-416.526] (-415.138) (-418.624) * [-415.752] (-417.712) (-420.634) (-416.367) -- 0:00:37
378500 -- (-418.254) (-415.869) [-415.596] (-415.733) * (-416.001) [-417.900] (-419.374) (-417.512) -- 0:00:37
379000 -- [-415.293] (-417.112) (-415.596) (-419.824) * [-419.052] (-419.857) (-415.381) (-417.998) -- 0:00:37
379500 -- (-416.851) (-419.467) (-418.509) [-422.650] * (-416.723) (-416.400) [-416.253] (-414.961) -- 0:00:37
380000 -- [-417.204] (-416.508) (-417.663) (-418.425) * (-415.468) (-417.882) [-415.820] (-414.602) -- 0:00:37
Average standard deviation of split frequencies: 0.008960
380500 -- (-416.865) (-415.129) [-417.108] (-414.725) * (-415.906) [-419.118] (-415.658) (-415.132) -- 0:00:37
381000 -- (-417.873) (-418.389) (-416.497) [-415.842] * (-419.092) [-418.063] (-417.556) (-417.443) -- 0:00:37
381500 -- (-416.567) (-418.287) (-414.955) [-414.802] * (-419.852) (-415.506) (-417.206) [-416.036] -- 0:00:37
382000 -- (-416.924) (-419.358) [-421.325] (-417.385) * (-416.572) [-415.687] (-415.229) (-418.587) -- 0:00:37
382500 -- (-415.632) [-419.567] (-416.013) (-416.645) * (-418.523) (-418.472) [-417.859] (-418.651) -- 0:00:37
383000 -- (-417.006) (-416.450) [-420.358] (-421.909) * [-417.364] (-419.036) (-417.119) (-417.186) -- 0:00:37
383500 -- [-416.208] (-415.636) (-415.822) (-417.024) * [-417.563] (-420.638) (-416.904) (-416.835) -- 0:00:38
384000 -- [-415.289] (-415.806) (-416.964) (-417.623) * (-416.555) (-416.104) (-416.330) [-415.428] -- 0:00:38
384500 -- (-416.232) (-416.458) (-417.386) [-416.642] * (-415.050) (-418.580) (-417.102) [-415.491] -- 0:00:38
385000 -- (-416.169) (-417.287) [-416.084] (-416.892) * [-415.238] (-418.296) (-415.498) (-418.442) -- 0:00:38
Average standard deviation of split frequencies: 0.009411
385500 -- (-416.783) (-416.730) (-415.613) [-415.557] * [-417.674] (-417.601) (-414.703) (-418.683) -- 0:00:38
386000 -- [-419.316] (-415.925) (-416.925) (-416.673) * [-421.495] (-416.529) (-417.244) (-417.038) -- 0:00:38
386500 -- (-416.803) (-417.034) [-417.894] (-415.378) * (-416.020) (-418.693) [-416.790] (-416.657) -- 0:00:38
387000 -- (-420.836) [-415.902] (-416.923) (-415.336) * [-418.475] (-416.567) (-418.713) (-418.614) -- 0:00:38
387500 -- (-421.676) (-418.411) [-415.513] (-415.187) * (-416.163) [-416.325] (-418.195) (-418.749) -- 0:00:37
388000 -- (-418.003) [-416.287] (-417.648) (-420.516) * (-415.840) (-418.009) (-418.988) [-416.097] -- 0:00:37
388500 -- (-417.209) (-417.398) (-418.218) [-415.895] * (-415.141) [-415.337] (-415.791) (-417.408) -- 0:00:37
389000 -- (-417.620) [-416.155] (-417.689) (-415.794) * (-415.542) [-416.288] (-417.893) (-416.971) -- 0:00:37
389500 -- [-419.015] (-416.317) (-420.630) (-415.271) * (-416.231) (-415.588) (-415.645) [-417.758] -- 0:00:37
390000 -- [-415.866] (-417.396) (-417.502) (-415.234) * (-417.580) [-415.882] (-420.355) (-415.076) -- 0:00:37
Average standard deviation of split frequencies: 0.008731
390500 -- (-418.024) (-417.351) [-416.690] (-415.191) * (-420.495) [-416.337] (-422.725) (-417.453) -- 0:00:37
391000 -- [-417.025] (-417.627) (-418.072) (-414.842) * (-417.626) (-416.500) [-417.580] (-418.832) -- 0:00:37
391500 -- (-415.610) (-417.047) (-418.485) [-416.450] * (-420.059) [-419.811] (-417.825) (-416.526) -- 0:00:37
392000 -- [-418.007] (-416.056) (-417.136) (-415.329) * (-416.025) (-419.321) [-417.451] (-417.824) -- 0:00:37
392500 -- (-422.050) (-415.986) [-415.995] (-416.408) * (-417.594) (-414.676) [-414.914] (-418.391) -- 0:00:37
393000 -- (-417.495) [-416.194] (-416.540) (-416.500) * (-416.528) [-415.159] (-418.545) (-417.157) -- 0:00:37
393500 -- [-417.027] (-423.676) (-419.597) (-418.893) * (-419.222) (-419.702) [-416.774] (-416.895) -- 0:00:36
394000 -- [-417.733] (-418.566) (-421.423) (-419.053) * (-418.291) [-417.002] (-415.137) (-415.872) -- 0:00:36
394500 -- (-418.093) (-417.470) (-419.888) [-415.503] * (-415.773) (-414.939) (-425.186) [-417.645] -- 0:00:36
395000 -- (-421.568) [-417.116] (-415.600) (-416.007) * (-416.495) (-415.975) (-417.928) [-415.673] -- 0:00:36
Average standard deviation of split frequencies: 0.008263
395500 -- (-415.753) [-416.281] (-417.397) (-415.155) * [-416.608] (-416.685) (-416.145) (-416.436) -- 0:00:36
396000 -- (-417.579) [-420.855] (-418.988) (-416.443) * (-416.599) [-417.064] (-415.762) (-418.711) -- 0:00:36
396500 -- (-417.447) (-417.349) [-418.151] (-415.112) * (-415.794) (-417.885) (-417.512) [-415.460] -- 0:00:36
397000 -- (-418.221) (-418.175) (-416.375) [-416.552] * (-416.558) (-419.008) (-417.585) [-415.324] -- 0:00:36
397500 -- (-418.029) (-423.113) [-416.568] (-416.612) * (-417.736) (-418.973) [-416.184] (-415.937) -- 0:00:36
398000 -- (-419.365) (-417.902) [-416.612] (-416.402) * (-417.261) (-418.656) [-414.918] (-415.940) -- 0:00:36
398500 -- [-417.015] (-419.708) (-417.579) (-415.878) * (-418.777) (-421.082) [-415.568] (-415.998) -- 0:00:36
399000 -- (-417.058) (-421.831) (-414.972) [-418.746] * (-414.751) (-416.685) (-414.641) [-416.239] -- 0:00:36
399500 -- (-417.250) [-415.937] (-415.113) (-416.403) * [-416.591] (-419.596) (-416.406) (-418.340) -- 0:00:36
400000 -- (-419.263) (-416.498) (-415.425) [-417.350] * [-417.978] (-417.715) (-415.270) (-420.616) -- 0:00:36
Average standard deviation of split frequencies: 0.007959
400500 -- (-420.763) (-416.064) [-415.556] (-415.625) * (-419.477) (-414.805) [-417.421] (-418.438) -- 0:00:37
401000 -- (-415.687) (-418.633) (-416.666) [-415.063] * [-415.189] (-414.728) (-421.710) (-418.116) -- 0:00:37
401500 -- (-421.553) (-418.122) [-415.975] (-417.570) * (-415.634) [-417.190] (-416.862) (-420.622) -- 0:00:37
402000 -- (-416.902) (-417.054) (-417.941) [-417.603] * (-418.799) [-415.875] (-417.874) (-416.295) -- 0:00:37
402500 -- (-415.714) (-423.758) [-418.522] (-418.220) * (-417.613) (-416.434) (-419.596) [-416.003] -- 0:00:37
403000 -- (-416.368) (-421.096) [-417.438] (-416.621) * (-418.746) (-418.094) (-416.038) [-416.585] -- 0:00:37
403500 -- (-415.719) [-426.139] (-418.585) (-418.628) * (-419.621) (-417.579) (-415.225) [-415.005] -- 0:00:36
404000 -- (-418.438) [-419.676] (-416.554) (-416.569) * (-417.256) (-417.736) [-416.887] (-417.441) -- 0:00:36
404500 -- [-416.030] (-417.495) (-416.238) (-420.661) * (-419.206) (-416.150) [-416.186] (-414.986) -- 0:00:36
405000 -- (-421.419) (-419.561) (-414.635) [-416.447] * (-426.046) (-415.891) [-416.918] (-416.471) -- 0:00:36
Average standard deviation of split frequencies: 0.008811
405500 -- (-419.055) (-417.353) [-415.804] (-419.067) * (-418.066) (-416.939) (-416.677) [-417.547] -- 0:00:36
406000 -- (-417.130) [-416.775] (-415.430) (-421.589) * (-417.487) (-417.557) [-416.841] (-414.796) -- 0:00:36
406500 -- [-417.164] (-416.498) (-415.097) (-415.502) * (-417.875) [-415.948] (-418.895) (-415.100) -- 0:00:36
407000 -- (-419.452) [-416.642] (-415.397) (-416.707) * (-416.448) (-416.190) [-415.665] (-420.638) -- 0:00:36
407500 -- (-417.489) [-416.959] (-417.861) (-417.811) * (-414.968) (-416.904) [-416.301] (-414.928) -- 0:00:36
408000 -- [-417.137] (-417.650) (-418.394) (-418.321) * (-417.920) (-415.949) [-418.633] (-416.097) -- 0:00:36
408500 -- (-417.817) (-418.818) [-416.126] (-417.405) * (-416.440) (-418.021) (-417.077) [-417.200] -- 0:00:36
409000 -- (-417.697) [-418.018] (-416.069) (-419.324) * (-418.729) (-414.949) (-416.103) [-416.353] -- 0:00:36
409500 -- [-415.142] (-419.727) (-417.929) (-419.866) * (-417.782) (-417.691) (-416.693) [-416.495] -- 0:00:36
410000 -- (-415.377) (-415.502) [-418.693] (-419.004) * [-415.765] (-419.129) (-416.304) (-417.674) -- 0:00:35
Average standard deviation of split frequencies: 0.009318
410500 -- (-418.303) [-415.079] (-415.828) (-419.157) * (-417.325) (-418.325) (-418.035) [-417.446] -- 0:00:35
411000 -- (-415.209) (-420.516) [-418.607] (-415.835) * (-416.912) (-415.942) (-420.712) [-416.064] -- 0:00:35
411500 -- (-417.862) [-421.302] (-415.475) (-416.245) * (-416.075) (-416.688) [-419.244] (-415.616) -- 0:00:35
412000 -- (-417.006) [-416.063] (-420.459) (-419.116) * [-415.286] (-420.120) (-415.734) (-418.306) -- 0:00:35
412500 -- (-418.190) (-416.979) (-417.523) [-418.742] * [-416.548] (-417.009) (-415.960) (-420.388) -- 0:00:35
413000 -- (-416.501) [-414.709] (-417.736) (-417.503) * (-416.192) [-417.347] (-417.749) (-419.684) -- 0:00:35
413500 -- (-416.785) [-414.777] (-419.611) (-418.155) * (-416.517) (-416.867) [-415.226] (-419.753) -- 0:00:35
414000 -- [-419.557] (-414.804) (-416.502) (-419.699) * [-418.402] (-418.632) (-418.043) (-419.238) -- 0:00:35
414500 -- (-416.664) (-416.668) (-417.037) [-417.634] * (-417.235) (-419.296) (-416.005) [-415.605] -- 0:00:35
415000 -- (-415.635) (-415.259) [-416.351] (-415.894) * (-416.656) [-420.223] (-415.204) (-416.797) -- 0:00:35
Average standard deviation of split frequencies: 0.008999
415500 -- [-414.797] (-417.774) (-418.889) (-417.674) * (-415.404) (-418.314) (-417.335) [-422.135] -- 0:00:35
416000 -- (-417.827) (-418.767) (-416.549) [-418.123] * [-418.006] (-422.482) (-417.232) (-421.202) -- 0:00:35
416500 -- (-422.460) (-415.457) (-415.453) [-415.869] * (-416.858) (-417.218) [-418.467] (-416.324) -- 0:00:35
417000 -- (-417.493) [-416.361] (-416.223) (-417.915) * [-417.036] (-421.335) (-417.443) (-415.387) -- 0:00:34
417500 -- (-417.610) (-415.733) (-415.395) [-420.639] * (-415.661) (-416.370) [-416.797] (-415.759) -- 0:00:36
418000 -- (-421.159) (-417.693) (-419.295) [-418.718] * (-416.245) [-416.319] (-415.842) (-416.282) -- 0:00:36
418500 -- [-417.948] (-416.697) (-417.373) (-418.389) * [-416.787] (-415.274) (-415.713) (-415.508) -- 0:00:36
419000 -- (-417.941) [-415.752] (-416.680) (-418.091) * (-421.635) (-418.712) (-415.538) [-415.033] -- 0:00:36
419500 -- [-415.262] (-420.131) (-414.899) (-416.596) * (-423.383) (-415.882) (-418.266) [-416.903] -- 0:00:35
420000 -- [-416.072] (-417.854) (-415.775) (-417.929) * [-417.155] (-418.057) (-416.978) (-418.307) -- 0:00:35
Average standard deviation of split frequencies: 0.010020
420500 -- (-416.371) [-417.721] (-419.759) (-416.511) * (-416.141) (-416.151) [-418.114] (-417.142) -- 0:00:35
421000 -- [-416.852] (-416.933) (-416.972) (-416.378) * (-416.438) [-416.733] (-417.555) (-415.838) -- 0:00:35
421500 -- (-417.210) (-415.596) [-416.235] (-417.922) * (-415.502) (-418.413) (-416.284) [-417.616] -- 0:00:35
422000 -- [-416.555] (-418.122) (-419.091) (-417.930) * [-415.845] (-419.162) (-416.712) (-415.118) -- 0:00:35
422500 -- (-417.798) (-419.705) (-420.034) [-423.970] * (-417.039) (-415.617) (-415.041) [-415.994] -- 0:00:35
423000 -- (-423.756) [-415.147] (-418.649) (-416.673) * (-421.177) [-418.671] (-415.992) (-418.306) -- 0:00:35
423500 -- (-415.216) [-416.184] (-416.983) (-416.965) * (-414.970) (-415.678) [-416.966] (-417.655) -- 0:00:35
424000 -- (-416.834) [-418.849] (-420.970) (-417.069) * (-416.175) [-416.572] (-418.223) (-418.267) -- 0:00:35
424500 -- (-415.884) (-415.732) (-420.647) [-420.284] * (-417.547) [-415.056] (-417.660) (-418.879) -- 0:00:35
425000 -- (-416.126) [-416.049] (-416.466) (-421.272) * [-415.411] (-415.717) (-417.509) (-415.408) -- 0:00:35
Average standard deviation of split frequencies: 0.009764
425500 -- (-419.278) (-416.507) [-415.408] (-415.508) * (-419.228) (-416.309) [-417.423] (-417.030) -- 0:00:35
426000 -- (-419.317) [-415.086] (-414.904) (-421.187) * (-420.944) (-418.097) (-415.808) [-415.221] -- 0:00:35
426500 -- (-418.990) [-415.916] (-416.903) (-418.875) * (-424.251) (-417.211) (-418.078) [-415.060] -- 0:00:34
427000 -- (-417.722) [-417.154] (-414.968) (-415.705) * (-419.425) (-417.156) (-418.232) [-418.483] -- 0:00:34
427500 -- (-418.250) [-416.174] (-416.085) (-416.911) * [-416.138] (-416.836) (-416.917) (-415.525) -- 0:00:34
428000 -- (-419.251) [-418.531] (-416.708) (-417.054) * (-416.592) (-419.749) [-415.515] (-417.402) -- 0:00:34
428500 -- (-416.833) [-417.096] (-419.390) (-415.443) * (-417.289) (-418.572) [-416.078] (-416.396) -- 0:00:34
429000 -- (-415.072) (-422.201) (-418.583) [-416.026] * [-415.364] (-421.914) (-416.067) (-416.871) -- 0:00:34
429500 -- [-416.815] (-423.398) (-417.506) (-416.680) * (-417.788) (-415.290) [-417.276] (-418.192) -- 0:00:34
430000 -- (-418.122) [-416.271] (-420.276) (-419.305) * (-418.716) (-417.414) [-417.528] (-421.291) -- 0:00:34
Average standard deviation of split frequencies: 0.009061
430500 -- (-417.081) (-415.245) [-417.971] (-421.176) * (-416.155) (-415.529) (-417.138) [-417.404] -- 0:00:34
431000 -- (-415.545) (-416.886) (-421.393) [-418.397] * (-419.334) [-415.255] (-415.816) (-418.026) -- 0:00:34
431500 -- (-416.857) (-416.569) (-415.867) [-418.985] * (-419.757) (-417.296) [-416.014] (-418.763) -- 0:00:34
432000 -- [-418.866] (-416.842) (-415.654) (-418.324) * [-416.077] (-417.498) (-416.631) (-421.861) -- 0:00:34
432500 -- [-416.739] (-416.923) (-415.153) (-416.513) * (-415.008) (-417.461) [-418.083] (-418.910) -- 0:00:34
433000 -- (-417.484) [-415.398] (-417.583) (-420.542) * (-414.803) (-419.174) [-417.326] (-418.279) -- 0:00:34
433500 -- (-418.705) (-416.817) [-415.523] (-415.171) * [-415.086] (-417.169) (-415.622) (-417.902) -- 0:00:33
434000 -- (-415.798) [-416.200] (-416.082) (-416.068) * (-416.624) (-415.255) (-419.089) [-420.312] -- 0:00:33
434500 -- (-415.944) (-416.524) [-416.211] (-415.638) * (-418.182) [-414.767] (-417.135) (-420.067) -- 0:00:35
435000 -- (-416.273) (-421.651) [-415.693] (-416.167) * (-418.183) (-415.495) [-415.924] (-419.514) -- 0:00:35
Average standard deviation of split frequencies: 0.008770
435500 -- (-417.054) (-417.755) (-417.713) [-418.162] * (-416.774) (-415.612) [-419.915] (-420.777) -- 0:00:34
436000 -- (-416.944) (-415.724) [-416.034] (-422.883) * (-415.544) [-416.296] (-416.189) (-417.309) -- 0:00:34
436500 -- (-418.447) (-416.974) [-415.650] (-416.052) * (-417.431) (-415.324) [-414.982] (-416.481) -- 0:00:34
437000 -- (-415.852) [-415.795] (-416.664) (-415.450) * (-415.698) [-416.704] (-415.156) (-416.399) -- 0:00:34
437500 -- (-416.319) (-416.235) (-417.549) [-415.283] * (-417.040) (-421.587) (-416.654) [-416.418] -- 0:00:34
438000 -- [-418.413] (-420.717) (-420.433) (-417.278) * (-419.601) (-419.928) [-420.064] (-415.638) -- 0:00:34
438500 -- [-418.566] (-415.302) (-415.541) (-422.206) * (-414.576) (-416.625) [-415.387] (-415.491) -- 0:00:34
439000 -- (-415.814) (-416.655) [-417.073] (-423.223) * (-415.807) (-416.760) [-415.338] (-417.840) -- 0:00:34
439500 -- (-416.083) [-420.090] (-416.872) (-416.908) * (-417.321) (-417.185) (-418.940) [-416.304] -- 0:00:34
440000 -- (-418.514) (-417.451) [-419.732] (-415.695) * (-418.267) (-416.330) (-416.226) [-415.508] -- 0:00:34
Average standard deviation of split frequencies: 0.009628
440500 -- (-418.496) [-418.686] (-418.436) (-419.476) * [-417.671] (-417.038) (-418.088) (-418.909) -- 0:00:34
441000 -- [-416.091] (-416.959) (-418.909) (-423.393) * (-422.731) (-416.019) (-419.237) [-417.302] -- 0:00:34
441500 -- [-416.431] (-415.645) (-415.977) (-418.384) * (-417.063) (-418.050) [-418.543] (-416.087) -- 0:00:34
442000 -- [-420.211] (-421.438) (-417.577) (-418.285) * (-416.447) (-425.199) [-414.867] (-416.639) -- 0:00:34
442500 -- [-416.389] (-417.366) (-417.110) (-415.936) * (-418.144) [-417.953] (-417.595) (-416.583) -- 0:00:34
443000 -- (-417.427) (-414.859) [-416.290] (-416.421) * (-416.193) (-418.527) (-415.548) [-418.789] -- 0:00:33
443500 -- (-416.949) [-417.058] (-417.600) (-416.255) * (-416.200) [-416.031] (-415.390) (-417.785) -- 0:00:33
444000 -- (-417.443) (-416.480) [-418.361] (-419.411) * (-415.764) (-417.777) [-417.304] (-419.110) -- 0:00:33
444500 -- (-417.715) (-419.599) [-416.063] (-420.317) * [-416.644] (-415.086) (-415.391) (-415.435) -- 0:00:33
445000 -- (-417.626) [-416.546] (-418.280) (-421.759) * (-414.917) (-417.224) (-417.354) [-417.454] -- 0:00:33
Average standard deviation of split frequencies: 0.009761
445500 -- (-417.316) (-417.234) (-417.692) [-415.913] * (-416.203) (-417.377) [-418.161] (-417.156) -- 0:00:33
446000 -- (-416.462) (-417.455) [-415.167] (-419.360) * (-416.474) (-417.444) [-416.072] (-418.292) -- 0:00:33
446500 -- [-420.197] (-415.536) (-417.585) (-415.746) * [-418.079] (-417.040) (-417.016) (-417.156) -- 0:00:33
447000 -- (-417.678) (-417.422) (-418.569) [-414.818] * (-417.148) [-418.476] (-417.195) (-418.670) -- 0:00:33
447500 -- (-419.025) (-418.627) (-416.316) [-415.051] * (-418.063) (-418.033) (-416.912) [-417.106] -- 0:00:33
448000 -- [-418.695] (-422.027) (-418.467) (-419.075) * (-416.620) (-421.837) [-415.762] (-418.437) -- 0:00:33
448500 -- [-418.783] (-419.731) (-421.853) (-423.303) * (-415.773) (-418.086) (-418.825) [-415.817] -- 0:00:33
449000 -- (-419.261) [-418.259] (-416.979) (-416.713) * (-418.691) (-417.322) (-418.697) [-415.265] -- 0:00:33
449500 -- [-415.871] (-418.924) (-417.423) (-418.090) * (-416.438) [-415.546] (-418.787) (-419.253) -- 0:00:33
450000 -- (-416.040) (-421.026) (-419.942) [-415.521] * (-416.801) (-419.953) [-418.810] (-415.819) -- 0:00:33
Average standard deviation of split frequencies: 0.010337
450500 -- [-420.071] (-417.110) (-416.636) (-416.905) * [-415.518] (-417.523) (-417.383) (-417.351) -- 0:00:32
451000 -- (-415.456) [-415.100] (-418.059) (-418.818) * [-417.830] (-414.979) (-416.284) (-416.795) -- 0:00:34
451500 -- [-415.864] (-417.853) (-416.310) (-418.175) * [-416.894] (-415.505) (-417.735) (-416.743) -- 0:00:34
452000 -- (-416.781) (-418.403) (-415.345) [-415.316] * (-418.001) (-416.195) (-415.859) [-415.837] -- 0:00:33
452500 -- (-418.113) (-416.268) [-416.708] (-416.329) * (-417.455) (-417.255) [-416.392] (-416.796) -- 0:00:33
453000 -- (-415.790) (-415.775) [-414.950] (-418.765) * (-415.026) (-416.191) (-415.017) [-417.209] -- 0:00:33
453500 -- [-418.792] (-416.097) (-415.995) (-416.545) * (-415.493) [-417.026] (-416.948) (-416.828) -- 0:00:33
454000 -- (-416.974) (-418.976) [-416.800] (-419.144) * (-416.430) (-416.659) [-421.123] (-417.336) -- 0:00:33
454500 -- (-422.407) (-417.704) [-417.887] (-417.108) * [-416.076] (-418.269) (-417.797) (-416.476) -- 0:00:33
455000 -- [-417.237] (-416.415) (-416.983) (-419.372) * (-416.105) (-420.114) (-418.318) [-415.882] -- 0:00:33
Average standard deviation of split frequencies: 0.010581
455500 -- [-418.562] (-416.457) (-417.832) (-417.334) * (-415.433) (-415.393) [-416.203] (-415.252) -- 0:00:33
456000 -- (-415.812) [-416.513] (-415.978) (-415.523) * [-417.815] (-417.085) (-415.475) (-416.108) -- 0:00:33
456500 -- [-416.175] (-416.779) (-416.604) (-415.474) * [-419.083] (-416.413) (-417.100) (-415.734) -- 0:00:33
457000 -- (-418.427) (-417.090) [-415.984] (-417.052) * [-415.810] (-415.783) (-419.311) (-418.365) -- 0:00:33
457500 -- (-417.223) [-417.669] (-416.587) (-416.079) * (-416.923) (-417.867) (-421.695) [-416.516] -- 0:00:33
458000 -- (-416.995) [-417.630] (-416.884) (-418.594) * (-423.355) [-417.619] (-418.628) (-414.829) -- 0:00:33
458500 -- (-419.332) [-418.674] (-415.794) (-422.670) * (-419.666) (-422.311) [-424.995] (-415.795) -- 0:00:33
459000 -- (-415.614) (-416.707) [-415.668] (-416.211) * (-426.454) [-420.262] (-417.224) (-418.246) -- 0:00:33
459500 -- [-416.549] (-417.192) (-418.358) (-417.927) * (-415.421) (-415.589) [-416.869] (-417.703) -- 0:00:32
460000 -- (-416.331) [-417.085] (-415.464) (-415.788) * (-415.113) (-416.045) [-416.432] (-419.565) -- 0:00:32
Average standard deviation of split frequencies: 0.009992
460500 -- (-417.251) [-415.147] (-423.801) (-415.562) * (-415.776) (-416.920) [-418.906] (-416.426) -- 0:00:32
461000 -- [-420.093] (-415.646) (-417.797) (-416.419) * (-416.073) (-415.662) [-417.597] (-418.977) -- 0:00:32
461500 -- (-416.271) (-415.803) [-417.708] (-415.299) * (-418.654) (-416.292) [-416.874] (-416.104) -- 0:00:32
462000 -- [-415.671] (-416.619) (-415.399) (-415.248) * (-417.030) (-417.462) [-415.792] (-415.591) -- 0:00:32
462500 -- (-417.003) (-415.779) [-414.879] (-418.162) * [-416.753] (-416.270) (-418.833) (-416.656) -- 0:00:32
463000 -- [-419.896] (-418.718) (-416.155) (-417.243) * (-416.670) (-416.814) (-420.222) [-415.939] -- 0:00:32
463500 -- (-418.524) (-415.083) [-416.427] (-417.818) * [-415.491] (-418.616) (-422.043) (-419.711) -- 0:00:32
464000 -- (-415.202) [-416.159] (-420.793) (-420.443) * [-417.200] (-415.656) (-419.511) (-417.841) -- 0:00:32
464500 -- (-417.613) (-416.474) (-419.339) [-418.851] * (-416.360) (-415.245) [-417.275] (-415.798) -- 0:00:32
465000 -- (-417.308) (-417.521) [-415.905] (-416.867) * (-417.448) [-417.775] (-417.265) (-415.900) -- 0:00:32
Average standard deviation of split frequencies: 0.009818
465500 -- (-416.655) (-421.824) [-416.895] (-418.805) * [-419.018] (-417.166) (-415.363) (-420.110) -- 0:00:32
466000 -- (-415.920) (-419.061) (-416.198) [-420.695] * (-415.902) (-415.859) (-417.064) [-415.825] -- 0:00:32
466500 -- (-418.808) [-415.536] (-416.589) (-417.926) * (-417.373) [-415.637] (-414.663) (-415.700) -- 0:00:32
467000 -- (-419.153) [-418.508] (-417.106) (-415.263) * (-421.412) [-417.432] (-415.833) (-415.359) -- 0:00:31
467500 -- [-415.294] (-419.221) (-417.674) (-418.845) * (-417.939) (-418.421) (-417.569) [-416.178] -- 0:00:33
468000 -- [-416.879] (-416.981) (-415.802) (-415.567) * [-415.542] (-417.118) (-423.185) (-415.133) -- 0:00:32
468500 -- (-418.298) (-424.234) [-419.730] (-415.547) * (-417.186) [-416.902] (-416.098) (-415.143) -- 0:00:32
469000 -- [-416.466] (-420.549) (-416.075) (-417.795) * [-416.410] (-420.240) (-419.368) (-419.555) -- 0:00:32
469500 -- (-419.895) [-419.261] (-415.601) (-419.544) * (-416.525) (-418.700) [-416.314] (-417.715) -- 0:00:32
470000 -- [-416.571] (-417.078) (-417.277) (-421.206) * (-419.911) [-416.392] (-415.313) (-426.053) -- 0:00:32
Average standard deviation of split frequencies: 0.009662
470500 -- (-415.977) (-415.161) [-420.636] (-417.728) * (-418.320) (-415.216) [-417.485] (-419.633) -- 0:00:32
471000 -- (-416.238) (-417.884) (-415.721) [-415.197] * [-415.735] (-416.158) (-416.882) (-421.732) -- 0:00:32
471500 -- (-421.900) (-418.034) (-418.473) [-415.145] * (-418.007) (-415.611) [-416.506] (-417.984) -- 0:00:32
472000 -- (-416.123) [-417.487] (-420.928) (-414.958) * (-416.950) (-416.463) (-416.844) [-416.401] -- 0:00:32
472500 -- (-415.232) (-416.037) [-416.470] (-417.059) * (-415.769) [-417.980] (-416.868) (-418.186) -- 0:00:32
473000 -- (-417.173) [-420.621] (-417.174) (-415.809) * (-415.692) (-416.505) (-421.898) [-417.883] -- 0:00:32
473500 -- (-415.040) (-422.090) [-417.968] (-417.177) * [-417.123] (-421.062) (-422.212) (-418.106) -- 0:00:32
474000 -- (-415.726) [-415.409] (-417.235) (-416.990) * (-420.239) (-418.055) (-420.099) [-417.528] -- 0:00:32
474500 -- (-417.745) (-416.134) (-417.396) [-414.831] * (-419.997) (-417.043) (-415.799) [-416.949] -- 0:00:32
475000 -- (-416.862) [-416.160] (-418.127) (-417.405) * (-417.871) (-417.760) (-417.018) [-417.946] -- 0:00:32
Average standard deviation of split frequencies: 0.009496
475500 -- (-418.353) [-415.678] (-415.673) (-419.691) * [-417.725] (-415.659) (-416.673) (-420.816) -- 0:00:31
476000 -- (-417.469) (-416.956) (-414.783) [-417.133] * (-420.004) (-419.150) (-415.831) [-418.466] -- 0:00:31
476500 -- (-415.947) (-423.756) [-418.665] (-415.649) * (-420.240) [-416.314] (-418.047) (-421.019) -- 0:00:31
477000 -- (-417.492) [-417.134] (-420.162) (-418.040) * [-421.612] (-418.641) (-421.070) (-415.083) -- 0:00:31
477500 -- (-417.458) [-417.679] (-418.081) (-416.979) * (-420.643) (-418.821) (-419.478) [-420.313] -- 0:00:31
478000 -- (-415.912) (-419.592) [-416.310] (-418.014) * [-418.749] (-418.107) (-418.154) (-416.475) -- 0:00:31
478500 -- (-420.524) (-417.751) [-418.227] (-417.362) * (-417.859) (-416.407) [-415.444] (-421.255) -- 0:00:31
479000 -- (-414.781) (-418.219) [-418.251] (-414.865) * [-416.105] (-416.407) (-417.077) (-417.032) -- 0:00:31
479500 -- (-415.865) (-415.725) (-415.207) [-415.685] * (-415.340) [-416.469] (-420.591) (-415.065) -- 0:00:31
480000 -- (-417.973) [-419.443] (-418.468) (-422.501) * (-415.841) [-417.153] (-417.196) (-415.536) -- 0:00:31
Average standard deviation of split frequencies: 0.009577
480500 -- (-416.685) (-416.244) (-415.661) [-421.819] * [-416.626] (-420.399) (-418.678) (-415.154) -- 0:00:31
481000 -- (-417.227) (-417.886) [-418.858] (-419.602) * (-415.824) (-418.836) [-419.184] (-415.565) -- 0:00:31
481500 -- (-417.472) [-419.355] (-416.364) (-419.819) * (-416.120) (-414.729) [-419.627] (-417.842) -- 0:00:31
482000 -- [-416.987] (-421.948) (-415.842) (-416.021) * (-414.782) (-414.653) [-422.050] (-416.156) -- 0:00:31
482500 -- (-415.783) [-417.368] (-418.299) (-416.255) * [-415.906] (-414.931) (-423.016) (-419.358) -- 0:00:31
483000 -- [-416.297] (-419.933) (-416.949) (-419.688) * [-416.361] (-417.055) (-415.379) (-418.898) -- 0:00:31
483500 -- (-419.452) (-416.805) (-415.952) [-418.185] * (-419.784) (-416.643) (-417.423) [-415.442] -- 0:00:30
484000 -- (-418.591) (-416.759) [-417.392] (-415.257) * (-419.317) (-415.205) [-421.052] (-416.933) -- 0:00:30
484500 -- (-419.551) (-415.648) (-420.202) [-417.965] * [-416.512] (-415.395) (-417.198) (-416.404) -- 0:00:31
485000 -- (-416.921) [-416.649] (-421.950) (-418.466) * [-415.730] (-415.632) (-416.696) (-414.621) -- 0:00:31
Average standard deviation of split frequencies: 0.009243
485500 -- (-417.403) [-417.828] (-416.955) (-417.920) * (-421.237) (-416.602) (-417.396) [-415.379] -- 0:00:31
486000 -- (-414.779) (-416.869) (-416.779) [-415.696] * (-421.600) (-415.685) [-416.179] (-417.791) -- 0:00:31
486500 -- (-420.375) [-420.579] (-417.813) (-416.831) * (-416.175) (-417.528) [-417.710] (-416.568) -- 0:00:31
487000 -- (-417.362) [-416.509] (-420.693) (-417.724) * (-415.113) (-418.427) [-415.951] (-417.128) -- 0:00:31
487500 -- [-415.895] (-416.462) (-421.089) (-415.521) * (-417.057) [-415.919] (-415.067) (-417.933) -- 0:00:31
488000 -- (-417.885) (-420.098) [-415.746] (-416.332) * (-419.998) (-418.347) [-416.534] (-415.847) -- 0:00:31
488500 -- (-417.471) [-421.249] (-420.094) (-417.214) * (-415.030) [-416.426] (-416.950) (-419.001) -- 0:00:31
489000 -- (-417.388) (-417.423) (-418.058) [-415.635] * [-415.060] (-416.654) (-419.297) (-416.379) -- 0:00:31
489500 -- (-414.935) (-420.733) [-414.606] (-416.424) * (-417.533) (-415.415) [-416.132] (-415.913) -- 0:00:31
490000 -- (-417.597) (-417.224) (-415.733) [-417.731] * (-417.404) (-417.416) (-416.954) [-414.859] -- 0:00:31
Average standard deviation of split frequencies: 0.009833
490500 -- [-417.962] (-417.075) (-417.219) (-416.039) * (-418.983) (-419.999) [-417.039] (-417.732) -- 0:00:31
491000 -- (-414.954) (-417.968) [-416.653] (-417.069) * (-418.517) [-416.658] (-418.498) (-419.006) -- 0:00:31
491500 -- (-416.941) (-418.320) [-416.443] (-417.659) * (-420.509) (-419.411) [-416.772] (-416.319) -- 0:00:31
492000 -- [-416.736] (-416.587) (-416.873) (-416.796) * [-421.924] (-416.394) (-417.853) (-417.183) -- 0:00:30
492500 -- (-420.978) (-415.749) (-424.163) [-417.007] * (-422.898) (-417.628) (-418.711) [-415.837] -- 0:00:30
493000 -- (-416.525) [-415.438] (-421.427) (-416.665) * (-419.161) (-416.708) (-420.675) [-415.461] -- 0:00:30
493500 -- (-417.844) (-421.429) (-416.768) [-415.700] * (-420.150) [-415.625] (-416.104) (-418.415) -- 0:00:30
494000 -- (-415.889) [-422.971] (-415.880) (-416.383) * (-422.547) (-415.806) [-415.753] (-417.966) -- 0:00:30
494500 -- (-416.135) [-416.912] (-416.403) (-415.720) * (-417.660) (-417.044) [-416.704] (-423.960) -- 0:00:30
495000 -- (-416.661) (-416.488) [-417.044] (-417.954) * (-417.596) (-414.693) [-416.325] (-416.185) -- 0:00:30
Average standard deviation of split frequencies: 0.010063
495500 -- (-422.334) (-415.927) [-417.124] (-417.184) * (-416.701) (-415.715) (-416.605) [-416.886] -- 0:00:30
496000 -- (-421.928) (-418.410) [-415.597] (-416.227) * (-418.164) (-417.353) [-416.001] (-416.145) -- 0:00:30
496500 -- (-417.130) [-415.536] (-416.105) (-418.484) * (-416.789) [-415.898] (-417.315) (-415.471) -- 0:00:30
497000 -- (-415.794) (-415.785) [-416.496] (-420.021) * (-419.525) [-422.468] (-415.984) (-415.509) -- 0:00:30
497500 -- (-414.685) (-416.871) [-415.272] (-421.456) * [-422.058] (-417.106) (-415.582) (-415.469) -- 0:00:30
498000 -- (-417.527) (-417.045) [-422.522] (-417.030) * [-417.930] (-418.856) (-415.356) (-417.697) -- 0:00:30
498500 -- (-417.360) (-416.948) (-418.138) [-418.050] * [-415.775] (-417.485) (-415.699) (-417.368) -- 0:00:30
499000 -- [-417.720] (-416.572) (-416.487) (-418.556) * (-416.158) (-416.366) (-417.238) [-417.759] -- 0:00:30
499500 -- [-416.361] (-415.928) (-420.091) (-419.040) * [-415.413] (-417.693) (-415.030) (-418.841) -- 0:00:30
500000 -- [-417.352] (-416.407) (-416.246) (-417.560) * (-416.820) (-416.587) [-415.754] (-417.354) -- 0:00:30
Average standard deviation of split frequencies: 0.010357
500500 -- (-417.452) (-416.221) [-417.418] (-420.293) * [-419.845] (-415.130) (-416.285) (-418.937) -- 0:00:30
501000 -- (-420.622) (-414.929) [-418.524] (-416.500) * [-414.966] (-422.504) (-418.437) (-417.122) -- 0:00:30
501500 -- [-416.795] (-415.234) (-418.052) (-416.692) * (-415.619) (-418.939) [-418.425] (-415.724) -- 0:00:30
502000 -- (-418.927) (-417.196) [-415.658] (-417.575) * (-417.013) (-417.530) [-421.705] (-417.161) -- 0:00:30
502500 -- [-419.029] (-420.260) (-418.441) (-417.069) * (-419.196) (-418.974) (-416.713) [-416.286] -- 0:00:30
503000 -- [-416.464] (-416.954) (-416.183) (-418.538) * (-417.656) (-418.330) [-415.724] (-417.254) -- 0:00:30
503500 -- (-417.683) (-416.549) [-415.477] (-416.267) * (-416.240) (-416.122) (-416.975) [-415.474] -- 0:00:30
504000 -- (-417.101) (-416.118) [-420.488] (-418.244) * (-422.083) (-416.766) (-420.152) [-417.207] -- 0:00:30
504500 -- [-417.668] (-416.631) (-417.081) (-417.956) * [-416.619] (-417.826) (-417.458) (-416.155) -- 0:00:30
505000 -- (-417.804) [-418.452] (-418.175) (-415.742) * (-415.765) (-415.905) [-415.757] (-419.446) -- 0:00:30
Average standard deviation of split frequencies: 0.010029
505500 -- (-415.540) (-418.224) (-415.987) [-416.180] * [-417.805] (-415.873) (-417.233) (-422.235) -- 0:00:30
506000 -- [-415.502] (-416.230) (-419.200) (-415.223) * [-421.134] (-416.762) (-415.511) (-418.743) -- 0:00:30
506500 -- [-415.565] (-415.399) (-416.993) (-418.624) * [-419.778] (-418.918) (-416.402) (-418.058) -- 0:00:30
507000 -- (-416.499) (-418.158) [-416.251] (-416.938) * (-417.895) (-415.155) [-416.115] (-416.033) -- 0:00:30
507500 -- (-417.004) (-416.582) (-420.774) [-415.430] * (-417.196) [-417.053] (-419.407) (-417.340) -- 0:00:30
508000 -- (-420.363) [-414.960] (-415.717) (-418.566) * (-417.431) (-416.155) [-417.777] (-418.564) -- 0:00:30
508500 -- (-417.031) (-416.034) (-418.421) [-416.313] * (-417.505) (-418.644) [-415.445] (-421.814) -- 0:00:29
509000 -- (-420.649) (-415.996) [-416.774] (-418.039) * (-416.336) [-415.162] (-415.847) (-418.046) -- 0:00:29
509500 -- (-415.493) (-417.271) (-417.452) [-416.024] * (-416.501) (-414.832) [-416.393] (-418.920) -- 0:00:29
510000 -- (-415.538) (-416.713) [-415.981] (-416.469) * (-415.920) (-415.291) (-416.676) [-415.591] -- 0:00:29
Average standard deviation of split frequencies: 0.010046
510500 -- (-419.743) [-415.719] (-415.259) (-416.157) * (-416.028) (-418.853) [-416.599] (-415.919) -- 0:00:29
511000 -- (-419.772) [-416.811] (-419.990) (-416.242) * (-415.403) (-416.546) (-430.925) [-415.282] -- 0:00:29
511500 -- [-415.376] (-416.493) (-419.590) (-415.812) * (-415.175) (-417.931) (-417.792) [-415.928] -- 0:00:29
512000 -- [-415.093] (-417.533) (-415.437) (-416.985) * (-416.005) (-417.928) (-419.872) [-416.543] -- 0:00:29
512500 -- (-416.691) (-415.415) (-417.842) [-417.610] * [-416.300] (-417.070) (-417.436) (-416.934) -- 0:00:29
513000 -- (-417.988) (-419.558) [-416.598] (-416.785) * (-417.580) (-416.299) (-423.593) [-421.167] -- 0:00:29
513500 -- (-416.791) (-418.208) [-415.502] (-415.142) * (-415.245) (-415.302) [-415.759] (-415.166) -- 0:00:29
514000 -- (-418.002) (-418.672) (-418.215) [-414.973] * (-422.653) (-416.476) (-419.128) [-415.803] -- 0:00:29
514500 -- (-416.257) [-420.212] (-416.587) (-417.112) * (-418.917) [-419.424] (-423.463) (-417.880) -- 0:00:29
515000 -- (-416.275) (-415.785) (-417.102) [-416.243] * (-420.984) (-416.996) [-415.495] (-416.075) -- 0:00:29
Average standard deviation of split frequencies: 0.009942
515500 -- (-416.559) (-417.332) (-421.900) [-417.662] * (-415.851) [-416.239] (-418.545) (-417.655) -- 0:00:30
516000 -- (-415.296) [-416.640] (-415.918) (-416.403) * (-415.224) (-418.051) (-418.257) [-419.135] -- 0:00:30
516500 -- (-415.667) [-418.930] (-417.106) (-415.694) * (-415.920) (-416.440) [-416.811] (-416.093) -- 0:00:29
517000 -- (-416.082) (-420.004) [-415.819] (-415.803) * (-419.017) (-415.674) [-416.306] (-416.327) -- 0:00:29
517500 -- [-415.522] (-418.085) (-417.196) (-414.880) * (-416.578) (-414.894) [-418.086] (-417.612) -- 0:00:29
518000 -- [-416.802] (-417.401) (-415.968) (-419.311) * (-417.414) [-415.616] (-418.089) (-421.273) -- 0:00:29
518500 -- (-415.834) (-416.171) [-416.887] (-419.799) * (-417.319) (-415.719) [-415.799] (-419.839) -- 0:00:29
519000 -- [-417.388] (-417.126) (-419.671) (-419.769) * [-416.429] (-419.405) (-420.097) (-416.183) -- 0:00:29
519500 -- [-418.934] (-414.793) (-417.310) (-415.929) * [-416.096] (-417.027) (-418.223) (-416.995) -- 0:00:29
520000 -- [-416.593] (-415.729) (-418.767) (-418.472) * (-417.613) [-416.366] (-417.962) (-419.240) -- 0:00:29
Average standard deviation of split frequencies: 0.008658
520500 -- (-418.874) (-416.764) [-419.150] (-416.488) * [-422.399] (-419.607) (-416.379) (-421.771) -- 0:00:29
521000 -- (-415.283) [-418.690] (-421.265) (-416.597) * (-420.443) (-415.221) (-417.582) [-415.184] -- 0:00:29
521500 -- (-415.955) (-416.214) [-415.207] (-417.319) * (-416.362) [-416.329] (-416.195) (-415.962) -- 0:00:29
522000 -- (-418.216) (-416.133) [-417.047] (-418.799) * (-418.709) (-416.916) [-418.963] (-416.722) -- 0:00:29
522500 -- (-417.883) (-415.409) [-420.142] (-419.773) * [-416.114] (-417.622) (-417.890) (-417.196) -- 0:00:29
523000 -- [-417.119] (-417.845) (-419.990) (-416.558) * [-416.578] (-416.888) (-419.092) (-416.068) -- 0:00:29
523500 -- [-415.100] (-417.566) (-420.050) (-415.099) * (-419.868) (-416.398) [-416.532] (-416.124) -- 0:00:29
524000 -- [-416.874] (-417.678) (-416.022) (-418.014) * (-421.632) [-416.550] (-415.511) (-415.777) -- 0:00:29
524500 -- [-417.154] (-416.910) (-415.223) (-416.292) * [-416.867] (-421.961) (-416.822) (-416.303) -- 0:00:29
525000 -- (-419.365) (-415.455) [-415.097] (-420.192) * (-421.268) (-416.122) (-416.579) [-416.131] -- 0:00:28
Average standard deviation of split frequencies: 0.009278
525500 -- [-415.906] (-416.353) (-414.821) (-417.796) * (-418.068) [-415.738] (-415.239) (-419.030) -- 0:00:28
526000 -- [-419.518] (-416.485) (-414.837) (-416.837) * [-417.717] (-416.183) (-418.599) (-415.609) -- 0:00:28
526500 -- (-418.213) (-416.978) (-415.353) [-416.011] * (-416.878) [-415.419] (-417.569) (-418.577) -- 0:00:28
527000 -- (-418.995) [-418.199] (-416.436) (-415.957) * (-415.475) [-418.320] (-416.734) (-417.683) -- 0:00:28
527500 -- (-415.738) (-418.350) [-417.151] (-417.069) * (-422.225) (-417.447) (-416.655) [-419.780] -- 0:00:28
528000 -- (-416.025) (-416.169) [-416.703] (-415.951) * (-419.101) (-419.924) (-416.498) [-417.773] -- 0:00:28
528500 -- (-417.996) [-415.536] (-419.172) (-416.191) * (-416.048) (-418.387) (-420.319) [-415.953] -- 0:00:28
529000 -- (-424.389) (-418.463) [-417.046] (-417.360) * (-415.918) (-419.522) (-419.435) [-417.047] -- 0:00:28
529500 -- [-417.095] (-416.320) (-415.457) (-418.677) * (-417.031) [-415.840] (-421.135) (-420.637) -- 0:00:28
530000 -- [-416.649] (-416.248) (-417.467) (-416.021) * (-420.048) [-417.687] (-415.455) (-418.521) -- 0:00:28
Average standard deviation of split frequencies: 0.008883
530500 -- (-422.227) (-417.810) [-417.183] (-416.141) * (-416.311) (-417.453) (-416.412) [-414.900] -- 0:00:29
531000 -- (-421.562) [-415.550] (-415.417) (-415.796) * (-417.530) (-416.350) [-417.601] (-415.762) -- 0:00:29
531500 -- (-415.911) (-419.603) [-416.844] (-418.000) * (-417.299) (-417.039) (-417.819) [-416.196] -- 0:00:29
532000 -- (-417.237) [-417.813] (-416.078) (-416.070) * (-415.341) (-419.120) (-419.045) [-415.301] -- 0:00:29
532500 -- (-416.568) [-417.000] (-417.113) (-417.357) * (-420.581) [-417.180] (-418.997) (-421.770) -- 0:00:28
533000 -- (-416.466) [-417.052] (-414.916) (-420.156) * (-418.099) (-416.680) [-416.941] (-417.392) -- 0:00:28
533500 -- (-417.890) (-415.976) [-415.678] (-416.672) * (-416.105) [-415.180] (-424.405) (-417.679) -- 0:00:28
534000 -- [-417.141] (-415.842) (-417.510) (-418.417) * (-418.346) [-418.084] (-420.551) (-415.552) -- 0:00:28
534500 -- (-417.331) [-416.179] (-416.149) (-419.601) * [-419.311] (-416.976) (-416.155) (-415.515) -- 0:00:28
535000 -- [-420.220] (-419.624) (-416.363) (-416.758) * (-421.466) [-417.128] (-415.718) (-416.053) -- 0:00:28
Average standard deviation of split frequencies: 0.008300
535500 -- (-417.400) (-420.596) [-415.609] (-417.827) * (-416.257) (-415.612) [-414.834] (-417.638) -- 0:00:28
536000 -- (-417.528) [-415.091] (-417.745) (-416.109) * (-415.989) [-415.846] (-415.985) (-419.627) -- 0:00:28
536500 -- (-417.732) [-416.956] (-417.443) (-415.494) * (-416.830) [-416.500] (-414.733) (-415.531) -- 0:00:28
537000 -- [-415.748] (-417.584) (-416.758) (-417.660) * (-416.763) [-418.824] (-416.748) (-416.716) -- 0:00:28
537500 -- (-416.307) (-418.465) (-416.491) [-416.553] * (-416.281) [-416.260] (-416.538) (-415.341) -- 0:00:28
538000 -- (-420.393) (-420.541) (-415.765) [-416.448] * (-417.785) [-417.762] (-415.952) (-417.497) -- 0:00:28
538500 -- (-419.947) (-421.132) [-415.265] (-415.083) * (-422.112) (-417.755) [-418.930] (-416.509) -- 0:00:28
539000 -- (-421.405) [-416.876] (-417.319) (-415.452) * (-415.974) [-417.002] (-422.558) (-421.634) -- 0:00:28
539500 -- (-415.357) (-419.223) (-415.838) [-417.530] * (-416.589) [-415.198] (-418.903) (-425.700) -- 0:00:28
540000 -- (-417.879) (-417.083) [-421.483] (-415.616) * (-420.180) [-417.737] (-420.034) (-420.231) -- 0:00:28
Average standard deviation of split frequencies: 0.008229
540500 -- (-418.838) [-415.434] (-417.921) (-415.501) * (-419.112) [-416.059] (-417.970) (-420.547) -- 0:00:28
541000 -- (-415.134) (-418.414) [-418.598] (-415.353) * (-417.162) (-417.743) [-415.906] (-414.966) -- 0:00:27
541500 -- (-416.061) (-414.818) [-418.824] (-417.780) * (-416.085) [-415.693] (-417.665) (-415.548) -- 0:00:27
542000 -- (-417.640) (-416.480) (-416.263) [-416.282] * (-415.666) (-418.436) [-416.336] (-416.720) -- 0:00:27
542500 -- [-415.184] (-416.685) (-415.746) (-416.816) * [-416.122] (-416.435) (-414.991) (-419.825) -- 0:00:27
543000 -- (-415.515) (-417.982) (-415.262) [-415.548] * (-419.062) [-416.200] (-422.133) (-417.275) -- 0:00:27
543500 -- [-414.985] (-419.545) (-420.374) (-415.547) * (-421.431) (-416.270) (-417.738) [-416.222] -- 0:00:27
544000 -- [-415.742] (-415.282) (-417.329) (-421.124) * [-417.113] (-416.641) (-419.004) (-421.683) -- 0:00:27
544500 -- (-416.201) [-416.504] (-418.883) (-419.860) * [-416.631] (-417.953) (-417.592) (-418.335) -- 0:00:27
545000 -- (-416.891) (-417.167) [-416.606] (-416.031) * (-420.822) [-416.999] (-415.883) (-416.509) -- 0:00:27
Average standard deviation of split frequencies: 0.008688
545500 -- [-416.582] (-416.940) (-414.948) (-419.795) * (-415.787) [-416.492] (-415.210) (-416.423) -- 0:00:27
546000 -- (-421.493) [-416.269] (-418.922) (-417.635) * (-415.469) (-417.607) [-418.888] (-415.444) -- 0:00:27
546500 -- (-415.546) (-418.256) [-418.223] (-420.544) * (-416.557) (-415.625) [-415.639] (-414.769) -- 0:00:28
547000 -- (-415.531) (-418.183) [-419.322] (-422.153) * (-416.754) (-416.482) (-414.793) [-416.283] -- 0:00:28
547500 -- [-414.633] (-418.321) (-420.139) (-415.324) * (-416.718) (-419.223) [-418.658] (-417.443) -- 0:00:28
548000 -- [-414.788] (-420.447) (-416.442) (-415.832) * [-418.284] (-417.458) (-416.611) (-416.911) -- 0:00:28
548500 -- [-418.701] (-416.592) (-415.427) (-415.633) * (-416.029) (-416.040) (-416.448) [-425.000] -- 0:00:27
549000 -- (-416.873) [-415.632] (-414.949) (-416.194) * (-418.456) [-416.939] (-417.460) (-416.514) -- 0:00:27
549500 -- (-417.039) [-415.341] (-417.170) (-416.812) * (-419.322) [-417.458] (-416.369) (-418.805) -- 0:00:27
550000 -- [-415.622] (-419.978) (-414.858) (-416.064) * (-416.423) (-416.409) (-416.715) [-416.217] -- 0:00:27
Average standard deviation of split frequencies: 0.008347
550500 -- (-418.662) (-419.751) [-415.031] (-417.616) * [-417.615] (-415.399) (-416.715) (-416.160) -- 0:00:27
551000 -- (-415.856) [-419.582] (-414.987) (-416.328) * [-415.860] (-414.987) (-422.725) (-415.060) -- 0:00:27
551500 -- (-414.966) (-417.355) (-417.797) [-418.736] * (-418.959) (-415.490) (-419.947) [-415.237] -- 0:00:27
552000 -- (-415.803) (-417.377) [-416.193] (-418.301) * (-418.900) (-415.599) (-418.804) [-415.093] -- 0:00:27
552500 -- (-417.312) (-416.671) (-416.124) [-416.863] * (-418.544) [-421.060] (-422.104) (-415.033) -- 0:00:27
553000 -- (-416.813) (-416.813) (-418.169) [-415.995] * [-418.280] (-419.412) (-416.611) (-417.332) -- 0:00:27
553500 -- [-416.590] (-417.104) (-417.513) (-416.227) * (-416.222) [-419.645] (-419.930) (-417.506) -- 0:00:27
554000 -- [-417.535] (-417.903) (-414.980) (-421.951) * (-415.778) (-418.683) (-417.144) [-416.089] -- 0:00:27
554500 -- (-416.689) (-416.187) [-418.707] (-425.861) * (-416.633) [-415.671] (-416.439) (-418.535) -- 0:00:27
555000 -- (-416.864) [-418.277] (-416.806) (-419.399) * (-417.442) (-416.571) (-415.773) [-415.401] -- 0:00:27
Average standard deviation of split frequencies: 0.008637
555500 -- (-417.043) [-418.644] (-417.892) (-417.383) * (-419.420) (-415.112) (-418.991) [-415.778] -- 0:00:27
556000 -- (-416.762) (-415.973) (-418.583) [-415.649] * (-416.104) (-420.174) (-419.193) [-415.605] -- 0:00:27
556500 -- (-417.055) (-418.427) [-417.623] (-417.544) * (-416.692) (-417.218) [-416.366] (-416.252) -- 0:00:27
557000 -- (-418.670) [-416.679] (-419.142) (-417.675) * [-415.987] (-418.677) (-416.462) (-414.846) -- 0:00:27
557500 -- [-420.310] (-420.953) (-416.891) (-418.304) * [-416.635] (-415.981) (-418.154) (-418.049) -- 0:00:26
558000 -- [-421.455] (-418.427) (-419.781) (-416.669) * (-418.212) (-415.347) [-416.271] (-419.127) -- 0:00:26
558500 -- (-416.725) [-415.788] (-417.402) (-417.325) * (-418.063) [-415.822] (-419.461) (-416.221) -- 0:00:26
559000 -- [-419.674] (-416.205) (-417.526) (-420.568) * (-417.555) (-415.879) [-417.862] (-416.798) -- 0:00:26
559500 -- (-416.988) (-419.621) [-420.453] (-416.775) * (-415.888) [-416.014] (-417.784) (-421.115) -- 0:00:26
560000 -- (-415.429) (-419.902) (-419.003) [-416.341] * (-417.947) (-416.323) (-420.560) [-416.226] -- 0:00:26
Average standard deviation of split frequencies: 0.009144
560500 -- [-415.816] (-415.621) (-417.393) (-418.962) * (-416.571) (-419.923) (-418.941) [-417.967] -- 0:00:26
561000 -- (-417.818) (-417.106) (-417.392) [-415.569] * (-416.646) (-416.835) (-417.348) [-418.146] -- 0:00:26
561500 -- (-415.138) [-414.971] (-418.827) (-414.615) * [-416.062] (-421.065) (-417.092) (-417.577) -- 0:00:26
562000 -- (-415.157) (-415.417) (-415.381) [-415.549] * (-416.454) [-418.300] (-419.675) (-416.018) -- 0:00:26
562500 -- (-415.053) (-415.112) [-416.492] (-415.323) * [-417.001] (-417.083) (-416.052) (-415.631) -- 0:00:26
563000 -- [-418.256] (-416.018) (-415.253) (-420.795) * [-415.924] (-415.484) (-416.846) (-417.396) -- 0:00:26
563500 -- [-416.464] (-417.516) (-418.125) (-416.601) * [-416.744] (-418.206) (-418.919) (-415.760) -- 0:00:27
564000 -- (-416.413) (-416.065) (-417.536) [-417.363] * [-415.508] (-416.996) (-415.631) (-416.428) -- 0:00:27
564500 -- (-416.565) (-416.413) (-415.351) [-416.418] * (-416.832) (-414.956) [-417.627] (-416.275) -- 0:00:27
565000 -- (-416.156) (-417.731) (-415.492) [-417.437] * [-415.070] (-416.404) (-418.268) (-415.427) -- 0:00:26
Average standard deviation of split frequencies: 0.009474
565500 -- (-421.560) [-415.164] (-417.404) (-416.994) * (-416.777) (-416.199) (-419.965) [-417.928] -- 0:00:26
566000 -- [-422.515] (-417.482) (-416.388) (-414.858) * (-419.430) (-415.238) [-415.036] (-414.836) -- 0:00:26
566500 -- (-416.763) (-418.061) [-416.815] (-415.567) * (-415.874) [-416.329] (-416.791) (-417.076) -- 0:00:26
567000 -- (-417.140) [-415.312] (-421.395) (-416.599) * (-415.124) [-417.567] (-415.604) (-417.315) -- 0:00:26
567500 -- (-416.075) (-415.060) [-419.186] (-416.374) * (-419.804) (-415.468) (-419.545) [-418.528] -- 0:00:26
568000 -- [-416.623] (-418.800) (-416.259) (-416.917) * (-419.427) [-416.415] (-417.404) (-416.769) -- 0:00:26
568500 -- [-418.017] (-417.167) (-416.316) (-416.696) * (-416.141) (-416.915) [-415.664] (-417.703) -- 0:00:26
569000 -- [-416.596] (-416.408) (-418.914) (-415.118) * (-417.376) (-415.262) [-416.139] (-416.443) -- 0:00:26
569500 -- (-417.932) (-416.932) (-422.271) [-418.449] * (-416.243) [-415.855] (-416.536) (-416.329) -- 0:00:26
570000 -- (-418.922) [-415.924] (-416.116) (-416.765) * (-415.477) (-419.294) [-415.604] (-415.510) -- 0:00:26
Average standard deviation of split frequencies: 0.009603
570500 -- (-418.769) [-418.778] (-420.037) (-417.341) * (-418.223) (-415.711) [-416.555] (-416.908) -- 0:00:26
571000 -- [-416.053] (-418.137) (-419.552) (-416.980) * (-416.352) (-416.370) [-416.080] (-418.098) -- 0:00:26
571500 -- (-417.813) [-417.922] (-418.959) (-417.611) * (-415.325) (-416.454) [-414.905] (-416.148) -- 0:00:26
572000 -- [-417.361] (-416.271) (-415.567) (-420.487) * (-415.631) [-416.862] (-415.021) (-416.125) -- 0:00:26
572500 -- [-418.558] (-415.966) (-417.926) (-416.323) * (-416.033) (-420.360) [-416.817] (-416.847) -- 0:00:26
573000 -- (-418.557) [-419.724] (-419.105) (-417.245) * [-417.143] (-416.961) (-414.687) (-415.505) -- 0:00:26
573500 -- (-417.501) (-421.135) [-416.046] (-415.229) * [-415.652] (-416.092) (-414.985) (-416.022) -- 0:00:26
574000 -- (-422.101) (-421.516) [-416.288] (-418.782) * [-417.316] (-417.302) (-416.635) (-417.717) -- 0:00:25
574500 -- [-417.527] (-418.933) (-416.087) (-415.713) * (-418.334) (-415.372) [-421.202] (-415.525) -- 0:00:25
575000 -- [-415.472] (-415.798) (-416.170) (-418.142) * (-417.729) [-415.512] (-416.398) (-414.825) -- 0:00:25
Average standard deviation of split frequencies: 0.009565
575500 -- [-415.254] (-418.478) (-418.356) (-417.519) * [-417.282] (-416.522) (-419.372) (-416.368) -- 0:00:25
576000 -- (-416.899) (-416.736) [-419.604] (-415.825) * [-415.965] (-417.586) (-416.033) (-416.934) -- 0:00:25
576500 -- (-415.916) [-417.745] (-415.828) (-416.772) * (-415.946) (-416.553) (-417.017) [-416.215] -- 0:00:25
577000 -- (-421.934) [-416.670] (-416.955) (-418.037) * (-420.577) (-418.816) (-417.895) [-416.833] -- 0:00:25
577500 -- [-419.429] (-416.552) (-417.910) (-417.602) * (-417.218) (-418.333) (-416.667) [-416.061] -- 0:00:25
578000 -- (-415.567) (-415.812) [-415.768] (-415.234) * (-416.900) (-419.223) [-415.874] (-415.892) -- 0:00:25
578500 -- (-415.677) (-420.631) (-417.449) [-416.031] * (-419.031) (-417.450) [-415.594] (-417.630) -- 0:00:25
579000 -- (-415.321) [-417.079] (-414.950) (-425.422) * [-419.300] (-416.393) (-421.960) (-416.790) -- 0:00:25
579500 -- [-415.901] (-416.014) (-417.663) (-417.080) * (-417.441) (-421.501) (-417.821) [-416.217] -- 0:00:25
580000 -- (-415.405) (-418.174) [-418.100] (-418.689) * (-417.438) [-415.610] (-420.247) (-417.292) -- 0:00:25
Average standard deviation of split frequencies: 0.009945
580500 -- (-418.153) (-421.577) [-417.441] (-415.605) * [-423.039] (-415.588) (-417.496) (-418.557) -- 0:00:26
581000 -- (-418.023) (-417.367) [-416.274] (-415.652) * (-418.650) (-416.587) (-417.350) [-414.751] -- 0:00:25
581500 -- [-415.464] (-416.454) (-415.870) (-416.330) * (-416.989) (-416.930) (-417.237) [-417.322] -- 0:00:25
582000 -- (-419.768) [-417.168] (-417.978) (-416.306) * [-415.229] (-417.583) (-415.452) (-417.346) -- 0:00:25
582500 -- (-417.546) [-417.711] (-417.579) (-417.274) * (-418.982) (-416.142) [-415.573] (-420.831) -- 0:00:25
583000 -- [-416.528] (-415.004) (-417.023) (-417.154) * [-418.245] (-417.975) (-416.154) (-415.725) -- 0:00:25
583500 -- [-415.307] (-415.969) (-419.302) (-416.238) * [-419.045] (-419.142) (-416.964) (-418.311) -- 0:00:25
584000 -- (-416.196) (-416.349) (-419.286) [-415.789] * (-420.171) (-416.672) (-417.208) [-414.933] -- 0:00:25
584500 -- (-416.580) (-417.849) (-416.446) [-416.902] * (-417.992) (-417.631) [-416.439] (-415.516) -- 0:00:25
585000 -- (-416.610) [-415.211] (-416.616) (-417.753) * (-419.107) [-416.970] (-417.662) (-416.314) -- 0:00:25
Average standard deviation of split frequencies: 0.009402
585500 -- (-416.968) (-419.192) [-416.395] (-417.890) * (-418.053) (-415.827) (-418.136) [-416.181] -- 0:00:25
586000 -- (-417.907) (-415.390) (-419.787) [-418.933] * [-414.873] (-416.760) (-416.415) (-419.812) -- 0:00:25
586500 -- (-415.768) [-415.380] (-421.337) (-418.957) * (-420.499) (-417.175) [-416.547] (-420.970) -- 0:00:25
587000 -- (-418.619) (-416.422) (-419.654) [-416.750] * (-415.614) (-416.839) (-418.743) [-418.672] -- 0:00:25
587500 -- [-415.402] (-415.377) (-417.116) (-415.724) * (-426.549) [-418.108] (-417.054) (-417.141) -- 0:00:25
588000 -- [-420.189] (-419.237) (-417.333) (-414.832) * (-416.531) (-421.794) (-416.272) [-416.776] -- 0:00:25
588500 -- (-416.250) [-415.504] (-416.173) (-417.314) * (-417.778) (-416.197) (-418.405) [-417.969] -- 0:00:25
589000 -- (-417.117) (-416.510) (-416.907) [-415.172] * (-416.431) (-417.371) (-418.624) [-416.841] -- 0:00:25
589500 -- [-418.461] (-419.587) (-416.479) (-416.365) * (-417.280) (-416.555) (-415.261) [-415.856] -- 0:00:25
590000 -- [-417.116] (-416.154) (-416.522) (-416.426) * [-420.094] (-415.071) (-415.214) (-416.357) -- 0:00:25
Average standard deviation of split frequencies: 0.009028
590500 -- (-416.165) (-418.896) [-416.474] (-415.725) * (-415.165) (-414.807) (-415.307) [-416.975] -- 0:00:24
591000 -- [-414.789] (-417.850) (-416.387) (-416.039) * (-416.588) (-417.372) (-416.637) [-416.136] -- 0:00:24
591500 -- [-416.158] (-414.911) (-416.866) (-417.457) * (-417.861) (-415.527) [-417.656] (-415.895) -- 0:00:24
592000 -- [-415.233] (-415.814) (-418.219) (-416.432) * (-421.526) (-416.805) (-418.677) [-417.405] -- 0:00:24
592500 -- (-416.382) [-415.224] (-418.073) (-419.257) * (-418.913) (-415.099) (-416.519) [-417.108] -- 0:00:24
593000 -- (-417.905) [-415.493] (-419.099) (-415.929) * (-418.701) (-418.240) [-415.521] (-416.498) -- 0:00:24
593500 -- (-418.908) (-415.229) (-417.625) [-414.932] * [-417.113] (-416.932) (-417.792) (-421.555) -- 0:00:24
594000 -- [-415.618] (-423.562) (-417.404) (-415.632) * (-416.627) (-419.964) (-415.616) [-416.544] -- 0:00:24
594500 -- (-419.584) (-415.974) [-415.759] (-417.332) * [-416.360] (-415.358) (-414.619) (-416.030) -- 0:00:24
595000 -- (-420.205) (-415.342) (-415.914) [-420.839] * (-416.392) (-415.161) [-414.739] (-419.135) -- 0:00:24
Average standard deviation of split frequencies: 0.008849
595500 -- (-421.998) [-415.470] (-415.832) (-415.546) * [-418.580] (-416.722) (-417.308) (-415.246) -- 0:00:24
596000 -- (-422.921) [-416.516] (-416.140) (-415.341) * (-422.318) [-417.308] (-417.608) (-416.286) -- 0:00:24
596500 -- (-417.895) [-418.670] (-416.880) (-416.125) * (-416.776) (-416.319) (-416.518) [-417.171] -- 0:00:24
597000 -- (-416.912) (-416.587) [-416.016] (-418.901) * (-416.238) (-414.955) (-416.323) [-415.411] -- 0:00:24
597500 -- (-416.859) [-417.689] (-417.338) (-417.740) * (-415.646) [-415.359] (-418.422) (-414.954) -- 0:00:24
598000 -- (-415.282) (-415.703) (-415.492) [-419.886] * [-417.439] (-416.306) (-423.041) (-415.271) -- 0:00:24
598500 -- [-415.350] (-415.220) (-416.693) (-416.546) * (-416.782) [-415.472] (-420.733) (-423.608) -- 0:00:24
599000 -- [-416.500] (-417.806) (-416.683) (-415.861) * [-418.595] (-417.411) (-419.487) (-419.204) -- 0:00:24
599500 -- (-418.442) (-417.911) (-416.958) [-430.174] * [-417.741] (-419.046) (-417.156) (-418.033) -- 0:00:24
600000 -- (-416.060) [-417.854] (-417.590) (-417.210) * (-418.045) (-414.992) [-419.792] (-420.253) -- 0:00:24
Average standard deviation of split frequencies: 0.008976
600500 -- (-414.962) (-416.172) (-415.973) [-415.790] * (-417.620) [-418.924] (-416.648) (-415.394) -- 0:00:24
601000 -- (-415.481) (-417.995) [-416.335] (-416.292) * (-418.204) [-416.055] (-418.235) (-415.729) -- 0:00:24
601500 -- (-417.836) (-416.402) (-419.648) [-416.871] * [-417.264] (-420.604) (-415.464) (-420.139) -- 0:00:24
602000 -- [-417.643] (-418.408) (-420.637) (-417.705) * (-415.175) (-423.191) [-415.505] (-417.994) -- 0:00:24
602500 -- (-417.793) (-419.297) (-420.397) [-417.395] * (-415.086) (-419.881) [-417.370] (-417.882) -- 0:00:24
603000 -- (-415.338) (-417.799) [-417.236] (-418.007) * (-422.200) (-418.058) [-416.620] (-419.055) -- 0:00:24
603500 -- (-417.211) [-417.669] (-416.669) (-418.071) * (-419.930) (-419.725) (-415.680) [-416.068] -- 0:00:24
604000 -- (-416.525) (-415.989) [-417.235] (-420.764) * [-417.468] (-417.620) (-415.801) (-419.334) -- 0:00:24
604500 -- [-417.726] (-415.936) (-416.055) (-418.602) * (-418.893) [-417.659] (-416.893) (-416.167) -- 0:00:24
605000 -- (-418.054) [-416.871] (-424.539) (-417.205) * [-415.598] (-415.430) (-416.849) (-417.318) -- 0:00:24
Average standard deviation of split frequencies: 0.008800
605500 -- (-415.906) (-417.589) [-416.901] (-417.034) * [-415.499] (-415.348) (-416.031) (-415.750) -- 0:00:24
606000 -- [-418.882] (-415.975) (-422.957) (-418.195) * (-416.208) (-416.574) [-416.011] (-417.565) -- 0:00:24
606500 -- (-418.998) [-415.262] (-417.690) (-416.902) * (-418.794) (-418.797) (-418.620) [-417.440] -- 0:00:24
607000 -- (-416.824) (-415.206) (-415.745) [-418.293] * (-418.837) (-418.868) (-420.843) [-416.466] -- 0:00:23
607500 -- (-416.870) [-415.201] (-416.349) (-420.802) * [-419.900] (-416.512) (-417.306) (-416.261) -- 0:00:23
608000 -- [-415.447] (-415.484) (-416.633) (-417.806) * (-420.971) [-415.854] (-415.725) (-415.033) -- 0:00:23
608500 -- (-415.961) (-419.266) [-416.199] (-415.768) * [-420.404] (-420.319) (-415.368) (-416.199) -- 0:00:23
609000 -- (-417.155) (-420.003) (-416.767) [-416.078] * (-417.555) [-417.017] (-415.995) (-416.639) -- 0:00:23
609500 -- [-415.523] (-420.874) (-416.043) (-418.477) * (-417.016) (-425.114) [-424.071] (-417.210) -- 0:00:23
610000 -- (-415.310) (-417.515) [-415.980] (-415.380) * (-419.669) (-416.289) [-417.105] (-415.303) -- 0:00:23
Average standard deviation of split frequencies: 0.008347
610500 -- [-417.959] (-418.500) (-415.570) (-417.561) * (-418.019) (-416.470) [-416.115] (-416.901) -- 0:00:23
611000 -- (-424.744) [-415.753] (-417.886) (-418.451) * (-415.695) [-414.883] (-416.591) (-419.457) -- 0:00:23
611500 -- (-418.396) [-415.266] (-416.946) (-417.176) * [-415.815] (-416.357) (-416.970) (-415.270) -- 0:00:23
612000 -- (-420.987) [-415.123] (-418.179) (-415.249) * (-419.518) [-418.172] (-417.718) (-415.407) -- 0:00:23
612500 -- (-416.562) [-415.105] (-415.919) (-418.423) * (-415.127) (-414.838) (-417.137) [-416.806] -- 0:00:23
613000 -- (-416.662) (-416.654) (-415.791) [-417.147] * [-417.327] (-416.798) (-415.061) (-416.720) -- 0:00:23
613500 -- [-415.922] (-418.365) (-419.392) (-419.762) * (-419.333) [-418.988] (-418.311) (-415.284) -- 0:00:23
614000 -- [-415.359] (-416.143) (-419.222) (-416.883) * (-417.308) (-415.507) (-416.371) [-415.568] -- 0:00:23
614500 -- (-419.364) [-416.977] (-416.664) (-417.600) * (-416.021) (-419.598) [-418.136] (-417.122) -- 0:00:23
615000 -- (-417.100) [-415.776] (-415.738) (-418.304) * (-415.355) [-416.411] (-417.302) (-418.121) -- 0:00:23
Average standard deviation of split frequencies: 0.008179
615500 -- (-416.546) (-414.961) (-419.777) [-417.372] * (-417.685) [-416.240] (-420.227) (-418.444) -- 0:00:23
616000 -- (-419.267) (-415.270) [-416.777] (-415.564) * (-418.276) (-415.830) (-419.244) [-416.154] -- 0:00:23
616500 -- (-424.291) [-416.592] (-417.475) (-417.083) * (-418.442) (-418.740) [-417.392] (-415.743) -- 0:00:23
617000 -- (-416.020) [-416.352] (-415.713) (-415.270) * (-418.815) (-418.849) (-417.653) [-415.765] -- 0:00:23
617500 -- [-417.915] (-417.528) (-416.542) (-415.715) * (-416.973) [-418.146] (-417.661) (-420.064) -- 0:00:23
618000 -- (-416.328) (-415.358) (-414.812) [-418.359] * (-417.320) [-418.347] (-416.347) (-421.440) -- 0:00:23
618500 -- (-415.967) (-415.731) (-415.719) [-416.580] * [-416.260] (-417.462) (-416.116) (-417.730) -- 0:00:23
619000 -- (-420.684) (-418.186) [-417.384] (-418.283) * (-420.591) (-416.931) (-417.718) [-416.221] -- 0:00:23
619500 -- [-417.603] (-415.790) (-416.531) (-417.039) * [-416.655] (-418.665) (-418.190) (-416.373) -- 0:00:23
620000 -- [-415.760] (-419.166) (-418.845) (-417.344) * (-419.735) (-416.665) (-420.209) [-419.199] -- 0:00:23
Average standard deviation of split frequencies: 0.007975
620500 -- (-415.268) (-417.887) [-418.554] (-418.257) * (-419.837) (-415.911) [-417.859] (-417.598) -- 0:00:23
621000 -- [-416.924] (-420.103) (-418.498) (-418.959) * (-418.832) (-415.811) (-415.903) [-416.877] -- 0:00:23
621500 -- [-415.694] (-419.154) (-416.821) (-419.346) * (-420.780) (-419.794) (-419.174) [-420.241] -- 0:00:23
622000 -- (-415.585) [-415.233] (-421.040) (-418.711) * (-418.185) [-418.374] (-417.451) (-415.836) -- 0:00:23
622500 -- (-415.594) (-417.084) [-419.453] (-418.388) * [-416.234] (-416.163) (-415.448) (-418.130) -- 0:00:23
623000 -- (-416.295) [-418.371] (-418.681) (-421.176) * (-416.060) (-416.568) [-415.543] (-419.523) -- 0:00:22
623500 -- [-416.570] (-417.390) (-417.469) (-415.589) * (-415.228) (-424.248) (-418.687) [-415.880] -- 0:00:22
624000 -- (-418.664) (-418.199) (-418.279) [-415.427] * (-418.278) [-417.611] (-421.308) (-416.380) -- 0:00:22
624500 -- (-417.638) (-416.802) [-415.937] (-418.454) * (-421.172) [-417.393] (-416.779) (-418.457) -- 0:00:22
625000 -- (-420.742) (-417.664) [-418.270] (-417.916) * (-420.282) (-418.619) (-418.656) [-418.032] -- 0:00:22
Average standard deviation of split frequencies: 0.007719
625500 -- (-415.491) (-417.394) (-417.162) [-418.987] * (-415.519) (-419.210) (-416.916) [-418.159] -- 0:00:22
626000 -- (-416.738) (-416.996) (-415.576) [-421.236] * (-417.177) [-414.995] (-418.126) (-415.262) -- 0:00:22
626500 -- (-422.658) (-416.552) [-415.767] (-418.189) * (-417.662) [-415.713] (-418.177) (-416.090) -- 0:00:22
627000 -- (-417.041) (-415.254) [-421.205] (-419.588) * (-417.854) (-416.841) [-416.967] (-421.145) -- 0:00:22
627500 -- [-417.352] (-417.348) (-419.523) (-419.352) * (-415.465) (-416.423) [-416.178] (-417.582) -- 0:00:22
628000 -- (-417.764) [-416.193] (-416.361) (-420.783) * (-416.841) (-418.205) (-416.504) [-415.921] -- 0:00:22
628500 -- (-415.143) (-420.034) [-416.291] (-423.951) * (-416.228) [-415.835] (-417.222) (-416.040) -- 0:00:22
629000 -- (-417.208) (-415.753) (-415.367) [-419.014] * (-417.113) (-416.271) (-424.725) [-414.792] -- 0:00:22
629500 -- [-415.222] (-417.768) (-417.080) (-419.650) * (-415.290) (-416.831) (-416.972) [-415.766] -- 0:00:22
630000 -- (-415.074) [-419.124] (-416.374) (-415.969) * [-415.625] (-417.848) (-414.957) (-414.906) -- 0:00:22
Average standard deviation of split frequencies: 0.008750
630500 -- (-418.682) (-418.569) [-416.779] (-418.337) * (-415.870) (-415.819) (-415.289) [-417.838] -- 0:00:22
631000 -- [-416.898] (-419.476) (-416.418) (-418.791) * (-417.700) (-415.988) [-416.696] (-415.871) -- 0:00:22
631500 -- (-420.175) (-419.122) [-418.963] (-416.627) * (-415.334) (-415.899) (-417.271) [-416.504] -- 0:00:22
632000 -- (-418.608) [-418.064] (-418.604) (-417.978) * (-423.046) [-419.142] (-416.588) (-417.809) -- 0:00:22
632500 -- [-416.701] (-421.395) (-418.525) (-418.470) * (-417.499) (-415.820) [-417.233] (-417.999) -- 0:00:22
633000 -- [-418.857] (-416.323) (-415.698) (-415.395) * (-417.797) (-415.925) [-418.098] (-416.848) -- 0:00:22
633500 -- (-419.020) [-414.745] (-422.227) (-417.727) * [-415.215] (-416.058) (-418.453) (-416.273) -- 0:00:22
634000 -- (-417.943) (-415.207) (-419.232) [-418.441] * (-417.946) (-415.676) [-418.078] (-415.808) -- 0:00:22
634500 -- (-417.253) (-416.562) (-420.018) [-420.415] * (-415.112) [-416.280] (-418.365) (-419.200) -- 0:00:22
635000 -- (-416.181) (-417.292) (-416.747) [-416.957] * (-416.206) [-417.493] (-418.739) (-415.325) -- 0:00:22
Average standard deviation of split frequencies: 0.008415
635500 -- (-416.987) (-415.457) (-419.088) [-415.556] * [-415.526] (-420.387) (-418.837) (-417.075) -- 0:00:22
636000 -- [-415.070] (-416.390) (-415.685) (-416.475) * (-422.832) (-421.390) [-419.562] (-418.232) -- 0:00:22
636500 -- [-416.240] (-418.266) (-418.084) (-420.565) * (-416.658) (-417.199) (-416.911) [-416.476] -- 0:00:22
637000 -- [-415.634] (-418.630) (-419.593) (-416.935) * [-415.896] (-423.063) (-416.406) (-418.323) -- 0:00:22
637500 -- (-415.838) (-415.792) (-418.595) [-415.773] * (-415.030) (-420.290) [-422.002] (-417.092) -- 0:00:22
638000 -- (-420.543) [-416.119] (-422.680) (-415.924) * [-416.931] (-418.892) (-415.835) (-415.302) -- 0:00:22
638500 -- (-417.419) (-418.777) [-417.304] (-415.567) * (-416.781) (-416.151) [-419.666] (-417.453) -- 0:00:22
639000 -- (-417.626) (-418.672) [-415.872] (-415.835) * (-416.424) (-418.308) [-416.220] (-415.341) -- 0:00:22
639500 -- (-415.233) (-417.953) [-416.681] (-416.657) * [-416.340] (-416.936) (-415.951) (-417.434) -- 0:00:21
640000 -- (-421.757) (-418.061) (-416.321) [-417.428] * [-417.533] (-417.270) (-416.598) (-415.791) -- 0:00:21
Average standard deviation of split frequencies: 0.008916
640500 -- [-420.290] (-417.136) (-418.212) (-419.905) * (-416.986) (-418.367) (-418.966) [-416.454] -- 0:00:21
641000 -- (-418.190) (-415.432) [-417.714] (-418.245) * (-419.937) (-417.926) (-417.188) [-416.698] -- 0:00:21
641500 -- [-419.351] (-418.153) (-416.397) (-420.148) * (-416.903) (-417.409) [-417.000] (-421.489) -- 0:00:21
642000 -- [-416.991] (-417.484) (-416.077) (-415.919) * (-416.658) (-415.772) [-415.667] (-419.574) -- 0:00:21
642500 -- [-416.277] (-416.930) (-415.790) (-417.619) * (-416.177) [-417.878] (-416.993) (-420.656) -- 0:00:21
643000 -- (-415.850) [-419.685] (-415.322) (-416.956) * [-418.557] (-416.607) (-417.075) (-417.472) -- 0:00:21
643500 -- (-417.132) [-419.635] (-419.063) (-415.987) * (-416.427) (-418.977) (-418.201) [-420.629] -- 0:00:21
644000 -- (-416.295) (-418.646) [-421.851] (-416.881) * (-417.430) [-417.992] (-415.111) (-417.811) -- 0:00:21
644500 -- (-416.593) (-416.849) (-421.561) [-415.219] * (-416.011) [-415.242] (-417.148) (-414.898) -- 0:00:21
645000 -- (-420.505) (-415.351) [-417.286] (-418.777) * [-416.078] (-415.399) (-416.191) (-417.117) -- 0:00:21
Average standard deviation of split frequencies: 0.008886
645500 -- (-416.265) (-418.448) (-415.886) [-417.415] * [-417.219] (-416.341) (-418.269) (-420.365) -- 0:00:21
646000 -- [-417.237] (-417.060) (-416.074) (-415.681) * (-418.790) (-415.842) (-416.460) [-415.920] -- 0:00:21
646500 -- (-417.997) (-416.988) (-421.171) [-416.361] * (-418.948) (-416.579) (-419.390) [-415.063] -- 0:00:21
647000 -- (-416.105) (-415.490) (-416.286) [-417.166] * (-415.545) [-416.940] (-416.941) (-419.231) -- 0:00:21
647500 -- (-416.134) (-417.372) [-417.579] (-421.161) * (-418.687) (-420.219) [-416.074] (-419.024) -- 0:00:21
648000 -- [-421.430] (-416.882) (-415.670) (-415.345) * [-416.622] (-415.453) (-418.111) (-416.596) -- 0:00:21
648500 -- [-416.586] (-418.686) (-417.733) (-415.530) * (-415.548) (-417.181) (-419.600) [-415.221] -- 0:00:21
649000 -- (-416.066) (-416.157) (-421.144) [-417.586] * (-418.219) (-417.875) (-416.174) [-419.312] -- 0:00:21
649500 -- [-416.464] (-417.154) (-418.938) (-416.246) * (-415.729) (-419.133) [-418.031] (-416.854) -- 0:00:21
650000 -- (-415.282) (-417.989) [-418.127] (-416.269) * (-418.872) (-417.087) (-416.261) [-418.075] -- 0:00:21
Average standard deviation of split frequencies: 0.009248
650500 -- (-415.248) [-418.772] (-423.401) (-417.502) * (-417.351) [-417.905] (-416.228) (-418.642) -- 0:00:21
651000 -- [-415.280] (-416.235) (-418.031) (-418.134) * (-415.209) [-416.151] (-421.312) (-418.504) -- 0:00:21
651500 -- (-416.124) [-416.327] (-420.487) (-417.566) * (-415.485) [-418.359] (-419.493) (-416.238) -- 0:00:21
652000 -- [-419.630] (-417.282) (-415.524) (-417.981) * (-417.829) [-417.518] (-416.693) (-417.597) -- 0:00:21
652500 -- (-416.118) [-417.493] (-417.882) (-415.354) * (-417.106) [-417.526] (-417.866) (-417.900) -- 0:00:21
653000 -- (-416.368) [-416.832] (-415.432) (-418.420) * [-416.307] (-415.892) (-418.797) (-418.401) -- 0:00:21
653500 -- (-416.434) (-418.991) (-415.470) [-416.181] * (-416.047) (-416.704) (-417.795) [-420.127] -- 0:00:21
654000 -- [-415.672] (-416.362) (-417.129) (-416.634) * [-415.472] (-417.691) (-415.108) (-417.206) -- 0:00:21
654500 -- (-415.901) (-415.590) (-416.671) [-415.291] * (-415.377) (-419.733) (-417.086) [-418.320] -- 0:00:21
655000 -- (-417.264) (-415.931) [-415.346] (-418.800) * (-418.298) [-417.255] (-420.494) (-419.266) -- 0:00:21
Average standard deviation of split frequencies: 0.009426
655500 -- (-415.468) (-417.198) [-420.348] (-420.438) * (-418.296) (-417.036) (-422.165) [-418.460] -- 0:00:21
656000 -- [-415.615] (-416.517) (-420.482) (-418.199) * (-416.666) [-415.567] (-415.680) (-416.599) -- 0:00:20
656500 -- (-415.469) (-419.064) (-417.318) [-415.168] * (-416.727) (-415.283) [-417.944] (-418.117) -- 0:00:20
657000 -- (-417.897) (-420.396) (-416.645) [-416.310] * (-415.221) (-416.010) [-417.762] (-415.929) -- 0:00:20
657500 -- (-416.020) (-426.679) [-417.091] (-416.971) * [-417.954] (-416.022) (-416.101) (-416.093) -- 0:00:20
658000 -- (-417.589) (-418.653) [-415.686] (-416.439) * (-416.496) [-416.221] (-419.251) (-418.006) -- 0:00:20
658500 -- (-416.705) (-416.912) (-416.573) [-416.026] * [-417.502] (-419.145) (-416.266) (-415.709) -- 0:00:20
659000 -- (-420.304) (-417.653) (-417.639) [-414.887] * (-417.724) (-415.855) [-416.420] (-417.052) -- 0:00:20
659500 -- [-417.717] (-414.831) (-418.810) (-415.139) * (-417.204) (-416.942) [-415.937] (-415.854) -- 0:00:20
660000 -- (-418.181) [-415.965] (-416.807) (-417.835) * (-417.737) [-417.749] (-416.768) (-419.580) -- 0:00:20
Average standard deviation of split frequencies: 0.009276
660500 -- (-418.651) (-416.004) (-417.955) [-417.435] * (-417.430) (-417.161) [-417.663] (-416.157) -- 0:00:20
661000 -- (-416.103) (-416.945) [-417.208] (-422.277) * (-421.410) [-417.171] (-415.768) (-418.203) -- 0:00:20
661500 -- [-415.557] (-418.169) (-420.375) (-419.434) * (-418.267) (-417.971) [-415.816] (-421.430) -- 0:00:20
662000 -- (-418.495) (-418.644) (-417.033) [-416.669] * (-416.226) (-419.396) (-415.908) [-415.525] -- 0:00:20
662500 -- (-419.655) (-416.437) [-420.709] (-419.354) * (-416.160) (-417.398) (-417.246) [-414.945] -- 0:00:20
663000 -- [-418.543] (-416.952) (-418.839) (-416.872) * (-420.512) (-417.501) (-419.659) [-417.901] -- 0:00:20
663500 -- [-417.640] (-416.120) (-416.496) (-416.808) * (-421.491) (-420.309) [-420.400] (-415.944) -- 0:00:20
664000 -- (-417.759) (-416.948) [-415.770] (-414.854) * (-417.426) [-418.637] (-418.870) (-415.362) -- 0:00:20
664500 -- (-414.812) (-416.707) (-415.805) [-418.902] * (-417.601) [-420.500] (-417.658) (-417.236) -- 0:00:20
665000 -- (-415.844) (-416.802) [-414.801] (-415.877) * (-417.795) (-418.522) (-417.869) [-417.503] -- 0:00:20
Average standard deviation of split frequencies: 0.009368
665500 -- (-421.199) [-414.825] (-415.838) (-415.638) * (-417.796) [-417.054] (-417.458) (-416.099) -- 0:00:20
666000 -- (-415.604) (-416.365) (-415.297) [-416.438] * [-417.764] (-418.131) (-417.540) (-417.337) -- 0:00:20
666500 -- (-415.329) (-416.180) (-417.968) [-417.341] * [-416.329] (-417.902) (-416.922) (-421.029) -- 0:00:20
667000 -- (-415.493) (-419.490) (-417.816) [-415.831] * (-415.547) (-419.235) [-418.516] (-418.089) -- 0:00:20
667500 -- (-416.271) (-416.703) [-414.705] (-416.870) * (-418.946) (-418.293) [-417.038] (-418.089) -- 0:00:20
668000 -- (-415.992) (-417.274) (-415.598) [-416.476] * [-416.398] (-417.016) (-418.641) (-419.481) -- 0:00:20
668500 -- (-416.279) (-415.599) [-417.568] (-416.737) * [-415.944] (-420.751) (-419.067) (-415.185) -- 0:00:20
669000 -- (-416.490) (-417.606) (-419.459) [-418.418] * [-420.334] (-417.487) (-416.603) (-416.219) -- 0:00:20
669500 -- (-418.417) (-416.077) (-414.747) [-418.737] * (-419.714) [-418.140] (-415.879) (-417.465) -- 0:00:20
670000 -- (-422.260) [-417.765] (-421.379) (-415.218) * (-418.542) [-416.441] (-415.449) (-415.557) -- 0:00:20
Average standard deviation of split frequencies: 0.008765
670500 -- (-416.939) [-415.784] (-419.707) (-420.023) * (-419.896) (-416.994) [-417.696] (-417.930) -- 0:00:20
671000 -- (-417.646) [-415.771] (-416.702) (-425.076) * (-415.976) [-418.951] (-418.582) (-424.439) -- 0:00:20
671500 -- [-416.006] (-421.909) (-418.608) (-421.037) * (-415.697) (-415.646) [-415.266] (-415.974) -- 0:00:20
672000 -- [-420.718] (-417.795) (-418.033) (-419.179) * (-416.296) (-415.275) [-415.280] (-417.703) -- 0:00:20
672500 -- [-418.042] (-416.457) (-417.321) (-421.559) * (-419.833) (-416.193) [-418.364] (-418.675) -- 0:00:19
673000 -- (-417.517) (-416.423) [-416.517] (-416.425) * (-417.985) (-414.886) (-417.287) [-417.454] -- 0:00:19
673500 -- (-416.216) [-415.922] (-420.936) (-417.209) * [-417.179] (-415.969) (-417.971) (-422.787) -- 0:00:19
674000 -- (-416.043) (-420.912) [-416.854] (-416.934) * (-417.719) [-417.062] (-421.449) (-418.109) -- 0:00:19
674500 -- (-419.832) (-416.902) (-415.251) [-417.092] * [-416.074] (-416.228) (-419.118) (-418.535) -- 0:00:19
675000 -- [-415.504] (-416.204) (-416.032) (-415.079) * (-418.562) [-420.704] (-418.066) (-415.856) -- 0:00:19
Average standard deviation of split frequencies: 0.008368
675500 -- (-419.653) (-419.522) (-417.113) [-417.042] * [-416.305] (-417.070) (-418.873) (-416.389) -- 0:00:19
676000 -- (-415.125) [-416.330] (-415.350) (-418.075) * (-416.113) (-417.165) (-418.637) [-414.659] -- 0:00:19
676500 -- (-415.186) (-415.307) [-416.950] (-418.687) * (-416.414) (-422.002) [-416.991] (-414.703) -- 0:00:19
677000 -- (-419.115) (-416.372) (-416.096) [-417.150] * [-416.661] (-415.247) (-419.746) (-415.306) -- 0:00:19
677500 -- (-421.163) [-417.895] (-415.619) (-418.747) * (-417.446) (-415.228) (-419.001) [-415.840] -- 0:00:19
678000 -- (-417.112) (-416.760) (-419.130) [-418.119] * (-419.294) (-417.702) [-417.251] (-416.768) -- 0:00:19
678500 -- [-415.973] (-416.289) (-416.537) (-418.117) * [-417.945] (-415.896) (-416.248) (-417.472) -- 0:00:19
679000 -- (-415.445) (-416.085) (-418.377) [-415.755] * [-422.098] (-417.475) (-415.879) (-416.434) -- 0:00:19
679500 -- [-415.834] (-415.077) (-417.910) (-421.316) * (-417.831) [-416.093] (-415.346) (-414.968) -- 0:00:19
680000 -- [-416.538] (-414.679) (-416.699) (-417.599) * [-421.126] (-416.163) (-416.156) (-416.843) -- 0:00:19
Average standard deviation of split frequencies: 0.008026
680500 -- (-416.506) [-415.477] (-418.245) (-417.302) * (-415.359) (-416.006) [-419.622] (-416.707) -- 0:00:19
681000 -- (-416.412) [-415.544] (-417.890) (-416.609) * (-416.222) [-417.453] (-419.626) (-418.352) -- 0:00:19
681500 -- (-415.309) (-423.618) (-420.410) [-418.683] * (-415.429) (-416.375) [-416.986] (-420.293) -- 0:00:19
682000 -- (-415.215) (-418.826) [-417.886] (-419.002) * (-416.463) (-414.773) (-419.937) [-422.608] -- 0:00:19
682500 -- (-419.256) [-418.790] (-416.854) (-417.128) * (-415.315) (-416.447) (-419.284) [-414.783] -- 0:00:19
683000 -- (-415.239) (-421.339) (-416.935) [-418.720] * (-416.670) [-415.508] (-419.419) (-420.282) -- 0:00:19
683500 -- (-415.494) (-415.901) [-418.575] (-414.995) * (-415.742) [-416.814] (-417.639) (-417.650) -- 0:00:19
684000 -- [-415.012] (-417.941) (-417.655) (-415.063) * (-420.455) (-415.617) (-420.448) [-417.030] -- 0:00:19
684500 -- (-414.888) (-419.232) [-418.644] (-418.567) * [-417.239] (-415.373) (-416.955) (-417.208) -- 0:00:19
685000 -- (-416.726) (-416.427) [-417.208] (-417.430) * (-416.420) [-416.467] (-416.913) (-416.598) -- 0:00:19
Average standard deviation of split frequencies: 0.008044
685500 -- (-417.047) [-418.364] (-416.266) (-421.050) * (-415.915) (-415.531) (-417.088) [-414.946] -- 0:00:19
686000 -- (-417.035) (-420.464) (-420.281) [-415.567] * [-419.132] (-416.861) (-416.196) (-416.632) -- 0:00:19
686500 -- (-421.260) [-418.739] (-417.568) (-416.428) * (-417.661) (-418.839) [-417.295] (-415.746) -- 0:00:19
687000 -- (-415.516) [-417.832] (-417.641) (-417.722) * [-416.063] (-416.430) (-419.765) (-415.168) -- 0:00:19
687500 -- (-418.247) (-416.056) [-415.545] (-415.842) * (-416.044) (-416.790) [-415.294] (-415.634) -- 0:00:19
688000 -- (-417.945) [-418.066] (-415.125) (-419.348) * (-418.721) (-418.380) (-418.741) [-416.387] -- 0:00:19
688500 -- [-418.292] (-418.540) (-415.250) (-417.484) * (-416.816) [-416.562] (-416.037) (-416.778) -- 0:00:19
689000 -- (-418.381) (-416.634) (-418.366) [-415.233] * (-418.459) (-416.121) (-416.269) [-416.132] -- 0:00:18
689500 -- [-416.666] (-418.594) (-418.062) (-416.894) * (-416.590) (-418.919) (-417.693) [-415.663] -- 0:00:18
690000 -- (-416.591) (-416.714) [-419.349] (-415.494) * (-419.335) [-418.713] (-420.446) (-415.335) -- 0:00:18
Average standard deviation of split frequencies: 0.008489
690500 -- [-419.499] (-415.608) (-417.735) (-417.918) * (-415.917) [-416.474] (-418.215) (-416.182) -- 0:00:18
691000 -- (-415.444) (-416.713) [-415.630] (-415.489) * (-418.000) [-415.474] (-419.403) (-417.185) -- 0:00:18
691500 -- (-418.927) [-416.972] (-415.795) (-419.539) * [-415.522] (-421.910) (-419.164) (-418.219) -- 0:00:18
692000 -- (-415.249) (-417.434) [-416.199] (-420.556) * (-415.917) (-416.487) [-420.688] (-415.841) -- 0:00:18
692500 -- [-416.469] (-416.942) (-420.172) (-415.089) * [-415.663] (-415.681) (-419.829) (-417.744) -- 0:00:18
693000 -- [-415.472] (-416.396) (-417.712) (-416.020) * (-420.319) (-416.149) (-421.245) [-421.392] -- 0:00:18
693500 -- (-415.827) (-416.962) (-416.333) [-417.981] * [-415.385] (-415.813) (-420.205) (-416.039) -- 0:00:18
694000 -- (-417.883) (-420.357) [-415.918] (-416.463) * [-418.122] (-416.565) (-418.350) (-416.297) -- 0:00:18
694500 -- (-416.998) [-417.724] (-420.318) (-416.591) * (-417.439) (-417.682) (-416.887) [-417.542] -- 0:00:18
695000 -- (-419.925) (-417.692) [-415.017] (-415.568) * (-415.343) (-419.180) (-417.968) [-418.162] -- 0:00:18
Average standard deviation of split frequencies: 0.008212
695500 -- (-416.130) (-415.428) (-416.035) [-415.150] * (-415.860) (-419.581) [-418.027] (-417.422) -- 0:00:18
696000 -- (-416.717) (-417.570) (-415.536) [-415.434] * [-417.428] (-420.835) (-419.005) (-417.030) -- 0:00:18
696500 -- (-416.104) (-416.376) (-418.131) [-415.286] * (-417.279) (-418.007) (-416.669) [-418.486] -- 0:00:18
697000 -- (-415.334) [-415.146] (-418.188) (-419.050) * (-420.131) (-418.774) (-419.608) [-415.424] -- 0:00:18
697500 -- (-418.906) [-415.211] (-417.467) (-415.028) * (-418.595) (-417.221) [-415.134] (-418.502) -- 0:00:18
698000 -- (-415.719) [-416.626] (-415.831) (-415.974) * (-416.388) (-416.887) (-418.280) [-418.156] -- 0:00:18
698500 -- (-415.108) (-425.462) [-416.798] (-417.111) * (-416.010) [-418.326] (-417.213) (-416.471) -- 0:00:18
699000 -- (-415.541) [-416.857] (-416.137) (-417.517) * (-418.761) (-420.754) (-418.290) [-419.695] -- 0:00:18
699500 -- (-415.091) (-417.782) (-418.238) [-419.215] * (-417.352) (-418.607) (-419.214) [-414.929] -- 0:00:18
700000 -- (-415.713) (-416.980) [-416.031] (-418.674) * (-415.500) (-419.509) (-416.072) [-414.971] -- 0:00:18
Average standard deviation of split frequencies: 0.007821
700500 -- (-415.578) (-417.562) (-414.886) [-421.898] * [-415.898] (-418.123) (-417.610) (-416.666) -- 0:00:18
701000 -- (-415.608) [-414.924] (-419.599) (-419.864) * (-415.320) [-416.474] (-417.754) (-415.786) -- 0:00:18
701500 -- [-416.609] (-415.052) (-416.787) (-417.841) * (-415.182) (-415.018) (-416.126) [-415.486] -- 0:00:18
702000 -- (-416.904) (-416.523) (-418.504) [-416.281] * (-415.396) (-415.338) (-417.708) [-415.678] -- 0:00:18
702500 -- (-417.684) [-419.078] (-415.749) (-418.453) * [-416.854] (-418.909) (-419.876) (-417.056) -- 0:00:18
703000 -- (-415.948) (-419.939) [-414.987] (-416.318) * (-416.146) (-416.395) (-421.864) [-417.116] -- 0:00:18
703500 -- (-415.897) (-420.059) (-417.377) [-417.570] * [-414.849] (-415.693) (-415.988) (-418.000) -- 0:00:18
704000 -- [-416.372] (-415.771) (-416.165) (-418.614) * (-415.199) [-416.699] (-415.485) (-416.310) -- 0:00:18
704500 -- (-416.944) (-421.601) (-416.159) [-415.650] * [-418.235] (-418.436) (-416.834) (-415.175) -- 0:00:18
705000 -- [-418.853] (-419.257) (-418.847) (-420.429) * [-416.087] (-416.529) (-416.382) (-417.773) -- 0:00:17
Average standard deviation of split frequencies: 0.008054
705500 -- (-416.125) (-419.620) (-417.012) [-419.694] * (-416.069) (-425.070) (-415.121) [-418.681] -- 0:00:17
706000 -- (-416.127) [-417.618] (-416.960) (-419.834) * [-416.578] (-417.264) (-416.276) (-416.064) -- 0:00:17
706500 -- (-416.017) (-420.966) (-415.553) [-418.932] * (-417.567) (-416.859) (-418.021) [-417.995] -- 0:00:17
707000 -- (-418.260) (-417.392) (-416.672) [-417.324] * (-416.969) (-419.098) (-417.462) [-419.811] -- 0:00:17
707500 -- (-417.946) (-415.665) [-416.951] (-415.976) * [-420.258] (-417.895) (-418.134) (-416.833) -- 0:00:17
708000 -- [-419.508] (-418.085) (-417.353) (-419.117) * (-415.576) (-419.628) [-415.218] (-415.979) -- 0:00:17
708500 -- [-417.448] (-420.017) (-417.971) (-416.294) * (-416.352) (-416.885) [-414.864] (-423.620) -- 0:00:17
709000 -- (-417.752) (-417.992) (-420.759) [-416.795] * (-423.336) (-423.857) [-415.493] (-416.956) -- 0:00:17
709500 -- (-415.491) (-417.161) [-419.307] (-418.498) * (-416.362) (-423.247) (-416.230) [-417.012] -- 0:00:17
710000 -- (-417.284) (-418.328) (-418.344) [-420.616] * (-418.472) (-418.791) [-416.945] (-419.585) -- 0:00:17
Average standard deviation of split frequencies: 0.007783
710500 -- (-415.693) (-420.440) [-419.978] (-421.656) * (-418.478) (-416.635) [-416.490] (-415.906) -- 0:00:17
711000 -- [-417.627] (-417.209) (-418.131) (-419.934) * (-420.416) (-418.543) (-418.407) [-417.088] -- 0:00:17
711500 -- (-416.386) (-418.811) (-416.575) [-416.497] * (-420.797) [-417.072] (-417.014) (-417.011) -- 0:00:17
712000 -- (-415.164) (-417.035) [-416.997] (-417.746) * (-417.789) (-420.941) (-419.919) [-417.251] -- 0:00:17
712500 -- (-418.423) (-415.381) (-416.780) [-415.749] * (-418.787) (-419.483) (-419.507) [-415.132] -- 0:00:17
713000 -- (-415.567) (-416.730) (-416.920) [-418.100] * (-419.263) (-416.544) (-415.079) [-415.770] -- 0:00:17
713500 -- (-416.408) (-415.303) (-415.866) [-415.705] * [-419.386] (-416.730) (-417.008) (-417.272) -- 0:00:17
714000 -- (-422.334) [-415.135] (-416.178) (-417.971) * (-423.202) (-418.175) [-415.035] (-416.509) -- 0:00:17
714500 -- (-419.241) (-417.679) [-415.579] (-417.066) * (-419.919) [-416.246] (-417.101) (-417.033) -- 0:00:17
715000 -- (-418.246) (-420.914) (-415.359) [-417.265] * (-418.638) (-419.801) (-417.008) [-416.420] -- 0:00:17
Average standard deviation of split frequencies: 0.008189
715500 -- (-415.207) [-415.905] (-422.061) (-419.012) * (-417.701) (-416.553) (-416.472) [-418.376] -- 0:00:17
716000 -- (-416.672) (-417.546) [-415.944] (-416.070) * (-415.870) (-417.716) [-418.368] (-419.491) -- 0:00:17
716500 -- (-417.358) (-416.897) (-416.411) [-420.854] * (-417.866) (-415.823) [-415.915] (-417.982) -- 0:00:17
717000 -- [-415.960] (-417.074) (-416.166) (-416.365) * [-416.606] (-417.773) (-416.564) (-420.423) -- 0:00:17
717500 -- (-418.155) (-417.655) [-418.792] (-415.441) * (-419.494) (-415.605) (-418.196) [-415.044] -- 0:00:17
718000 -- (-416.742) (-415.786) [-415.676] (-415.859) * (-416.946) [-418.668] (-416.990) (-417.465) -- 0:00:17
718500 -- (-417.199) (-418.411) [-415.067] (-414.985) * (-417.052) (-415.905) [-416.850] (-416.819) -- 0:00:17
719000 -- [-414.898] (-417.358) (-417.428) (-417.091) * (-416.884) (-414.959) (-420.672) [-415.925] -- 0:00:17
719500 -- (-417.102) (-415.586) [-415.948] (-417.461) * (-415.350) [-415.818] (-415.695) (-414.871) -- 0:00:17
720000 -- [-415.484] (-415.195) (-416.756) (-416.939) * (-417.679) (-418.108) (-417.468) [-416.320] -- 0:00:17
Average standard deviation of split frequencies: 0.008329
720500 -- (-416.235) [-414.560] (-417.840) (-419.547) * [-415.448] (-417.336) (-423.377) (-418.216) -- 0:00:17
721000 -- (-416.668) [-419.561] (-417.789) (-420.344) * [-418.681] (-415.563) (-416.828) (-418.652) -- 0:00:17
721500 -- (-414.958) (-415.685) (-415.199) [-415.634] * (-416.895) (-415.847) [-417.311] (-417.314) -- 0:00:16
722000 -- (-416.486) (-415.664) [-417.196] (-415.204) * (-416.795) [-416.084] (-417.748) (-417.687) -- 0:00:16
722500 -- (-415.562) (-415.392) (-415.302) [-416.016] * [-417.948] (-421.020) (-418.995) (-416.016) -- 0:00:16
723000 -- [-415.683] (-418.695) (-415.487) (-417.915) * (-422.143) [-422.190] (-416.098) (-417.455) -- 0:00:16
723500 -- [-416.305] (-418.195) (-415.497) (-418.843) * (-420.147) (-417.715) (-415.032) [-417.018] -- 0:00:16
724000 -- [-414.610] (-422.700) (-416.531) (-416.358) * [-417.219] (-416.783) (-417.107) (-417.748) -- 0:00:16
724500 -- (-417.690) (-417.290) [-417.260] (-417.457) * (-416.971) (-418.067) [-418.324] (-415.371) -- 0:00:16
725000 -- [-420.624] (-419.482) (-416.290) (-418.900) * (-415.680) (-416.340) [-417.681] (-418.146) -- 0:00:16
Average standard deviation of split frequencies: 0.008365
725500 -- [-415.438] (-417.131) (-417.101) (-417.622) * (-420.163) (-416.155) (-417.512) [-416.362] -- 0:00:16
726000 -- (-419.644) [-417.104] (-420.581) (-416.473) * (-420.229) (-417.884) [-416.263] (-417.495) -- 0:00:16
726500 -- (-420.851) (-424.254) (-415.611) [-416.637] * (-416.912) (-418.073) [-422.264] (-416.514) -- 0:00:16
727000 -- (-416.063) (-417.704) (-427.002) [-415.994] * [-421.021] (-421.119) (-421.784) (-418.053) -- 0:00:16
727500 -- (-415.627) (-418.988) (-415.522) [-415.703] * (-417.515) (-416.311) [-416.931] (-415.059) -- 0:00:16
728000 -- [-415.850] (-419.285) (-419.892) (-418.380) * (-416.551) [-415.981] (-416.942) (-416.548) -- 0:00:16
728500 -- (-417.550) (-419.232) [-416.717] (-420.630) * (-416.364) (-416.805) [-414.837] (-415.878) -- 0:00:16
729000 -- (-417.666) [-417.015] (-418.368) (-416.363) * (-416.534) [-417.443] (-415.038) (-418.267) -- 0:00:16
729500 -- (-418.057) [-416.423] (-415.751) (-416.619) * (-416.044) (-416.551) (-419.152) [-415.672] -- 0:00:16
730000 -- (-416.305) [-415.359] (-416.338) (-418.202) * (-417.348) (-415.748) [-416.093] (-415.938) -- 0:00:16
Average standard deviation of split frequencies: 0.008729
730500 -- (-417.449) (-419.718) (-415.807) [-415.561] * (-417.850) [-415.217] (-415.242) (-415.286) -- 0:00:16
731000 -- [-416.116] (-419.470) (-415.576) (-416.319) * (-416.751) (-415.934) (-417.836) [-415.607] -- 0:00:16
731500 -- (-418.019) (-415.209) (-416.399) [-418.291] * (-416.475) (-416.071) (-416.152) [-416.848] -- 0:00:16
732000 -- (-417.846) (-416.823) (-419.180) [-419.524] * (-417.909) (-415.185) [-416.255] (-415.446) -- 0:00:16
732500 -- (-421.048) (-416.868) [-419.988] (-415.579) * (-416.938) (-419.585) (-416.781) [-415.852] -- 0:00:16
733000 -- [-420.310] (-417.058) (-421.899) (-416.478) * (-415.039) (-416.071) [-417.213] (-418.664) -- 0:00:16
733500 -- (-418.037) (-415.457) (-420.625) [-414.989] * [-415.992] (-417.906) (-418.918) (-415.890) -- 0:00:15
734000 -- [-416.023] (-416.865) (-416.595) (-417.687) * (-416.922) (-416.960) [-416.204] (-418.148) -- 0:00:16
734500 -- (-415.444) (-415.614) (-416.496) [-418.826] * (-416.756) (-415.610) [-415.012] (-418.809) -- 0:00:16
735000 -- (-419.765) [-416.900] (-415.749) (-416.149) * (-416.551) [-418.162] (-416.059) (-417.277) -- 0:00:16
Average standard deviation of split frequencies: 0.008687
735500 -- (-418.376) (-416.342) [-416.172] (-417.097) * (-417.163) (-416.666) (-418.480) [-415.298] -- 0:00:16
736000 -- (-416.993) (-416.069) [-419.568] (-416.353) * (-416.514) (-415.742) (-417.527) [-416.280] -- 0:00:16
736500 -- [-416.033] (-418.063) (-418.169) (-416.346) * (-420.951) (-419.369) [-416.541] (-415.752) -- 0:00:16
737000 -- (-415.648) (-419.093) (-417.744) [-415.862] * [-416.288] (-415.369) (-416.865) (-418.085) -- 0:00:16
737500 -- (-419.290) (-416.672) [-415.931] (-416.639) * (-417.430) (-419.863) [-415.400] (-417.425) -- 0:00:16
738000 -- (-416.194) [-416.006] (-416.234) (-417.172) * [-417.663] (-419.352) (-416.508) (-416.584) -- 0:00:15
738500 -- (-417.584) (-416.092) [-418.339] (-415.407) * (-416.665) (-415.890) [-416.341] (-422.696) -- 0:00:15
739000 -- (-414.800) (-417.456) (-416.284) [-415.734] * [-415.521] (-415.896) (-415.485) (-418.644) -- 0:00:15
739500 -- (-416.995) [-416.412] (-416.259) (-420.830) * (-415.545) (-418.488) [-416.895] (-416.438) -- 0:00:15
740000 -- (-416.168) (-417.854) [-415.406] (-416.163) * [-420.073] (-417.365) (-415.157) (-420.477) -- 0:00:15
Average standard deviation of split frequencies: 0.008486
740500 -- (-418.051) (-418.169) [-415.421] (-417.508) * (-417.642) (-415.675) (-416.303) [-415.934] -- 0:00:15
741000 -- (-417.947) (-418.032) [-417.635] (-417.823) * (-418.320) [-416.653] (-417.252) (-421.015) -- 0:00:15
741500 -- (-417.930) (-416.247) (-415.559) [-415.541] * [-416.489] (-415.102) (-419.914) (-418.710) -- 0:00:15
742000 -- (-418.844) (-419.513) [-417.634] (-415.070) * (-418.334) (-417.208) [-418.292] (-416.804) -- 0:00:15
742500 -- (-421.292) [-416.120] (-416.117) (-415.001) * (-418.751) [-415.449] (-417.317) (-416.974) -- 0:00:15
743000 -- (-417.054) [-418.332] (-416.207) (-416.031) * [-417.270] (-417.772) (-417.519) (-416.938) -- 0:00:15
743500 -- (-419.418) [-419.418] (-416.618) (-417.528) * [-416.451] (-415.577) (-417.770) (-417.221) -- 0:00:15
744000 -- (-420.961) (-427.086) [-416.903] (-417.286) * [-416.491] (-415.784) (-416.577) (-416.621) -- 0:00:15
744500 -- [-418.373] (-416.713) (-415.782) (-415.306) * (-420.487) [-423.425] (-418.292) (-422.682) -- 0:00:15
745000 -- [-416.386] (-415.055) (-416.218) (-416.311) * (-420.918) (-420.381) (-416.934) [-417.270] -- 0:00:15
Average standard deviation of split frequencies: 0.008257
745500 -- (-415.766) (-418.314) [-415.622] (-414.619) * (-419.090) (-414.949) (-417.958) [-416.761] -- 0:00:15
746000 -- (-419.156) (-418.423) [-415.114] (-416.707) * (-415.615) [-420.722] (-417.636) (-418.292) -- 0:00:15
746500 -- (-420.297) (-418.378) (-415.632) [-416.552] * (-417.448) [-419.476] (-419.133) (-415.189) -- 0:00:15
747000 -- (-417.155) (-424.984) (-415.092) [-420.891] * [-415.846] (-416.936) (-417.220) (-416.503) -- 0:00:15
747500 -- (-415.311) (-420.826) [-416.465] (-420.011) * (-419.713) (-420.893) (-417.180) [-416.675] -- 0:00:15
748000 -- (-417.075) [-418.591] (-417.587) (-420.668) * [-416.626] (-416.912) (-418.309) (-416.534) -- 0:00:15
748500 -- (-416.286) (-417.535) [-420.178] (-418.124) * [-417.793] (-418.292) (-418.476) (-417.486) -- 0:00:15
749000 -- (-417.051) (-420.816) [-418.447] (-414.829) * (-416.175) [-419.741] (-417.639) (-420.317) -- 0:00:15
749500 -- [-417.070] (-415.864) (-415.736) (-416.781) * (-418.110) (-417.947) [-418.860] (-415.964) -- 0:00:15
750000 -- (-416.660) [-415.387] (-417.122) (-419.615) * (-417.298) (-418.436) (-421.398) [-416.587] -- 0:00:15
Average standard deviation of split frequencies: 0.007996
750500 -- (-415.170) (-421.305) (-415.859) [-415.768] * (-417.717) (-417.388) [-417.944] (-415.640) -- 0:00:14
751000 -- [-416.758] (-417.718) (-415.267) (-416.623) * [-416.746] (-419.596) (-419.722) (-415.150) -- 0:00:15
751500 -- [-416.650] (-419.303) (-417.391) (-416.651) * (-423.809) (-419.669) [-415.589] (-415.615) -- 0:00:15
752000 -- (-418.348) (-419.088) [-415.939] (-418.496) * (-417.636) (-417.268) [-416.647] (-419.335) -- 0:00:15
752500 -- (-416.721) [-420.198] (-415.967) (-419.315) * (-416.509) (-417.909) [-419.168] (-421.963) -- 0:00:15
753000 -- [-418.081] (-420.540) (-415.455) (-419.137) * (-416.671) (-419.599) (-415.311) [-416.132] -- 0:00:15
753500 -- (-419.022) [-415.563] (-417.296) (-416.406) * (-414.840) (-417.079) (-419.149) [-421.823] -- 0:00:15
754000 -- (-423.167) [-416.583] (-416.951) (-415.789) * [-414.971] (-417.225) (-417.352) (-417.124) -- 0:00:15
754500 -- (-421.865) (-417.139) (-416.597) [-414.744] * (-420.254) (-416.629) (-416.836) [-417.016] -- 0:00:14
755000 -- [-417.742] (-417.690) (-416.511) (-416.896) * (-417.357) (-419.357) (-419.342) [-416.059] -- 0:00:14
Average standard deviation of split frequencies: 0.008189
755500 -- [-417.276] (-415.910) (-416.962) (-416.070) * (-417.481) (-415.825) (-420.668) [-415.431] -- 0:00:14
756000 -- (-421.022) [-417.689] (-419.567) (-415.186) * [-416.307] (-419.406) (-416.736) (-416.710) -- 0:00:14
756500 -- [-418.244] (-421.612) (-416.974) (-416.196) * (-416.149) (-416.542) [-419.371] (-415.770) -- 0:00:14
757000 -- (-420.113) [-418.844] (-420.203) (-415.594) * [-421.095] (-417.771) (-415.912) (-418.509) -- 0:00:14
757500 -- (-416.666) [-420.073] (-419.250) (-419.856) * [-417.959] (-416.040) (-416.832) (-418.974) -- 0:00:14
758000 -- [-417.080] (-422.183) (-421.646) (-417.029) * (-416.124) (-421.314) [-418.519] (-417.179) -- 0:00:14
758500 -- [-416.711] (-417.133) (-420.258) (-420.000) * (-418.797) [-416.626] (-416.954) (-416.609) -- 0:00:14
759000 -- (-417.638) (-420.164) (-417.025) [-422.296] * [-418.864] (-422.307) (-420.063) (-416.314) -- 0:00:14
759500 -- [-418.989] (-417.933) (-422.804) (-416.106) * [-415.606] (-420.335) (-420.214) (-415.596) -- 0:00:14
760000 -- (-418.514) [-417.736] (-416.554) (-416.206) * [-415.619] (-421.083) (-416.923) (-418.121) -- 0:00:14
Average standard deviation of split frequencies: 0.008263
760500 -- (-420.733) [-417.346] (-415.831) (-418.222) * (-415.442) [-416.533] (-420.722) (-418.763) -- 0:00:14
761000 -- (-419.327) (-416.699) [-415.022] (-423.777) * [-415.690] (-415.012) (-421.990) (-417.450) -- 0:00:14
761500 -- (-420.416) (-416.626) [-416.202] (-422.906) * [-415.741] (-415.772) (-420.165) (-419.847) -- 0:00:14
762000 -- (-417.812) [-416.433] (-419.944) (-415.948) * (-416.562) (-417.988) [-418.015] (-422.854) -- 0:00:14
762500 -- (-415.543) [-416.304] (-416.074) (-415.385) * (-418.662) (-416.513) (-416.930) [-420.062] -- 0:00:14
763000 -- (-415.231) (-422.630) [-415.526] (-417.380) * [-416.873] (-418.401) (-415.313) (-419.357) -- 0:00:14
763500 -- (-414.643) (-415.940) [-415.891] (-417.337) * [-416.249] (-417.365) (-418.104) (-417.988) -- 0:00:14
764000 -- [-416.419] (-417.741) (-419.682) (-417.041) * (-415.462) (-420.295) (-415.518) [-417.751] -- 0:00:14
764500 -- (-416.166) [-417.000] (-415.563) (-415.693) * (-416.085) (-420.848) [-416.674] (-418.800) -- 0:00:14
765000 -- (-416.518) [-418.737] (-418.545) (-417.122) * (-415.403) [-416.676] (-416.453) (-416.872) -- 0:00:14
Average standard deviation of split frequencies: 0.008288
765500 -- (-415.459) (-415.248) [-416.523] (-420.145) * (-415.322) (-423.662) [-416.381] (-417.188) -- 0:00:14
766000 -- (-415.408) [-423.256] (-414.745) (-416.170) * [-417.603] (-419.788) (-419.228) (-415.936) -- 0:00:14
766500 -- (-417.370) (-418.617) (-415.635) [-415.618] * [-415.658] (-415.432) (-420.391) (-416.016) -- 0:00:14
767000 -- (-416.906) (-414.792) [-422.923] (-415.518) * (-420.932) (-415.194) (-415.973) [-416.602] -- 0:00:13
767500 -- (-416.313) (-422.709) [-415.976] (-416.783) * (-417.369) [-415.147] (-418.060) (-417.984) -- 0:00:14
768000 -- (-417.260) (-418.369) [-416.111] (-418.485) * (-417.020) [-418.846] (-419.056) (-421.097) -- 0:00:14
768500 -- (-417.201) (-422.251) (-419.063) [-420.313] * (-416.755) (-417.634) [-415.612] (-416.499) -- 0:00:14
769000 -- (-415.897) (-415.931) (-419.651) [-415.692] * (-418.018) [-415.381] (-421.609) (-417.284) -- 0:00:14
769500 -- (-417.359) (-416.507) [-417.415] (-417.702) * (-415.680) (-417.411) [-417.858] (-417.855) -- 0:00:14
770000 -- (-418.131) [-418.111] (-419.102) (-427.790) * (-415.090) [-418.575] (-422.207) (-419.756) -- 0:00:14
Average standard deviation of split frequencies: 0.008074
770500 -- [-417.674] (-417.846) (-420.700) (-419.523) * (-416.867) [-415.369] (-417.144) (-417.353) -- 0:00:13
771000 -- (-418.925) (-417.037) [-417.008] (-419.903) * (-417.906) (-416.216) [-417.885] (-418.025) -- 0:00:13
771500 -- [-416.083] (-418.570) (-416.731) (-418.581) * (-416.799) (-424.999) [-417.779] (-416.230) -- 0:00:13
772000 -- (-415.828) [-415.547] (-415.913) (-416.814) * (-419.372) (-417.929) (-417.038) [-416.203] -- 0:00:13
772500 -- (-417.909) (-418.754) [-418.913] (-418.848) * [-416.429] (-416.979) (-421.008) (-417.215) -- 0:00:13
773000 -- (-419.190) (-416.425) (-417.329) [-417.510] * (-417.373) [-418.925] (-416.374) (-416.083) -- 0:00:13
773500 -- [-416.956] (-417.989) (-418.260) (-416.249) * (-420.630) (-414.602) [-417.135] (-417.675) -- 0:00:13
774000 -- (-417.703) [-417.697] (-418.615) (-417.041) * [-417.187] (-414.766) (-417.238) (-415.055) -- 0:00:13
774500 -- (-418.805) [-419.565] (-415.419) (-416.298) * (-416.337) (-419.824) (-418.934) [-417.538] -- 0:00:13
775000 -- (-415.226) (-420.697) (-416.039) [-415.589] * (-416.628) (-419.336) [-415.629] (-417.792) -- 0:00:13
Average standard deviation of split frequencies: 0.008059
775500 -- [-416.953] (-418.283) (-414.994) (-416.990) * (-415.516) [-417.258] (-417.199) (-421.936) -- 0:00:13
776000 -- (-417.469) (-416.700) [-416.620] (-419.431) * (-417.866) (-417.374) [-415.730] (-418.978) -- 0:00:13
776500 -- [-420.035] (-415.917) (-416.757) (-420.878) * (-415.573) (-416.149) (-417.278) [-419.235] -- 0:00:13
777000 -- [-420.272] (-416.311) (-416.036) (-417.017) * [-416.356] (-416.177) (-418.863) (-416.143) -- 0:00:13
777500 -- [-417.416] (-419.145) (-418.655) (-418.814) * (-418.861) (-415.166) [-420.724] (-415.457) -- 0:00:13
778000 -- (-415.173) [-418.670] (-419.206) (-418.095) * [-417.354] (-415.382) (-420.119) (-417.292) -- 0:00:13
778500 -- (-419.183) (-418.880) (-417.135) [-415.294] * (-419.171) (-415.804) (-417.859) [-417.903] -- 0:00:13
779000 -- [-417.779] (-418.610) (-415.205) (-416.340) * (-424.105) (-419.486) (-416.682) [-418.542] -- 0:00:13
779500 -- (-421.039) [-415.593] (-415.566) (-418.404) * (-418.581) (-416.914) (-416.154) [-415.973] -- 0:00:13
780000 -- (-415.893) (-419.218) [-416.888] (-414.727) * (-417.074) (-416.836) [-419.048] (-416.754) -- 0:00:13
Average standard deviation of split frequencies: 0.008534
780500 -- [-420.169] (-415.125) (-417.627) (-416.990) * [-415.076] (-425.122) (-417.450) (-416.129) -- 0:00:13
781000 -- (-415.004) (-415.216) [-415.458] (-418.085) * (-420.145) (-417.586) [-415.942] (-415.819) -- 0:00:13
781500 -- (-416.026) (-415.988) (-415.549) [-416.153] * [-419.019] (-417.584) (-418.873) (-420.035) -- 0:00:13
782000 -- (-416.816) (-417.179) [-419.335] (-416.616) * (-416.549) (-415.325) [-424.921] (-419.597) -- 0:00:13
782500 -- (-416.351) (-418.148) (-419.586) [-416.718] * (-417.294) [-418.579] (-415.948) (-421.502) -- 0:00:13
783000 -- (-417.302) (-421.261) (-419.448) [-417.203] * [-416.950] (-417.421) (-416.331) (-416.565) -- 0:00:13
783500 -- [-415.049] (-416.309) (-415.394) (-415.316) * (-415.694) [-416.416] (-417.201) (-419.269) -- 0:00:12
784000 -- (-417.073) [-415.129] (-417.551) (-417.086) * (-417.018) (-415.918) [-416.979] (-418.467) -- 0:00:12
784500 -- (-414.682) (-416.798) [-419.233] (-418.311) * (-417.459) (-414.792) (-415.397) [-420.043] -- 0:00:12
785000 -- (-414.837) [-417.847] (-418.855) (-417.082) * (-418.183) (-418.063) (-416.379) [-416.985] -- 0:00:13
Average standard deviation of split frequencies: 0.008996
785500 -- (-417.285) [-415.483] (-420.049) (-421.639) * (-417.568) (-415.787) (-415.701) [-416.220] -- 0:00:13
786000 -- [-416.149] (-416.011) (-419.986) (-417.609) * [-415.544] (-416.741) (-415.769) (-417.902) -- 0:00:13
786500 -- [-417.793] (-417.270) (-416.626) (-422.984) * [-415.532] (-418.590) (-417.473) (-417.423) -- 0:00:13
787000 -- (-418.581) (-417.178) (-418.701) [-415.299] * (-416.778) (-416.620) [-418.810] (-416.359) -- 0:00:12
787500 -- (-419.176) [-418.575] (-417.971) (-416.187) * (-419.983) (-417.360) [-419.543] (-418.875) -- 0:00:12
788000 -- [-416.000] (-417.554) (-417.455) (-417.803) * (-415.455) (-416.132) (-416.742) [-416.311] -- 0:00:12
788500 -- (-415.481) [-417.461] (-416.400) (-417.655) * (-417.243) (-415.207) (-419.149) [-419.424] -- 0:00:12
789000 -- [-416.085] (-416.634) (-418.828) (-419.727) * (-414.846) [-415.277] (-418.902) (-415.848) -- 0:00:12
789500 -- (-416.717) (-416.498) [-416.435] (-421.293) * [-415.115] (-416.167) (-414.850) (-416.089) -- 0:00:12
790000 -- (-415.852) (-417.484) (-418.913) [-419.134] * (-416.367) (-415.566) [-422.175] (-418.026) -- 0:00:12
Average standard deviation of split frequencies: 0.009715
790500 -- [-414.947] (-417.520) (-416.658) (-417.312) * [-416.208] (-416.621) (-420.429) (-422.569) -- 0:00:12
791000 -- (-416.917) [-415.510] (-416.195) (-417.725) * (-415.178) (-416.679) [-416.068] (-418.079) -- 0:00:12
791500 -- (-417.245) (-417.176) (-418.826) [-416.812] * (-416.556) (-418.391) [-415.927] (-416.252) -- 0:00:12
792000 -- (-417.350) [-414.787] (-416.724) (-419.533) * (-415.911) (-418.435) [-414.826] (-416.135) -- 0:00:12
792500 -- [-417.248] (-415.941) (-418.102) (-417.495) * [-416.013] (-418.123) (-414.816) (-416.954) -- 0:00:12
793000 -- (-415.609) (-417.077) (-417.687) [-418.171] * (-415.756) [-417.788] (-415.581) (-417.339) -- 0:00:12
793500 -- [-414.863] (-417.345) (-417.517) (-417.791) * (-415.149) (-418.136) (-417.158) [-420.942] -- 0:00:12
794000 -- (-420.068) [-418.432] (-422.332) (-421.836) * (-416.036) (-419.878) [-416.325] (-419.334) -- 0:00:12
794500 -- (-419.690) (-420.406) [-419.071] (-418.127) * (-415.187) [-416.870] (-424.255) (-419.323) -- 0:00:12
795000 -- [-417.782] (-421.230) (-415.927) (-415.061) * (-415.631) (-416.160) (-419.951) [-417.556] -- 0:00:12
Average standard deviation of split frequencies: 0.009216
795500 -- (-415.624) (-421.626) [-421.297] (-417.234) * [-416.904] (-416.734) (-416.926) (-420.580) -- 0:00:12
796000 -- [-417.464] (-418.428) (-416.529) (-419.220) * [-415.949] (-416.204) (-416.557) (-416.019) -- 0:00:12
796500 -- (-417.211) (-419.416) [-417.857] (-416.629) * (-417.452) (-416.139) (-418.661) [-418.292] -- 0:00:12
797000 -- [-414.840] (-417.021) (-416.601) (-417.663) * (-417.905) (-416.227) (-416.044) [-416.940] -- 0:00:12
797500 -- (-415.732) (-416.202) [-417.749] (-416.822) * (-416.072) (-417.506) [-416.413] (-417.494) -- 0:00:12
798000 -- (-417.290) (-416.703) (-418.153) [-416.562] * (-422.915) (-421.243) (-415.837) [-415.601] -- 0:00:12
798500 -- (-416.679) [-415.582] (-416.410) (-418.127) * (-421.904) [-415.693] (-415.588) (-419.770) -- 0:00:12
799000 -- (-417.011) (-416.612) (-415.587) [-416.652] * [-415.837] (-416.142) (-416.453) (-416.723) -- 0:00:12
799500 -- (-419.598) (-415.914) (-415.381) [-415.523] * (-419.050) (-415.453) (-414.959) [-416.235] -- 0:00:12
800000 -- (-415.319) (-415.395) (-415.758) [-416.160] * (-418.829) (-416.307) [-415.520] (-416.565) -- 0:00:12
Average standard deviation of split frequencies: 0.009751
800500 -- (-417.824) [-415.680] (-415.882) (-418.675) * (-416.603) (-415.897) (-418.481) [-415.558] -- 0:00:11
801000 -- (-418.960) (-417.180) [-418.523] (-415.751) * (-419.768) (-415.934) [-417.391] (-416.141) -- 0:00:11
801500 -- [-417.299] (-418.067) (-418.799) (-416.844) * (-418.482) (-421.830) [-416.516] (-417.128) -- 0:00:12
802000 -- (-420.322) (-416.100) [-416.610] (-417.670) * (-417.355) (-415.739) [-418.113] (-415.364) -- 0:00:12
802500 -- (-415.496) (-418.400) (-416.001) [-416.509] * (-417.589) (-416.888) [-415.202] (-417.277) -- 0:00:12
803000 -- (-415.438) [-417.719] (-416.376) (-415.962) * (-417.444) [-416.098] (-415.923) (-416.825) -- 0:00:12
803500 -- [-415.622] (-417.567) (-418.658) (-415.362) * (-419.742) (-416.731) [-415.843] (-417.036) -- 0:00:11
804000 -- (-415.320) [-417.154] (-416.773) (-417.068) * [-420.102] (-416.480) (-418.038) (-416.790) -- 0:00:11
804500 -- (-419.055) [-417.122] (-417.012) (-416.548) * (-419.163) [-415.243] (-417.398) (-417.315) -- 0:00:11
805000 -- [-418.086] (-418.449) (-416.866) (-420.021) * (-418.848) (-416.299) (-418.126) [-416.264] -- 0:00:11
Average standard deviation of split frequencies: 0.009906
805500 -- (-420.684) [-418.367] (-416.848) (-421.607) * (-419.269) [-415.904] (-420.703) (-417.975) -- 0:00:11
806000 -- (-419.134) (-418.293) [-421.351] (-421.037) * (-417.246) [-418.077] (-419.382) (-420.743) -- 0:00:11
806500 -- (-420.189) (-416.540) (-418.244) [-417.429] * [-420.016] (-416.367) (-415.577) (-415.777) -- 0:00:11
807000 -- (-418.517) [-417.433] (-415.584) (-415.709) * [-420.284] (-422.974) (-416.974) (-415.456) -- 0:00:11
807500 -- (-419.446) (-418.430) [-417.129] (-417.133) * (-418.987) [-418.974] (-416.365) (-415.857) -- 0:00:11
808000 -- (-415.866) [-418.786] (-414.996) (-416.623) * (-416.568) (-419.887) (-416.570) [-416.486] -- 0:00:11
808500 -- (-415.292) (-415.560) (-414.739) [-416.593] * (-416.845) (-418.286) [-415.473] (-417.246) -- 0:00:11
809000 -- (-417.578) [-415.031] (-415.516) (-416.884) * (-416.911) [-418.140] (-414.982) (-419.558) -- 0:00:11
809500 -- (-415.644) [-417.856] (-417.231) (-417.092) * (-415.910) (-418.437) [-415.925] (-422.520) -- 0:00:11
810000 -- (-416.287) (-417.576) [-418.523] (-416.823) * (-420.113) (-418.650) (-419.862) [-420.329] -- 0:00:11
Average standard deviation of split frequencies: 0.009420
810500 -- [-417.000] (-422.000) (-417.701) (-415.439) * [-417.569] (-420.794) (-421.078) (-417.963) -- 0:00:11
811000 -- (-415.235) (-422.943) (-418.299) [-418.069] * [-417.091] (-416.546) (-417.489) (-415.754) -- 0:00:11
811500 -- (-415.109) (-416.274) (-421.309) [-416.046] * (-418.036) [-419.270] (-420.295) (-417.552) -- 0:00:11
812000 -- (-419.493) [-415.213] (-421.322) (-416.311) * [-416.197] (-415.700) (-418.752) (-415.886) -- 0:00:11
812500 -- (-416.400) [-415.520] (-417.445) (-417.993) * (-417.170) (-419.810) (-415.293) [-415.802] -- 0:00:11
813000 -- [-415.406] (-420.492) (-415.757) (-417.804) * (-421.838) [-414.993] (-415.263) (-420.701) -- 0:00:11
813500 -- (-418.603) (-417.943) [-417.478] (-418.114) * (-415.756) (-416.422) (-415.518) [-416.945] -- 0:00:11
814000 -- (-419.031) (-419.316) [-416.389] (-420.508) * (-415.992) (-416.943) (-420.070) [-415.363] -- 0:00:11
814500 -- (-417.260) (-416.812) (-416.059) [-419.243] * (-419.391) [-417.154] (-416.296) (-418.549) -- 0:00:11
815000 -- [-415.821] (-416.521) (-416.770) (-416.929) * (-415.967) [-417.907] (-418.530) (-422.927) -- 0:00:11
Average standard deviation of split frequencies: 0.008858
815500 -- (-418.282) (-416.390) [-417.765] (-416.882) * [-417.821] (-415.998) (-416.541) (-420.850) -- 0:00:11
816000 -- (-416.717) (-416.591) (-419.912) [-419.931] * (-415.613) (-415.828) (-418.350) [-416.176] -- 0:00:11
816500 -- [-416.675] (-415.126) (-419.241) (-417.861) * (-416.022) (-419.565) (-416.025) [-418.478] -- 0:00:11
817000 -- (-416.538) (-414.945) (-423.183) [-417.993] * (-416.683) (-417.021) [-417.734] (-416.873) -- 0:00:10
817500 -- (-416.286) [-415.103] (-416.190) (-415.237) * (-417.492) (-418.821) [-417.152] (-415.900) -- 0:00:10
818000 -- [-417.381] (-417.250) (-421.911) (-416.867) * (-417.432) (-416.608) (-419.317) [-415.336] -- 0:00:10
818500 -- [-415.360] (-419.536) (-417.145) (-417.974) * (-415.924) (-416.037) (-421.820) [-416.983] -- 0:00:11
819000 -- (-421.320) [-419.087] (-416.696) (-418.434) * (-418.219) (-418.065) (-416.957) [-420.915] -- 0:00:11
819500 -- (-418.792) (-416.385) (-415.474) [-418.382] * [-416.551] (-418.388) (-415.570) (-417.135) -- 0:00:11
820000 -- (-415.114) (-417.086) [-418.485] (-417.457) * (-416.553) (-416.834) (-415.431) [-416.509] -- 0:00:10
Average standard deviation of split frequencies: 0.008731
820500 -- [-417.481] (-416.936) (-416.390) (-419.465) * (-416.156) (-417.439) [-416.745] (-415.654) -- 0:00:10
821000 -- (-417.391) (-416.279) (-415.566) [-417.499] * (-420.155) (-416.981) [-419.043] (-416.401) -- 0:00:10
821500 -- [-420.343] (-416.885) (-417.942) (-417.389) * [-415.076] (-418.645) (-417.688) (-416.333) -- 0:00:10
822000 -- (-421.401) (-419.101) (-415.029) [-416.504] * [-415.506] (-418.118) (-418.100) (-417.088) -- 0:00:10
822500 -- (-416.281) (-416.554) (-416.684) [-416.982] * (-415.895) (-416.521) [-418.920] (-419.896) -- 0:00:10
823000 -- (-418.512) (-418.854) [-417.628] (-417.677) * (-417.984) (-419.206) (-419.653) [-419.712] -- 0:00:10
823500 -- (-415.668) (-416.968) [-417.216] (-416.280) * [-418.992] (-418.478) (-418.544) (-418.327) -- 0:00:10
824000 -- (-415.792) (-414.768) (-417.485) [-416.079] * (-419.021) (-416.706) (-421.285) [-416.059] -- 0:00:10
824500 -- (-418.736) (-415.150) (-414.778) [-419.888] * (-418.606) (-417.848) [-417.341] (-416.398) -- 0:00:10
825000 -- (-420.530) (-415.324) (-417.776) [-419.779] * (-424.913) (-423.072) [-415.713] (-418.153) -- 0:00:10
Average standard deviation of split frequencies: 0.009381
825500 -- (-417.007) (-418.370) (-419.082) [-418.743] * [-416.395] (-418.333) (-415.339) (-417.024) -- 0:00:10
826000 -- [-416.772] (-416.534) (-416.774) (-417.319) * (-418.561) (-416.045) (-417.725) [-416.799] -- 0:00:10
826500 -- [-417.814] (-417.561) (-417.155) (-417.556) * (-416.741) [-417.841] (-417.994) (-415.494) -- 0:00:10
827000 -- (-415.231) [-419.287] (-418.603) (-422.015) * (-417.523) [-418.509] (-415.649) (-415.367) -- 0:00:10
827500 -- (-416.508) [-415.825] (-418.277) (-417.325) * (-416.218) (-415.559) (-416.692) [-415.649] -- 0:00:10
828000 -- [-416.904] (-420.259) (-418.629) (-416.034) * (-417.431) (-415.413) (-416.227) [-418.257] -- 0:00:10
828500 -- (-417.524) (-421.853) (-420.075) [-415.504] * (-419.985) (-416.008) [-416.394] (-418.459) -- 0:00:10
829000 -- (-417.521) (-421.499) (-419.561) [-416.333] * (-416.512) (-415.955) (-417.499) [-417.102] -- 0:00:10
829500 -- (-418.755) [-416.862] (-415.478) (-415.625) * (-415.966) [-416.754] (-415.804) (-419.066) -- 0:00:10
830000 -- [-419.280] (-420.733) (-417.135) (-416.115) * (-415.938) (-419.963) [-415.721] (-418.785) -- 0:00:10
Average standard deviation of split frequencies: 0.009648
830500 -- (-416.243) (-417.213) (-418.220) [-416.268] * (-416.392) [-416.978] (-415.364) (-418.977) -- 0:00:10
831000 -- (-415.764) (-416.420) [-419.167] (-417.337) * (-416.242) (-419.003) [-414.994] (-418.951) -- 0:00:10
831500 -- (-416.886) (-415.341) [-418.241] (-419.832) * (-416.078) [-420.362] (-414.874) (-418.126) -- 0:00:10
832000 -- (-420.632) (-415.518) [-417.613] (-417.230) * [-416.045] (-415.798) (-416.111) (-417.041) -- 0:00:10
832500 -- (-417.590) [-417.816] (-415.766) (-416.890) * (-416.551) [-418.611] (-418.052) (-416.522) -- 0:00:10
833000 -- (-422.207) (-420.221) (-414.873) [-417.927] * (-419.967) [-417.279] (-416.894) (-415.669) -- 0:00:10
833500 -- [-416.595] (-416.103) (-416.905) (-418.531) * (-418.069) (-415.430) (-417.345) [-416.918] -- 0:00:09
834000 -- (-417.997) [-417.256] (-415.887) (-415.589) * (-416.131) (-416.973) [-416.931] (-416.805) -- 0:00:09
834500 -- (-418.523) (-416.617) (-416.725) [-415.881] * (-420.404) (-415.324) (-419.975) [-415.565] -- 0:00:09
835000 -- (-417.966) (-416.252) (-417.176) [-416.747] * (-418.687) [-415.235] (-418.614) (-415.337) -- 0:00:09
Average standard deviation of split frequencies: 0.009375
835500 -- (-417.938) [-415.567] (-416.567) (-417.271) * (-416.393) (-415.136) (-419.994) [-415.048] -- 0:00:10
836000 -- (-415.693) (-418.334) [-415.148] (-416.793) * (-415.003) (-416.273) (-418.521) [-414.985] -- 0:00:10
836500 -- (-416.269) (-419.183) (-417.109) [-417.887] * [-416.813] (-417.885) (-421.350) (-420.074) -- 0:00:09
837000 -- (-416.484) (-420.827) (-420.153) [-418.244] * [-415.337] (-415.912) (-416.813) (-416.902) -- 0:00:09
837500 -- (-416.362) [-417.710] (-421.888) (-417.437) * (-417.547) (-417.757) [-417.747] (-415.829) -- 0:00:09
838000 -- [-417.016] (-417.471) (-418.928) (-416.607) * (-417.223) [-415.101] (-416.549) (-417.161) -- 0:00:09
838500 -- (-418.976) (-415.566) (-417.874) [-415.483] * (-419.746) [-416.366] (-415.626) (-419.643) -- 0:00:09
839000 -- (-419.961) (-415.694) (-418.098) [-416.642] * (-419.925) (-414.879) [-418.699] (-416.555) -- 0:00:09
839500 -- (-416.013) [-416.941] (-416.567) (-415.333) * (-417.634) (-416.233) (-424.421) [-416.809] -- 0:00:09
840000 -- (-417.164) [-418.176] (-416.726) (-415.119) * (-417.562) [-415.483] (-417.155) (-415.376) -- 0:00:09
Average standard deviation of split frequencies: 0.008935
840500 -- (-417.539) (-417.756) (-416.702) [-415.909] * (-416.724) [-418.638] (-415.457) (-416.017) -- 0:00:09
841000 -- [-415.714] (-416.310) (-417.371) (-415.081) * (-415.533) (-417.043) [-416.680] (-416.807) -- 0:00:09
841500 -- (-415.345) (-419.800) [-418.533] (-416.661) * (-417.208) (-419.066) (-416.689) [-415.767] -- 0:00:09
842000 -- (-415.392) (-415.733) (-416.336) [-416.815] * (-417.766) (-416.862) (-418.012) [-415.983] -- 0:00:09
842500 -- (-420.138) (-416.446) [-421.981] (-418.378) * (-415.503) [-415.691] (-423.280) (-416.332) -- 0:00:09
843000 -- (-415.349) [-416.416] (-415.451) (-423.048) * (-416.125) [-415.779] (-419.452) (-415.760) -- 0:00:09
843500 -- (-416.359) (-416.554) [-417.135] (-419.338) * (-418.536) (-415.994) [-418.700] (-414.894) -- 0:00:09
844000 -- (-415.536) (-420.223) (-416.102) [-416.009] * (-416.379) [-416.652] (-416.393) (-418.609) -- 0:00:09
844500 -- (-418.163) (-416.679) (-422.003) [-418.932] * (-414.935) [-419.317] (-417.657) (-420.962) -- 0:00:09
845000 -- (-418.780) (-418.919) (-422.759) [-418.277] * [-418.647] (-420.242) (-418.772) (-416.600) -- 0:00:09
Average standard deviation of split frequencies: 0.009101
845500 -- (-418.796) (-415.911) [-418.861] (-417.065) * (-416.430) (-418.330) [-417.627] (-415.668) -- 0:00:09
846000 -- (-418.783) (-419.095) (-417.011) [-419.280] * (-421.463) (-417.845) [-416.436] (-416.000) -- 0:00:09
846500 -- (-424.161) [-414.995] (-416.054) (-418.012) * [-416.370] (-416.687) (-418.114) (-418.081) -- 0:00:09
847000 -- (-423.660) (-418.580) [-416.219] (-417.445) * [-418.685] (-417.571) (-417.605) (-422.016) -- 0:00:09
847500 -- (-421.600) [-416.950] (-419.629) (-417.184) * (-419.442) [-415.188] (-417.384) (-416.061) -- 0:00:09
848000 -- (-421.549) (-416.724) (-417.077) [-418.371] * (-420.997) [-415.826] (-417.905) (-416.555) -- 0:00:09
848500 -- (-417.660) [-417.769] (-417.784) (-416.337) * (-421.150) [-415.018] (-418.346) (-416.804) -- 0:00:09
849000 -- (-416.805) (-421.339) [-417.883] (-417.308) * (-421.197) [-417.078] (-418.131) (-418.255) -- 0:00:09
849500 -- (-416.474) [-418.331] (-416.195) (-416.870) * [-420.609] (-417.147) (-415.543) (-415.570) -- 0:00:09
850000 -- (-418.741) (-417.114) (-416.137) [-417.319] * (-417.363) [-415.214] (-414.898) (-418.184) -- 0:00:09
Average standard deviation of split frequencies: 0.008940
850500 -- (-415.582) (-417.402) [-415.406] (-416.462) * [-417.391] (-416.293) (-415.719) (-416.194) -- 0:00:08
851000 -- (-418.170) (-423.211) [-417.481] (-416.865) * (-419.368) (-417.789) (-420.270) [-415.319] -- 0:00:08
851500 -- (-416.591) (-415.879) [-417.486] (-419.911) * [-416.829] (-418.020) (-415.006) (-416.594) -- 0:00:08
852000 -- (-416.098) (-416.245) (-417.742) [-415.263] * (-417.110) (-418.235) [-416.510] (-416.551) -- 0:00:08
852500 -- [-416.374] (-417.561) (-416.719) (-418.906) * (-414.731) (-422.180) [-417.715] (-416.935) -- 0:00:08
853000 -- (-424.745) (-416.161) (-415.707) [-416.375] * (-415.479) (-418.351) [-415.599] (-420.195) -- 0:00:08
853500 -- (-419.786) (-415.421) (-415.465) [-418.249] * (-415.607) [-422.785] (-415.202) (-419.222) -- 0:00:08
854000 -- (-417.068) (-416.119) [-415.536] (-417.096) * (-420.879) (-418.381) [-416.681] (-418.716) -- 0:00:08
854500 -- (-416.168) (-415.561) [-415.465] (-416.883) * (-417.236) [-416.693] (-417.067) (-417.967) -- 0:00:08
855000 -- (-417.774) (-420.583) [-415.795] (-418.341) * (-416.214) [-419.782] (-416.892) (-417.231) -- 0:00:08
Average standard deviation of split frequencies: 0.008848
855500 -- (-418.693) (-416.285) (-415.894) [-417.414] * (-419.316) (-418.174) (-419.892) [-419.365] -- 0:00:08
856000 -- (-418.740) (-416.152) (-416.460) [-419.509] * (-419.892) (-418.093) (-420.521) [-416.532] -- 0:00:08
856500 -- (-416.538) (-423.465) (-419.121) [-416.378] * (-415.490) (-415.814) (-419.703) [-417.664] -- 0:00:08
857000 -- (-419.100) (-419.065) [-418.735] (-417.217) * (-419.872) (-416.010) (-418.399) [-415.252] -- 0:00:08
857500 -- [-416.392] (-416.454) (-415.192) (-418.280) * [-416.503] (-416.548) (-424.530) (-419.897) -- 0:00:08
858000 -- [-417.630] (-422.658) (-415.343) (-419.793) * [-418.910] (-416.443) (-416.937) (-421.104) -- 0:00:08
858500 -- (-415.921) (-417.622) (-417.391) [-416.535] * (-416.708) [-415.939] (-416.112) (-418.763) -- 0:00:08
859000 -- (-416.000) [-419.531] (-415.724) (-419.357) * [-416.477] (-416.339) (-420.411) (-415.887) -- 0:00:08
859500 -- (-421.163) (-417.791) [-416.279] (-417.925) * (-415.632) [-419.541] (-420.628) (-417.863) -- 0:00:08
860000 -- [-414.836] (-416.261) (-417.962) (-417.165) * [-419.029] (-415.884) (-419.726) (-415.551) -- 0:00:08
Average standard deviation of split frequencies: 0.008617
860500 -- [-414.669] (-417.395) (-418.875) (-416.488) * (-420.193) (-416.272) (-419.302) [-418.319] -- 0:00:08
861000 -- (-415.602) (-423.804) (-417.471) [-416.260] * (-418.575) (-415.807) (-417.399) [-416.033] -- 0:00:08
861500 -- (-418.106) (-417.824) [-415.473] (-415.274) * [-419.100] (-417.435) (-423.058) (-415.384) -- 0:00:08
862000 -- (-422.163) (-418.880) [-415.444] (-414.937) * [-421.647] (-415.155) (-422.992) (-418.457) -- 0:00:08
862500 -- (-417.023) [-416.874] (-416.575) (-421.279) * (-417.202) (-416.152) (-417.865) [-416.549] -- 0:00:08
863000 -- [-416.714] (-422.776) (-416.003) (-419.003) * [-416.757] (-417.425) (-418.361) (-415.206) -- 0:00:08
863500 -- [-418.270] (-415.229) (-415.939) (-415.124) * (-416.606) (-416.430) (-415.163) [-416.320] -- 0:00:08
864000 -- [-415.977] (-417.958) (-415.606) (-415.858) * (-421.016) [-418.501] (-416.071) (-416.991) -- 0:00:08
864500 -- (-417.115) (-415.942) [-417.125] (-416.194) * [-414.971] (-415.686) (-420.795) (-417.946) -- 0:00:08
865000 -- (-417.120) (-420.501) [-416.280] (-415.795) * (-416.128) (-417.007) (-419.067) [-418.655] -- 0:00:08
Average standard deviation of split frequencies: 0.008456
865500 -- [-416.537] (-417.848) (-416.430) (-416.045) * (-417.090) (-417.820) (-416.689) [-417.528] -- 0:00:08
866000 -- (-415.467) (-417.640) (-417.216) [-417.836] * (-416.807) (-417.351) [-418.394] (-417.523) -- 0:00:08
866500 -- (-415.477) (-417.640) (-415.171) [-416.217] * (-418.736) (-415.677) (-417.552) [-417.461] -- 0:00:08
867000 -- (-415.411) (-415.510) [-415.905] (-419.109) * (-417.554) [-414.951] (-417.994) (-418.613) -- 0:00:07
867500 -- (-415.770) (-419.309) [-416.944] (-422.653) * [-414.657] (-415.540) (-416.184) (-419.726) -- 0:00:07
868000 -- (-418.578) [-419.531] (-416.087) (-416.814) * (-418.981) (-415.925) (-415.462) [-418.141] -- 0:00:07
868500 -- (-415.704) (-415.955) (-421.405) [-417.759] * (-415.727) (-419.302) (-417.026) [-416.367] -- 0:00:07
869000 -- (-417.987) (-416.582) (-416.145) [-417.153] * (-415.331) [-415.624] (-420.749) (-418.434) -- 0:00:07
869500 -- (-417.722) [-418.750] (-415.283) (-418.964) * (-415.595) [-416.153] (-415.510) (-418.503) -- 0:00:07
870000 -- (-416.508) (-422.847) [-420.916] (-419.357) * [-415.352] (-418.785) (-416.387) (-418.475) -- 0:00:07
Average standard deviation of split frequencies: 0.008627
870500 -- [-417.839] (-417.316) (-418.972) (-416.505) * (-420.364) (-417.163) [-416.243] (-417.989) -- 0:00:07
871000 -- (-418.031) [-415.270] (-421.590) (-415.662) * (-415.765) (-417.094) (-417.708) [-416.328] -- 0:00:07
871500 -- [-417.333] (-417.172) (-423.891) (-419.484) * (-419.126) (-418.119) [-414.608] (-415.928) -- 0:00:07
872000 -- (-419.560) (-418.416) (-416.660) [-415.454] * (-416.051) (-417.229) (-414.909) [-416.016] -- 0:00:07
872500 -- (-418.235) [-417.445] (-417.465) (-415.824) * (-417.249) (-415.052) (-415.321) [-415.883] -- 0:00:07
873000 -- (-420.090) (-418.865) (-416.269) [-415.761] * (-418.216) (-414.909) (-417.836) [-416.777] -- 0:00:07
873500 -- (-418.881) [-416.797] (-418.035) (-416.911) * [-415.692] (-416.964) (-415.985) (-417.791) -- 0:00:07
874000 -- (-418.942) [-415.474] (-417.064) (-416.960) * [-420.859] (-415.183) (-416.834) (-415.847) -- 0:00:07
874500 -- (-424.089) (-415.515) (-421.862) [-415.775] * [-416.825] (-416.076) (-419.505) (-416.766) -- 0:00:07
875000 -- [-423.441] (-416.500) (-416.319) (-415.821) * [-416.302] (-414.756) (-417.121) (-418.863) -- 0:00:07
Average standard deviation of split frequencies: 0.008431
875500 -- (-416.686) [-417.693] (-416.527) (-415.701) * (-416.674) (-422.778) (-416.282) [-416.168] -- 0:00:07
876000 -- (-418.640) (-416.179) [-416.109] (-415.715) * (-419.349) [-416.727] (-415.380) (-416.470) -- 0:00:07
876500 -- (-422.773) [-415.165] (-421.068) (-416.542) * (-419.579) (-417.005) (-415.155) [-417.653] -- 0:00:07
877000 -- (-418.349) [-417.092] (-417.281) (-415.902) * (-418.662) [-422.357] (-419.892) (-416.626) -- 0:00:07
877500 -- (-421.281) [-415.661] (-415.748) (-418.310) * (-417.007) (-416.675) (-418.436) [-415.942] -- 0:00:07
878000 -- (-416.496) (-416.745) [-417.064] (-419.163) * (-418.940) (-415.547) (-416.741) [-418.877] -- 0:00:07
878500 -- [-418.512] (-415.821) (-418.795) (-418.973) * (-417.866) (-418.043) [-416.736] (-418.566) -- 0:00:07
879000 -- (-416.431) (-417.516) [-416.573] (-417.735) * [-416.954] (-418.842) (-416.584) (-418.806) -- 0:00:07
879500 -- [-415.312] (-414.919) (-415.505) (-417.689) * [-418.044] (-418.013) (-418.102) (-421.371) -- 0:00:07
880000 -- (-415.010) (-414.837) [-417.885] (-417.551) * (-419.291) (-423.252) (-418.448) [-415.574] -- 0:00:07
Average standard deviation of split frequencies: 0.008493
880500 -- (-418.443) (-416.984) [-415.252] (-418.141) * (-416.194) [-416.528] (-416.848) (-416.212) -- 0:00:07
881000 -- (-417.747) (-416.806) [-420.486] (-421.060) * (-416.495) [-417.085] (-415.188) (-415.460) -- 0:00:07
881500 -- (-417.040) [-418.296] (-419.427) (-419.873) * (-417.449) [-415.710] (-416.706) (-417.086) -- 0:00:07
882000 -- [-416.764] (-417.808) (-417.500) (-415.831) * (-417.845) (-417.099) (-418.441) [-418.657] -- 0:00:07
882500 -- (-416.382) (-419.837) [-415.345] (-416.027) * [-417.671] (-415.573) (-421.447) (-416.346) -- 0:00:07
883000 -- (-418.396) [-419.011] (-415.447) (-416.526) * (-417.380) (-417.633) [-416.701] (-418.730) -- 0:00:07
883500 -- (-422.727) (-415.326) (-415.983) [-415.603] * (-417.945) (-420.280) [-417.716] (-416.172) -- 0:00:06
884000 -- (-418.561) (-419.953) [-415.409] (-418.260) * [-420.009] (-421.109) (-416.552) (-416.455) -- 0:00:06
884500 -- [-415.597] (-417.347) (-415.765) (-419.212) * (-421.133) (-418.150) [-416.677] (-420.694) -- 0:00:06
885000 -- (-417.188) (-416.263) (-416.387) [-418.085] * (-422.128) (-418.166) [-415.700] (-417.989) -- 0:00:06
Average standard deviation of split frequencies: 0.008265
885500 -- [-415.326] (-420.017) (-416.544) (-415.877) * [-417.035] (-418.457) (-416.196) (-416.647) -- 0:00:06
886000 -- (-415.940) (-420.354) [-416.469] (-426.215) * [-420.633] (-417.342) (-417.128) (-418.013) -- 0:00:06
886500 -- [-419.702] (-420.343) (-415.819) (-417.461) * (-419.952) [-415.681] (-415.882) (-415.542) -- 0:00:06
887000 -- (-414.905) [-418.378] (-416.201) (-418.045) * (-417.856) (-415.310) [-417.661] (-415.293) -- 0:00:06
887500 -- (-414.905) (-417.701) [-416.095] (-418.193) * (-418.333) [-417.561] (-418.195) (-418.015) -- 0:00:06
888000 -- (-415.540) (-418.674) (-416.466) [-415.276] * [-416.207] (-416.216) (-419.792) (-417.844) -- 0:00:06
888500 -- (-418.847) (-418.042) (-422.442) [-415.213] * (-418.566) [-415.743] (-415.134) (-418.480) -- 0:00:06
889000 -- (-422.507) (-419.429) (-415.493) [-415.646] * (-417.677) (-417.293) (-417.254) [-418.731] -- 0:00:06
889500 -- (-421.334) (-416.028) [-415.672] (-416.590) * (-415.929) [-415.108] (-415.223) (-418.705) -- 0:00:06
890000 -- [-419.779] (-416.572) (-416.072) (-416.095) * (-416.852) (-419.045) [-415.223] (-415.531) -- 0:00:06
Average standard deviation of split frequencies: 0.008292
890500 -- (-418.494) (-417.451) [-418.110] (-416.956) * [-425.582] (-417.951) (-417.940) (-419.921) -- 0:00:06
891000 -- (-418.611) [-417.125] (-419.474) (-415.683) * (-415.488) [-415.166] (-415.740) (-422.075) -- 0:00:06
891500 -- [-419.191] (-417.428) (-418.033) (-421.782) * (-417.735) (-416.067) (-417.584) [-415.727] -- 0:00:06
892000 -- (-416.448) (-420.395) [-416.203] (-418.671) * [-416.699] (-415.622) (-421.927) (-416.438) -- 0:00:06
892500 -- [-417.793] (-417.098) (-421.549) (-419.044) * (-416.119) (-414.915) [-417.162] (-414.784) -- 0:00:06
893000 -- (-414.851) [-416.637] (-419.637) (-417.884) * (-418.239) (-415.395) [-418.714] (-416.643) -- 0:00:06
893500 -- [-415.653] (-415.334) (-415.443) (-417.652) * [-418.240] (-416.143) (-416.359) (-419.887) -- 0:00:06
894000 -- [-415.573] (-416.581) (-415.288) (-421.957) * (-415.617) [-416.250] (-416.010) (-416.734) -- 0:00:06
894500 -- (-416.489) [-418.691] (-418.047) (-419.260) * (-417.759) (-415.561) [-416.304] (-420.268) -- 0:00:06
895000 -- (-415.007) [-416.695] (-415.343) (-421.399) * [-416.256] (-415.867) (-417.198) (-418.633) -- 0:00:06
Average standard deviation of split frequencies: 0.008383
895500 -- (-415.282) (-416.440) [-414.962] (-417.637) * (-415.582) [-415.433] (-416.465) (-415.725) -- 0:00:06
896000 -- (-421.724) (-415.914) (-417.877) [-415.718] * [-416.993] (-416.931) (-415.268) (-415.184) -- 0:00:06
896500 -- (-415.608) (-416.414) (-416.401) [-416.545] * (-418.843) (-418.413) [-414.835] (-418.760) -- 0:00:06
897000 -- (-416.037) (-419.649) (-418.813) [-417.291] * (-415.701) [-420.444] (-414.843) (-417.157) -- 0:00:06
897500 -- [-419.933] (-416.584) (-418.479) (-415.771) * (-415.375) (-420.149) [-416.681] (-415.171) -- 0:00:06
898000 -- (-415.687) (-417.530) [-417.926] (-418.019) * (-418.953) (-416.361) (-422.474) [-417.661] -- 0:00:06
898500 -- (-415.314) (-419.339) [-415.269] (-418.442) * (-416.604) [-418.351] (-421.303) (-417.585) -- 0:00:06
899000 -- (-414.891) (-418.288) [-417.464] (-416.373) * (-416.728) (-415.820) (-420.019) [-418.392] -- 0:00:06
899500 -- (-416.676) (-415.440) (-416.741) [-418.295] * (-415.169) (-418.289) [-415.668] (-417.095) -- 0:00:06
900000 -- [-417.009] (-415.172) (-417.114) (-416.184) * (-416.647) [-415.722] (-422.687) (-415.790) -- 0:00:06
Average standard deviation of split frequencies: 0.008374
900500 -- (-417.197) (-417.205) (-419.356) [-419.420] * (-417.462) (-417.175) (-424.279) [-417.587] -- 0:00:05
901000 -- (-419.402) [-417.833] (-419.680) (-417.941) * (-417.650) (-418.909) (-424.399) [-417.548] -- 0:00:05
901500 -- (-418.079) (-420.723) (-416.722) [-416.477] * (-416.371) (-416.831) (-423.853) [-417.594] -- 0:00:05
902000 -- [-417.577] (-419.785) (-418.233) (-416.978) * (-415.909) (-417.448) (-415.306) [-415.491] -- 0:00:05
902500 -- [-416.187] (-418.431) (-416.761) (-419.296) * (-414.803) [-420.015] (-417.647) (-417.546) -- 0:00:05
903000 -- (-416.281) [-416.147] (-417.887) (-415.739) * (-418.789) (-418.188) [-416.556] (-421.338) -- 0:00:05
903500 -- (-422.192) (-419.113) (-420.038) [-419.717] * (-417.606) (-419.953) [-415.289] (-422.575) -- 0:00:05
904000 -- (-419.098) [-417.843] (-420.568) (-416.195) * (-415.791) (-416.845) (-416.607) [-417.683] -- 0:00:05
904500 -- [-416.644] (-419.986) (-419.352) (-416.267) * [-417.709] (-415.678) (-417.302) (-417.170) -- 0:00:05
905000 -- (-421.582) [-415.219] (-415.178) (-415.485) * (-418.152) [-416.694] (-416.533) (-420.863) -- 0:00:05
Average standard deviation of split frequencies: 0.008429
905500 -- (-418.236) (-415.934) [-419.666] (-423.697) * (-415.589) [-418.799] (-420.879) (-415.708) -- 0:00:05
906000 -- (-415.760) [-415.914] (-419.364) (-416.484) * (-417.488) (-417.441) [-417.142] (-420.021) -- 0:00:05
906500 -- (-417.632) [-415.939] (-415.784) (-415.448) * (-416.077) (-416.407) (-417.108) [-415.444] -- 0:00:05
907000 -- (-416.390) (-416.777) (-416.422) [-417.075] * (-420.721) (-416.006) [-416.096] (-415.684) -- 0:00:05
907500 -- (-417.676) (-415.540) (-417.106) [-414.876] * (-417.887) [-418.399] (-416.166) (-416.086) -- 0:00:05
908000 -- [-417.400] (-414.890) (-415.240) (-414.687) * (-416.212) (-415.223) (-420.525) [-416.318] -- 0:00:05
908500 -- (-420.355) [-417.961] (-416.361) (-415.155) * (-418.089) (-418.380) [-416.578] (-418.268) -- 0:00:05
909000 -- (-421.929) (-417.237) (-415.590) [-416.789] * (-418.448) (-418.198) [-418.146] (-419.939) -- 0:00:05
909500 -- (-421.325) (-419.409) (-420.643) [-415.027] * [-418.934] (-417.576) (-419.549) (-418.566) -- 0:00:05
910000 -- (-418.807) [-416.210] (-416.810) (-416.389) * (-419.754) (-418.631) [-416.306] (-415.348) -- 0:00:05
Average standard deviation of split frequencies: 0.008420
910500 -- (-415.774) (-417.939) [-415.984] (-416.638) * (-415.827) (-417.931) [-416.606] (-417.395) -- 0:00:05
911000 -- (-419.590) [-416.081] (-415.081) (-418.478) * (-418.520) (-416.241) [-414.968] (-417.634) -- 0:00:05
911500 -- (-418.444) [-417.388] (-420.294) (-420.746) * (-415.948) (-416.090) [-416.122] (-421.361) -- 0:00:05
912000 -- (-416.638) (-415.548) [-417.467] (-416.832) * (-416.840) [-416.168] (-417.432) (-418.421) -- 0:00:05
912500 -- (-420.009) [-416.494] (-417.668) (-424.735) * (-416.038) (-418.577) [-418.359] (-416.758) -- 0:00:05
913000 -- (-419.094) [-419.314] (-419.680) (-417.927) * [-415.117] (-415.591) (-418.324) (-416.401) -- 0:00:05
913500 -- [-415.746] (-418.227) (-418.668) (-420.046) * [-417.372] (-415.845) (-415.783) (-416.581) -- 0:00:05
914000 -- [-416.910] (-418.861) (-415.997) (-416.655) * (-415.359) (-415.749) [-416.772] (-416.442) -- 0:00:05
914500 -- (-415.317) (-417.944) [-417.647] (-416.593) * (-415.754) [-416.156] (-419.415) (-415.644) -- 0:00:05
915000 -- [-416.270] (-416.133) (-416.795) (-415.569) * (-417.465) (-416.539) (-418.699) [-415.482] -- 0:00:05
Average standard deviation of split frequencies: 0.008268
915500 -- (-416.595) (-415.408) (-416.757) [-419.182] * (-423.300) (-420.592) [-419.106] (-416.673) -- 0:00:05
916000 -- (-421.504) (-415.357) (-418.521) [-421.054] * [-417.433] (-415.956) (-415.559) (-417.624) -- 0:00:05
916500 -- (-417.389) [-415.919] (-420.879) (-418.600) * (-415.344) (-416.218) (-419.109) [-415.890] -- 0:00:05
917000 -- (-415.812) [-418.595] (-416.929) (-418.073) * (-415.499) (-415.763) [-418.550] (-415.419) -- 0:00:04
917500 -- [-415.343] (-415.082) (-417.113) (-420.081) * [-416.304] (-415.783) (-418.541) (-417.421) -- 0:00:04
918000 -- (-416.576) (-417.183) [-418.304] (-416.480) * [-416.589] (-418.010) (-415.980) (-415.902) -- 0:00:04
918500 -- (-424.802) [-415.913] (-417.183) (-415.447) * (-418.748) (-417.637) [-416.966] (-421.487) -- 0:00:04
919000 -- (-416.726) (-417.477) [-418.781] (-416.703) * (-418.121) (-418.759) (-417.792) [-417.285] -- 0:00:04
919500 -- [-416.809] (-417.770) (-419.535) (-422.675) * (-417.880) [-416.712] (-416.709) (-421.895) -- 0:00:04
920000 -- [-416.807] (-417.313) (-417.051) (-421.469) * (-417.513) (-416.804) (-421.638) [-416.385] -- 0:00:04
Average standard deviation of split frequencies: 0.008192
920500 -- [-415.436] (-417.214) (-418.913) (-415.722) * (-415.862) [-417.043] (-418.194) (-419.015) -- 0:00:04
921000 -- (-415.563) (-415.266) [-418.421] (-415.883) * [-416.254] (-417.102) (-418.930) (-417.823) -- 0:00:04
921500 -- [-416.009] (-418.212) (-416.209) (-416.362) * (-417.805) (-416.591) (-418.130) [-418.393] -- 0:00:04
922000 -- [-417.965] (-415.875) (-418.611) (-415.904) * [-418.670] (-417.243) (-419.630) (-416.674) -- 0:00:04
922500 -- (-415.912) (-414.887) [-416.934] (-416.901) * (-420.452) [-419.429] (-420.305) (-419.831) -- 0:00:04
923000 -- (-416.991) [-415.351] (-419.736) (-416.149) * [-418.278] (-417.268) (-416.101) (-416.051) -- 0:00:04
923500 -- (-416.945) (-415.870) (-416.164) [-417.397] * [-418.755] (-418.614) (-417.355) (-418.865) -- 0:00:04
924000 -- (-420.905) (-417.976) [-414.640] (-416.539) * (-419.562) [-416.518] (-420.216) (-417.611) -- 0:00:04
924500 -- (-417.014) [-416.633] (-420.033) (-418.027) * (-418.383) [-417.696] (-417.775) (-416.791) -- 0:00:04
925000 -- (-421.096) (-418.720) (-418.109) [-416.781] * (-415.222) [-415.538] (-416.232) (-419.728) -- 0:00:04
Average standard deviation of split frequencies: 0.008349
925500 -- (-417.948) (-416.692) [-416.441] (-419.020) * (-415.384) (-418.732) (-415.302) [-415.330] -- 0:00:04
926000 -- (-420.573) [-416.751] (-418.233) (-419.538) * (-415.718) (-419.740) [-415.302] (-416.009) -- 0:00:04
926500 -- (-420.871) (-415.810) [-415.164] (-415.280) * [-415.994] (-414.878) (-415.681) (-416.662) -- 0:00:04
927000 -- (-416.478) (-417.827) [-416.132] (-415.362) * [-416.337] (-414.770) (-416.116) (-415.190) -- 0:00:04
927500 -- (-415.922) (-419.718) (-415.726) [-417.105] * (-416.915) (-420.023) (-417.949) [-415.074] -- 0:00:04
928000 -- [-415.478] (-421.012) (-417.003) (-417.440) * [-419.503] (-418.965) (-420.638) (-418.266) -- 0:00:04
928500 -- (-417.224) (-419.433) [-418.303] (-419.982) * (-418.412) (-418.212) (-416.615) [-417.680] -- 0:00:04
929000 -- [-414.657] (-419.461) (-418.142) (-419.179) * [-416.322] (-416.631) (-423.899) (-415.974) -- 0:00:04
929500 -- [-417.031] (-418.924) (-416.348) (-416.544) * (-418.179) (-416.255) [-417.460] (-416.325) -- 0:00:04
930000 -- (-415.817) (-415.567) (-417.984) [-417.927] * [-417.416] (-416.400) (-420.266) (-416.701) -- 0:00:04
Average standard deviation of split frequencies: 0.008476
930500 -- (-415.407) (-415.756) (-415.525) [-415.443] * (-416.060) [-414.748] (-416.928) (-421.788) -- 0:00:04
931000 -- (-415.352) (-420.159) (-418.963) [-418.452] * (-416.141) (-416.495) [-417.530] (-416.800) -- 0:00:04
931500 -- (-417.117) (-415.068) (-415.195) [-415.130] * (-418.185) [-416.243] (-422.772) (-415.385) -- 0:00:04
932000 -- (-417.005) (-415.487) (-415.945) [-415.780] * (-415.852) (-418.893) (-418.453) [-418.222] -- 0:00:04
932500 -- (-416.542) (-416.751) (-416.407) [-420.201] * (-418.273) (-416.466) (-417.243) [-416.091] -- 0:00:04
933000 -- (-415.619) (-416.122) (-414.897) [-417.646] * (-418.047) [-417.097] (-418.239) (-421.411) -- 0:00:04
933500 -- [-415.074] (-420.369) (-417.818) (-417.856) * (-415.970) [-417.479] (-417.906) (-418.122) -- 0:00:03
934000 -- (-415.113) [-421.280] (-415.399) (-418.809) * (-417.911) (-418.587) (-420.985) [-415.273] -- 0:00:03
934500 -- (-416.109) (-416.945) (-421.614) [-416.584] * (-416.092) [-419.258] (-416.472) (-415.664) -- 0:00:03
935000 -- (-420.302) (-415.984) (-415.441) [-416.514] * (-416.022) (-418.201) [-417.481] (-416.988) -- 0:00:03
Average standard deviation of split frequencies: 0.008394
935500 -- (-416.814) (-414.915) [-415.441] (-417.231) * (-417.546) (-417.573) [-415.852] (-417.236) -- 0:00:03
936000 -- (-416.226) [-418.992] (-415.499) (-417.069) * (-416.711) [-415.597] (-415.010) (-417.126) -- 0:00:03
936500 -- (-418.958) (-420.462) (-418.707) [-418.295] * (-423.312) [-417.546] (-416.158) (-416.620) -- 0:00:03
937000 -- (-415.826) [-416.026] (-418.783) (-419.021) * (-416.713) (-416.676) [-416.533] (-416.027) -- 0:00:03
937500 -- (-419.630) (-415.330) (-416.629) [-417.863] * (-417.231) (-420.043) (-418.116) [-416.891] -- 0:00:03
938000 -- [-416.829] (-416.650) (-418.067) (-417.264) * (-419.669) (-415.087) [-417.035] (-416.215) -- 0:00:03
938500 -- [-419.083] (-420.284) (-415.246) (-421.135) * (-420.412) [-415.613] (-417.548) (-416.166) -- 0:00:03
939000 -- [-414.875] (-416.420) (-416.148) (-421.436) * (-418.393) (-418.507) [-416.753] (-415.298) -- 0:00:03
939500 -- (-416.797) (-420.062) [-418.775] (-415.252) * (-419.084) (-415.852) [-419.016] (-415.432) -- 0:00:03
940000 -- (-416.317) [-416.275] (-423.290) (-415.465) * (-415.131) (-417.778) [-416.022] (-416.302) -- 0:00:03
Average standard deviation of split frequencies: 0.008386
940500 -- (-417.123) (-416.945) (-416.467) [-416.919] * [-416.314] (-418.958) (-421.100) (-415.065) -- 0:00:03
941000 -- [-417.932] (-421.777) (-417.999) (-417.556) * (-419.235) (-416.085) [-415.968] (-415.489) -- 0:00:03
941500 -- (-421.959) (-418.302) (-416.198) [-417.320] * [-415.593] (-417.779) (-416.484) (-421.777) -- 0:00:03
942000 -- [-417.643] (-417.697) (-418.733) (-422.883) * (-416.118) (-417.672) (-417.034) [-418.206] -- 0:00:03
942500 -- (-420.149) [-415.500] (-417.278) (-418.003) * (-417.288) [-416.026] (-417.451) (-419.042) -- 0:00:03
943000 -- [-419.324] (-418.711) (-416.517) (-417.792) * [-417.972] (-418.141) (-416.385) (-418.068) -- 0:00:03
943500 -- (-416.533) (-419.726) (-416.633) [-419.539] * (-423.789) (-422.656) [-416.598] (-419.079) -- 0:00:03
944000 -- (-421.923) (-421.163) [-415.817] (-415.530) * (-423.145) (-422.108) [-416.179] (-418.643) -- 0:00:03
944500 -- (-415.957) [-419.733] (-416.768) (-417.412) * (-421.427) (-416.820) [-416.273] (-420.301) -- 0:00:03
945000 -- (-417.224) (-416.146) [-416.499] (-418.020) * (-419.308) [-424.735] (-416.510) (-417.528) -- 0:00:03
Average standard deviation of split frequencies: 0.008505
945500 -- (-416.290) [-416.856] (-417.034) (-417.298) * [-416.030] (-417.870) (-415.432) (-416.134) -- 0:00:03
946000 -- [-415.277] (-416.603) (-420.126) (-420.519) * (-416.924) (-419.638) (-416.897) [-416.014] -- 0:00:03
946500 -- (-419.615) (-417.737) (-416.887) [-419.873] * (-417.775) (-415.747) [-416.139] (-416.933) -- 0:00:03
947000 -- (-417.846) (-418.048) [-419.090] (-418.867) * (-416.302) (-417.103) (-416.226) [-415.110] -- 0:00:03
947500 -- (-418.107) (-416.916) (-419.429) [-416.273] * (-416.973) (-418.221) (-420.110) [-415.876] -- 0:00:03
948000 -- (-416.733) (-419.807) [-418.533] (-416.693) * (-419.905) (-418.164) [-417.353] (-416.289) -- 0:00:03
948500 -- (-416.284) (-417.676) (-416.505) [-416.532] * (-417.384) [-417.727] (-417.647) (-418.754) -- 0:00:03
949000 -- (-418.176) (-418.382) (-416.525) [-415.912] * (-419.883) (-419.114) [-415.399] (-419.243) -- 0:00:03
949500 -- (-416.778) (-419.227) (-416.699) [-417.011] * (-418.189) [-416.266] (-416.796) (-419.462) -- 0:00:03
950000 -- [-415.178] (-418.252) (-416.788) (-417.463) * [-420.559] (-418.056) (-415.368) (-416.723) -- 0:00:03
Average standard deviation of split frequencies: 0.008893
950500 -- (-415.840) (-416.365) [-419.751] (-415.559) * (-422.416) (-420.340) (-415.156) [-417.330] -- 0:00:02
951000 -- (-416.179) (-416.997) (-418.329) [-415.492] * (-419.587) (-418.852) (-417.739) [-415.832] -- 0:00:02
951500 -- (-415.070) [-415.161] (-422.245) (-415.547) * (-421.523) [-418.491] (-416.419) (-415.439) -- 0:00:02
952000 -- (-416.971) (-417.733) (-416.153) [-415.861] * (-420.712) [-416.626] (-416.461) (-417.476) -- 0:00:02
952500 -- (-415.969) (-416.226) [-416.430] (-419.164) * [-416.658] (-417.018) (-418.786) (-421.427) -- 0:00:02
953000 -- [-416.344] (-415.392) (-414.656) (-420.164) * (-417.127) (-416.666) (-419.033) [-415.470] -- 0:00:02
953500 -- (-418.834) [-415.831] (-418.369) (-417.413) * (-417.986) [-416.661] (-417.633) (-415.489) -- 0:00:02
954000 -- [-416.778] (-416.027) (-415.805) (-416.620) * (-422.727) (-416.720) [-416.217] (-417.221) -- 0:00:02
954500 -- (-419.199) [-415.364] (-416.123) (-416.805) * (-417.523) (-417.056) (-417.602) [-416.445] -- 0:00:02
955000 -- [-417.068] (-422.828) (-415.749) (-416.192) * (-420.885) [-416.563] (-416.746) (-418.344) -- 0:00:02
Average standard deviation of split frequencies: 0.009040
955500 -- (-417.865) (-420.283) [-420.635] (-417.686) * (-416.817) (-420.770) (-416.179) [-419.258] -- 0:00:02
956000 -- (-418.041) [-418.162] (-418.251) (-417.839) * [-416.960] (-417.783) (-414.992) (-420.362) -- 0:00:02
956500 -- (-421.013) (-418.238) (-418.841) [-415.674] * [-416.646] (-417.519) (-417.793) (-416.887) -- 0:00:02
957000 -- [-415.605] (-417.129) (-415.854) (-418.385) * (-417.435) (-418.801) [-415.734] (-416.531) -- 0:00:02
957500 -- (-415.114) (-420.103) (-417.215) [-415.357] * (-416.706) (-419.870) (-421.154) [-416.943] -- 0:00:02
958000 -- (-416.185) (-419.540) [-417.114] (-416.922) * (-416.316) [-415.397] (-417.077) (-417.655) -- 0:00:02
958500 -- (-417.045) [-418.222] (-416.586) (-416.927) * (-419.495) (-417.280) (-419.311) [-418.359] -- 0:00:02
959000 -- (-418.003) (-417.204) [-417.885] (-417.690) * (-417.785) (-416.276) [-415.696] (-417.726) -- 0:00:02
959500 -- [-417.968] (-417.593) (-420.044) (-418.074) * (-416.459) [-414.837] (-416.025) (-415.896) -- 0:00:02
960000 -- (-422.016) (-415.524) (-416.659) [-418.200] * [-419.328] (-416.064) (-416.501) (-418.201) -- 0:00:02
Average standard deviation of split frequencies: 0.008898
960500 -- (-423.768) [-418.454] (-415.328) (-416.488) * (-415.541) [-417.464] (-417.223) (-418.852) -- 0:00:02
961000 -- (-419.034) (-417.562) (-416.792) [-417.216] * [-416.032] (-419.312) (-417.785) (-416.788) -- 0:00:02
961500 -- (-419.560) [-418.996] (-418.516) (-416.709) * (-418.381) [-415.937] (-416.393) (-416.038) -- 0:00:02
962000 -- [-419.245] (-422.866) (-417.815) (-417.284) * (-418.916) [-415.394] (-415.252) (-415.657) -- 0:00:02
962500 -- (-420.457) (-415.224) [-417.127] (-421.544) * (-416.680) (-414.612) (-418.369) [-415.456] -- 0:00:02
963000 -- (-414.798) [-416.917] (-415.447) (-420.328) * (-414.877) (-416.275) [-416.828] (-415.799) -- 0:00:02
963500 -- (-414.821) (-417.443) (-417.064) [-415.224] * (-416.124) (-415.052) [-417.567] (-415.930) -- 0:00:02
964000 -- (-416.957) [-420.908] (-417.438) (-416.822) * (-417.046) [-415.014] (-417.436) (-415.913) -- 0:00:02
964500 -- (-417.968) (-416.372) (-418.652) [-417.859] * (-417.086) (-416.150) [-417.713] (-416.365) -- 0:00:02
965000 -- (-419.157) (-416.525) [-421.869] (-415.211) * (-417.591) (-417.179) [-418.689] (-418.811) -- 0:00:02
Average standard deviation of split frequencies: 0.008654
965500 -- [-417.258] (-418.724) (-417.880) (-416.460) * [-416.472] (-416.565) (-416.350) (-417.329) -- 0:00:02
966000 -- (-420.777) (-416.321) (-423.948) [-417.572] * (-418.530) [-415.950] (-417.043) (-416.000) -- 0:00:02
966500 -- [-418.495] (-416.529) (-416.614) (-417.397) * (-417.217) (-419.123) [-415.523] (-416.950) -- 0:00:02
967000 -- (-416.634) [-416.068] (-417.011) (-416.314) * (-418.439) (-420.368) (-418.229) [-415.097] -- 0:00:01
967500 -- [-417.045] (-416.592) (-418.719) (-419.375) * (-415.717) (-421.036) (-415.240) [-415.542] -- 0:00:01
968000 -- (-417.149) (-416.381) [-417.129] (-418.143) * (-417.115) [-418.103] (-416.778) (-415.884) -- 0:00:01
968500 -- [-415.339] (-417.242) (-417.906) (-418.566) * (-415.829) (-417.532) [-417.078] (-416.551) -- 0:00:01
969000 -- (-417.056) (-415.303) [-415.812] (-418.779) * (-418.507) (-418.515) [-418.606] (-415.186) -- 0:00:01
969500 -- (-417.288) [-415.897] (-417.491) (-415.414) * [-418.090] (-418.585) (-418.279) (-415.131) -- 0:00:01
970000 -- (-416.666) (-414.957) [-416.893] (-417.090) * [-416.378] (-419.841) (-417.162) (-415.473) -- 0:00:01
Average standard deviation of split frequencies: 0.008839
970500 -- (-417.010) (-415.143) (-418.200) [-418.192] * (-416.589) (-417.681) (-418.381) [-418.023] -- 0:00:01
971000 -- [-415.898] (-417.534) (-415.128) (-417.769) * (-416.770) (-422.183) (-419.888) [-420.101] -- 0:00:01
971500 -- (-415.643) (-416.269) [-415.905] (-415.908) * [-415.461] (-416.861) (-420.125) (-417.989) -- 0:00:01
972000 -- [-415.179] (-418.048) (-415.733) (-416.746) * (-415.604) [-416.967] (-418.274) (-415.443) -- 0:00:01
972500 -- [-415.670] (-416.957) (-416.449) (-416.993) * (-417.421) (-415.936) [-415.428] (-421.873) -- 0:00:01
973000 -- (-419.028) (-415.275) [-416.377] (-417.758) * [-417.451] (-417.922) (-419.544) (-416.747) -- 0:00:01
973500 -- (-417.579) [-415.294] (-417.382) (-420.146) * [-416.495] (-417.194) (-419.667) (-420.078) -- 0:00:01
974000 -- (-417.463) [-417.876] (-416.707) (-419.708) * (-420.279) (-416.412) [-416.843] (-417.143) -- 0:00:01
974500 -- (-421.318) [-416.773] (-418.316) (-415.692) * (-417.527) [-416.357] (-414.895) (-417.711) -- 0:00:01
975000 -- (-417.016) [-417.812] (-417.444) (-416.043) * [-415.979] (-418.050) (-416.484) (-419.135) -- 0:00:01
Average standard deviation of split frequencies: 0.008791
975500 -- [-417.127] (-417.791) (-417.070) (-416.371) * (-419.854) [-417.135] (-416.236) (-417.341) -- 0:00:01
976000 -- [-416.307] (-415.053) (-416.289) (-417.073) * (-418.056) (-416.631) [-414.649] (-420.034) -- 0:00:01
976500 -- (-417.457) [-418.668] (-415.923) (-423.581) * (-421.238) [-421.562] (-414.924) (-420.023) -- 0:00:01
977000 -- (-417.986) (-418.336) [-420.145] (-415.853) * (-421.811) [-417.071] (-421.087) (-420.956) -- 0:00:01
977500 -- [-415.822] (-419.425) (-416.275) (-416.082) * (-417.604) [-416.072] (-416.330) (-415.432) -- 0:00:01
978000 -- (-415.467) [-421.181] (-416.121) (-417.614) * [-417.332] (-418.059) (-416.588) (-416.648) -- 0:00:01
978500 -- [-417.660] (-419.732) (-420.346) (-416.788) * (-417.124) [-417.097] (-415.870) (-419.316) -- 0:00:01
979000 -- (-417.331) (-417.126) (-416.837) [-416.253] * (-417.735) [-415.745] (-416.950) (-418.893) -- 0:00:01
979500 -- (-417.300) (-419.030) (-416.051) [-415.611] * [-415.515] (-416.702) (-417.869) (-416.376) -- 0:00:01
980000 -- (-416.298) (-419.001) (-415.395) [-416.372] * (-418.855) [-417.783] (-417.045) (-417.206) -- 0:00:01
Average standard deviation of split frequencies: 0.008781
980500 -- [-418.116] (-415.710) (-415.192) (-419.043) * (-419.999) [-416.032] (-417.087) (-417.846) -- 0:00:01
981000 -- (-419.513) (-416.275) [-415.825] (-415.950) * (-419.778) [-414.872] (-415.619) (-417.421) -- 0:00:01
981500 -- (-417.975) (-416.731) [-416.403] (-417.655) * [-418.354] (-414.682) (-415.824) (-417.362) -- 0:00:01
982000 -- (-417.705) [-415.574] (-415.229) (-417.733) * (-418.292) (-416.923) (-415.812) [-420.521] -- 0:00:01
982500 -- (-417.527) [-416.921] (-416.825) (-416.982) * (-417.700) (-420.837) [-416.657] (-416.163) -- 0:00:01
983000 -- (-416.070) (-418.179) (-417.547) [-419.383] * [-419.286] (-417.951) (-425.716) (-419.078) -- 0:00:01
983500 -- [-416.357] (-415.282) (-415.735) (-419.075) * (-417.482) (-421.637) [-418.100] (-416.553) -- 0:00:00
984000 -- [-415.549] (-419.094) (-419.616) (-415.546) * (-416.384) [-418.513] (-416.245) (-415.941) -- 0:00:00
984500 -- (-416.810) (-416.853) [-418.099] (-417.495) * (-417.473) [-417.476] (-415.897) (-414.811) -- 0:00:00
985000 -- [-414.956] (-417.591) (-422.682) (-421.134) * [-417.528] (-419.514) (-419.682) (-421.018) -- 0:00:00
Average standard deviation of split frequencies: 0.008638
985500 -- (-416.261) (-416.460) [-418.224] (-416.182) * (-416.374) (-415.607) [-417.797] (-417.551) -- 0:00:00
986000 -- (-418.093) (-415.924) (-417.645) [-418.784] * (-416.651) (-416.089) [-416.937] (-416.437) -- 0:00:00
986500 -- (-415.941) [-414.912] (-418.784) (-416.149) * [-416.018] (-417.123) (-418.735) (-415.384) -- 0:00:00
987000 -- [-416.966] (-419.649) (-416.641) (-422.560) * (-417.285) [-417.602] (-415.431) (-418.682) -- 0:00:00
987500 -- (-416.793) [-415.619] (-416.051) (-417.107) * (-417.081) [-417.579] (-416.659) (-418.309) -- 0:00:00
988000 -- (-415.646) [-416.426] (-416.943) (-420.621) * (-415.256) (-415.518) [-416.843] (-416.027) -- 0:00:00
988500 -- [-415.925] (-417.848) (-420.585) (-417.144) * [-414.684] (-416.888) (-417.502) (-419.667) -- 0:00:00
989000 -- [-416.238] (-416.686) (-416.967) (-419.270) * (-415.003) (-416.409) [-416.789] (-417.986) -- 0:00:00
989500 -- [-417.586] (-417.317) (-420.606) (-415.896) * [-415.138] (-419.605) (-421.331) (-417.650) -- 0:00:00
990000 -- (-419.545) (-415.858) [-424.230] (-415.499) * (-415.110) [-416.653] (-416.158) (-416.441) -- 0:00:00
Average standard deviation of split frequencies: 0.008565
990500 -- (-420.173) [-416.192] (-418.135) (-416.526) * [-415.379] (-418.614) (-415.505) (-416.593) -- 0:00:00
991000 -- (-419.336) (-420.145) (-415.732) [-416.462] * (-420.824) (-420.799) [-415.704] (-418.451) -- 0:00:00
991500 -- (-418.062) (-417.765) (-419.716) [-416.561] * (-421.330) (-420.999) [-417.122] (-417.851) -- 0:00:00
992000 -- (-417.201) (-417.136) (-415.579) [-416.632] * (-416.548) (-417.634) [-415.114] (-416.838) -- 0:00:00
992500 -- [-417.182] (-419.014) (-415.676) (-416.556) * [-419.429] (-420.355) (-416.438) (-415.734) -- 0:00:00
993000 -- (-419.171) (-418.198) [-418.885] (-420.304) * (-417.870) (-421.776) [-420.814] (-415.308) -- 0:00:00
993500 -- (-419.091) [-416.163] (-419.151) (-415.181) * (-418.830) [-418.694] (-419.870) (-415.411) -- 0:00:00
994000 -- [-419.321] (-415.680) (-417.377) (-414.964) * (-418.718) [-418.175] (-418.630) (-421.648) -- 0:00:00
994500 -- (-417.961) (-414.830) [-414.997] (-415.843) * (-417.643) (-419.740) [-419.044] (-421.995) -- 0:00:00
995000 -- (-418.415) (-420.256) (-416.924) [-417.108] * (-416.138) [-420.736] (-416.326) (-416.566) -- 0:00:00
Average standard deviation of split frequencies: 0.008330
995500 -- (-418.091) (-419.366) [-416.597] (-418.486) * (-416.264) [-419.651] (-416.835) (-420.675) -- 0:00:00
996000 -- [-416.830] (-416.808) (-415.691) (-421.418) * (-416.894) [-416.403] (-417.530) (-423.347) -- 0:00:00
996500 -- (-416.809) [-416.046] (-415.630) (-419.106) * (-418.993) (-415.093) (-416.271) [-414.996] -- 0:00:00
997000 -- [-417.377] (-417.828) (-416.963) (-416.646) * [-417.186] (-418.999) (-416.132) (-415.680) -- 0:00:00
997500 -- (-417.788) [-417.087] (-419.903) (-415.809) * (-417.173) [-417.941] (-415.650) (-418.266) -- 0:00:00
998000 -- [-415.630] (-418.249) (-417.773) (-415.693) * (-416.866) (-418.066) [-417.745] (-424.006) -- 0:00:00
998500 -- (-416.139) (-417.814) [-419.716] (-422.006) * (-418.762) [-415.845] (-415.743) (-416.455) -- 0:00:00
999000 -- (-419.359) [-415.301] (-416.014) (-416.548) * [-417.981] (-416.900) (-416.988) (-418.334) -- 0:00:00
999500 -- (-416.554) (-417.481) (-415.538) [-419.487] * (-416.579) [-417.971] (-415.172) (-419.270) -- 0:00:00
1000000 -- (-418.448) (-421.293) (-415.504) [-417.905] * (-417.235) (-417.489) [-415.780] (-418.835) -- 0:00:00
Average standard deviation of split frequencies: 0.007914
Analysis completed in 60 seconds
Analysis used 59.35 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -414.54
Likelihood of best state for "cold" chain of run 2 was -414.54
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.5 % ( 36 %) Dirichlet(Pi{all})
39.0 % ( 26 %) Slider(Pi{all})
78.7 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 47 %) Multiplier(Alpha{3})
25.6 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 59 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.7 % ( 31 %) Dirichlet(Pi{all})
38.9 % ( 22 %) Slider(Pi{all})
79.0 % ( 49 %) Multiplier(Alpha{1,2})
77.4 % ( 54 %) Multiplier(Alpha{3})
26.3 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 20 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166243 0.82 0.67
3 | 166704 167175 0.84
4 | 166763 166598 166517
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166498 0.82 0.67
3 | 166839 166219 0.83
4 | 166901 166673 166870
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -416.34
| 2 2 1 |
| |
| 1 2 1 2 |
| 1 2 2 1 1 1 1 1 2 2 12 2 |
| 2 1 2 * 12 2 |
| 2 2 222 |
|2 1 1 1 22 2 * 1* 1 1 |
| 1 * 1 2 2 1 21 2 2 1 |
| 2 * 2 1 1 1 12 1 1 2 2 1 1 1 |
|1 1 2 1 2 2 22 2 * 1 2 21|
| 2 * 1 1 1 2 1 1 2|
| 1 1 1 1 2 1 |
| 2 1 22 2 1 |
| 1 2 2 2 2 |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -417.74
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.25 -422.90
2 -416.28 -419.88
--------------------------------------
TOTAL -416.27 -422.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897713 0.094207 0.377027 1.535445 0.860498 1501.00 1501.00 1.000
r(A<->C){all} 0.170244 0.019748 0.000041 0.455582 0.138017 227.42 248.97 1.000
r(A<->G){all} 0.160051 0.019068 0.000084 0.457143 0.124902 334.40 348.06 1.000
r(A<->T){all} 0.165224 0.019026 0.000168 0.442449 0.128910 158.95 236.40 1.000
r(C<->G){all} 0.177775 0.021568 0.000072 0.466881 0.142002 212.69 230.71 1.001
r(C<->T){all} 0.156353 0.018470 0.000049 0.435127 0.117947 175.13 201.90 1.015
r(G<->T){all} 0.170354 0.020406 0.000085 0.460001 0.135683 209.91 269.95 1.001
pi(A){all} 0.256115 0.000628 0.208723 0.307644 0.255011 1140.96 1231.89 1.000
pi(C){all} 0.266936 0.000635 0.217559 0.315424 0.266463 1184.57 1238.71 1.000
pi(G){all} 0.266465 0.000661 0.215753 0.316809 0.266090 1320.34 1342.95 1.000
pi(T){all} 0.210484 0.000558 0.165585 0.257112 0.209314 1071.33 1128.97 1.000
alpha{1,2} 0.418777 0.224414 0.000281 1.404044 0.249937 1019.83 1156.00 1.000
alpha{3} 0.450721 0.230578 0.000365 1.464957 0.296121 1020.72 1115.91 1.000
pinvar{all} 0.994617 0.000041 0.981693 0.999999 0.996660 1286.24 1314.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .*...*
9 -- ..****
10 -- ...**.
11 -- .*.***
12 -- ...*.*
13 -- .*.*..
14 -- ..**..
15 -- .**.**
16 -- .****.
17 -- ..*..*
18 -- .*..*.
19 -- ..*.*.
20 -- .***.*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.012719 0.147235 0.165223 2
8 457 0.152232 0.003298 0.149900 0.154564 2
9 450 0.149900 0.000942 0.149234 0.150566 2
10 447 0.148901 0.009893 0.141905 0.155896 2
11 441 0.146902 0.003298 0.144570 0.149234 2
12 433 0.144237 0.022141 0.128581 0.159893 2
13 428 0.142572 0.002827 0.140573 0.144570 2
14 428 0.142572 0.009422 0.135909 0.149234 2
15 426 0.141905 0.015075 0.131246 0.152565 2
16 425 0.141572 0.006124 0.137242 0.145903 2
17 413 0.137575 0.017430 0.125250 0.149900 2
18 412 0.137242 0.000942 0.136576 0.137908 2
19 410 0.136576 0.008480 0.130580 0.142572 2
20 410 0.136576 0.002827 0.134577 0.138574 2
21 409 0.136243 0.003298 0.133911 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099291 0.010065 0.000010 0.300146 0.069862 1.000 2
length{all}[2] 0.100287 0.010001 0.000001 0.301343 0.069979 1.000 2
length{all}[3] 0.099514 0.009983 0.000045 0.288485 0.070369 1.000 2
length{all}[4] 0.100043 0.009603 0.000007 0.293653 0.069741 1.000 2
length{all}[5] 0.098479 0.009767 0.000031 0.299005 0.069750 1.000 2
length{all}[6] 0.098198 0.009996 0.000013 0.293161 0.066360 1.000 2
length{all}[7] 0.107779 0.011666 0.000586 0.307208 0.074954 0.998 2
length{all}[8] 0.098473 0.009062 0.000581 0.284956 0.072250 1.012 2
length{all}[9] 0.104534 0.009935 0.000332 0.311789 0.071739 1.000 2
length{all}[10] 0.100719 0.010560 0.000007 0.283684 0.069639 1.000 2
length{all}[11] 0.107270 0.010825 0.000013 0.300537 0.078636 0.999 2
length{all}[12] 0.087287 0.007863 0.000288 0.256240 0.060426 0.998 2
length{all}[13] 0.100941 0.011458 0.000097 0.324349 0.069291 0.998 2
length{all}[14] 0.099296 0.008891 0.000276 0.295088 0.070156 0.998 2
length{all}[15] 0.102424 0.009719 0.000032 0.279505 0.071831 1.000 2
length{all}[16] 0.094644 0.008739 0.000220 0.288250 0.064891 1.000 2
length{all}[17] 0.099825 0.009465 0.000359 0.288791 0.067598 0.998 2
length{all}[18] 0.101113 0.011660 0.000163 0.316829 0.066584 1.001 2
length{all}[19] 0.099758 0.009262 0.000007 0.262355 0.076196 0.998 2
length{all}[20] 0.092680 0.009219 0.000097 0.265643 0.062919 1.000 2
length{all}[21] 0.100883 0.008438 0.000379 0.292485 0.074791 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007914
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 300
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 42 patterns at 100 / 100 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 42 patterns at 100 / 100 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40992 bytes for conP
3696 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096471 0.056336 0.062522 0.032361 0.089517 0.098583 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -433.686886
Iterating by ming2
Initial: fx= 433.686886
x= 0.09647 0.05634 0.06252 0.03236 0.08952 0.09858 0.30000 1.30000
1 h-m-p 0.0000 0.0003 240.4931 +++ 414.712961 m 0.0003 14 | 1/8
2 h-m-p 0.0037 0.1446 19.5398 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 220.5467 +++ 402.845546 m 0.0002 47 | 2/8
4 h-m-p 0.0023 0.1534 21.1989 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 197.9307 ++ 400.380392 m 0.0001 79 | 3/8
6 h-m-p 0.0006 0.1822 19.0384 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 171.3497 +++ 392.260318 m 0.0003 111 | 4/8
8 h-m-p 0.0024 0.2318 15.8790 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 140.5539 ++ 390.853803 m 0.0001 143 | 5/8
10 h-m-p 0.0006 0.3228 12.2403 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 99.4980 ++ 390.639709 m 0.0000 174 | 6/8
12 h-m-p 0.0746 8.0000 0.0000 --------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 390.639709 m 8.0000 213 | 6/8
14 h-m-p 0.0037 1.8584 2.0600 ++++Y 390.639693 0 0.6329 230 | 6/8
15 h-m-p 1.6000 8.0000 0.0778 Y 390.639693 0 1.1177 241 | 6/8
16 h-m-p 1.6000 8.0000 0.0003 ++ 390.639693 m 8.0000 254 | 6/8
17 h-m-p 0.0571 8.0000 0.0476 ++Y 390.639693 0 1.7424 269 | 6/8
18 h-m-p 1.6000 8.0000 0.0047 ++ 390.639692 m 8.0000 282 | 6/8
19 h-m-p 0.0174 0.8218 2.1816 ----------C 390.639692 0 0.0000 305 | 6/8
20 h-m-p 0.0160 8.0000 0.1166 +++C 390.639692 0 1.0213 319 | 6/8
21 h-m-p 1.6000 8.0000 0.0005 C 390.639692 0 2.1372 332 | 6/8
22 h-m-p 1.6000 8.0000 0.0005 Y 390.639692 0 0.8450 345 | 6/8
23 h-m-p 1.6000 8.0000 0.0002 ++ 390.639692 m 8.0000 358 | 6/8
24 h-m-p 0.3537 8.0000 0.0035 +Y 390.639692 0 2.5903 372 | 6/8
25 h-m-p 1.6000 8.0000 0.0001 ++ 390.639692 m 8.0000 385 | 6/8
26 h-m-p 0.0031 1.5293 1.0699 -------C 390.639692 0 0.0000 405 | 6/8
27 h-m-p 0.0160 8.0000 0.2032 +++Y 390.639692 0 0.8357 419 | 6/8
28 h-m-p 1.6000 8.0000 0.0048 Y 390.639692 0 1.0824 432 | 6/8
29 h-m-p 1.6000 8.0000 0.0000 -----C 390.639692 0 0.0004 450
Out..
lnL = -390.639692
451 lfun, 451 eigenQcodon, 2706 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041063 0.085148 0.023540 0.109178 0.027097 0.072757 1.497983 0.742814 0.242693
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.595214
np = 9
lnL0 = -424.510561
Iterating by ming2
Initial: fx= 424.510561
x= 0.04106 0.08515 0.02354 0.10918 0.02710 0.07276 1.49798 0.74281 0.24269
1 h-m-p 0.0000 0.0003 221.5864 +++ 411.620851 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0001 148.6062 ++ 409.905303 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0002 237.1138 ++ 405.152929 m 0.0002 39 | 3/9
4 h-m-p 0.0000 0.0002 593.7433 ++ 396.058294 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 5186.2711 ++ 393.389204 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2528.9982 ++ 392.643753 m 0.0000 75 | 6/9
7 h-m-p 0.0039 0.6751 2.1317 ------------.. | 6/9
8 h-m-p 0.0000 0.0002 97.1659 +++ 390.639707 m 0.0002 110 | 7/9
9 h-m-p 0.1511 8.0000 0.0000 +++ 390.639707 m 8.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0506 +++++ 390.639698 m 8.0000 140 | 7/9
11 h-m-p 0.0995 0.4977 1.3166 ++ 390.639687 m 0.4977 154 | 8/9
12 h-m-p 1.2057 6.0284 0.3708 ------------C 390.639687 0 0.0000 178 | 8/9
13 h-m-p 0.0235 8.0000 0.0000 ---------Y 390.639687 0 0.0000 200
Out..
lnL = -390.639687
201 lfun, 603 eigenQcodon, 2412 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.046092 0.053796 0.029120 0.083503 0.100047 0.042627 2.235348 1.251414 0.454878 0.138623 2.453242
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.910958
np = 11
lnL0 = -421.447782
Iterating by ming2
Initial: fx= 421.447782
x= 0.04609 0.05380 0.02912 0.08350 0.10005 0.04263 2.23535 1.25141 0.45488 0.13862 2.45324
1 h-m-p 0.0000 0.0004 188.4951 +++ 407.352634 m 0.0004 17 | 1/11
2 h-m-p 0.0004 0.0019 62.0694 ++ 400.827777 m 0.0019 31 | 2/11
3 h-m-p 0.0000 0.0000 58203.4310 ++ 399.758128 m 0.0000 45 | 3/11
4 h-m-p 0.0009 0.0136 9.9101 -----------.. | 3/11
5 h-m-p 0.0000 0.0000 177.7691 ++ 399.528292 m 0.0000 82 | 4/11
6 h-m-p 0.0004 0.2086 6.1876 ----------.. | 4/11
7 h-m-p 0.0000 0.0001 153.9102 ++ 397.551036 m 0.0001 118 | 5/11
8 h-m-p 0.0160 8.0000 5.3617 -------------.. | 5/11
9 h-m-p 0.0000 0.0003 128.1492 +++ 392.210978 m 0.0003 158 | 6/11
10 h-m-p 0.0160 8.0000 2.8060 -------------.. | 6/11
11 h-m-p 0.0000 0.0002 96.6857 +++ 390.639694 m 0.0002 198 | 7/11
12 h-m-p 0.1329 8.0000 0.0000 +++ 390.639694 m 8.0000 213 | 7/11
13 h-m-p 0.0160 8.0000 0.0142 +++++ 390.639693 m 8.0000 234 | 7/11
14 h-m-p 0.0779 8.0000 1.4624 +++C 390.639680 0 4.9861 255 | 7/11
15 h-m-p 1.6000 8.0000 0.1295 ++ 390.639680 m 8.0000 269 | 7/11
16 h-m-p 0.0655 6.4141 15.8233 -----------C 390.639680 0 0.0000 298 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 390.639680 m 8.0000 315 | 7/11
18 h-m-p 0.0160 8.0000 0.0565 +++++ 390.639678 m 8.0000 336 | 7/11
19 h-m-p 0.0514 0.9769 8.7995 +Y 390.639669 0 0.3362 355 | 7/11
20 h-m-p 0.3778 1.8892 2.9842 C 390.639667 0 0.3778 369 | 7/11
21 h-m-p 1.6000 8.0000 0.2839 C 390.639667 0 0.5960 383 | 7/11
22 h-m-p 1.6000 8.0000 0.0050 C 390.639667 0 1.6000 401 | 7/11
23 h-m-p 1.6000 8.0000 0.0001 ++ 390.639667 m 8.0000 419 | 7/11
24 h-m-p 0.0160 8.0000 0.2410 +++C 390.639667 0 1.1720 440 | 7/11
25 h-m-p 1.6000 8.0000 0.0519 ++ 390.639666 m 8.0000 458 | 7/11
26 h-m-p 0.1907 3.1472 2.1773 +C 390.639663 0 1.0910 477 | 7/11
27 h-m-p 1.6000 8.0000 0.8564 +Y 390.639660 0 4.7192 492 | 7/11
28 h-m-p 1.6000 8.0000 2.3371 +Y 390.639653 0 7.0457 511 | 7/11
29 h-m-p 1.6000 8.0000 7.8107 +C 390.639643 0 6.4000 526 | 7/11
30 h-m-p 0.5087 2.5436 10.2644 ++ 390.639637 m 2.5436 540 | 7/11
31 h-m-p -0.0000 -0.0000 76.8258
h-m-p: -0.00000000e+00 -0.00000000e+00 7.68258310e+01 390.639637
.. | 7/11
32 h-m-p 0.0160 8.0000 0.0000 Y 390.639637 0 0.0040 565 | 7/11
33 h-m-p 0.0160 8.0000 0.0000 Y 390.639637 0 0.0160 583
Out..
lnL = -390.639637
584 lfun, 2336 eigenQcodon, 10512 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -390.638564 S = -390.637497 -0.000407
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:04
did 20 / 42 patterns 0:04
did 30 / 42 patterns 0:04
did 40 / 42 patterns 0:04
did 42 / 42 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108506 0.012864 0.044902 0.080243 0.040241 0.039496 8.253238 0.792600 1.273534
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 2.978304
np = 9
lnL0 = -421.893775
Iterating by ming2
Initial: fx= 421.893775
x= 0.10851 0.01286 0.04490 0.08024 0.04024 0.03950 8.25324 0.79260 1.27353
1 h-m-p 0.0000 0.0001 226.8535 ++ 414.811204 m 0.0001 14 | 1/9
2 h-m-p 0.0023 0.0670 12.5011 ------------.. | 1/9
3 h-m-p 0.0000 0.0003 209.9568 +++ 402.159685 m 0.0003 49 | 2/9
4 h-m-p 0.0078 0.1439 6.7418 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 193.5269 ++ 401.869808 m 0.0000 84 | 3/9
6 h-m-p 0.0008 0.3877 3.9226 -----------.. | 3/9
7 h-m-p 0.0000 0.0000 167.0419 ++ 400.514554 m 0.0000 117 | 4/9
8 h-m-p 0.0020 0.4715 3.3558 ------------.. | 4/9
9 h-m-p 0.0000 0.0004 135.9733 +++ 393.536557 m 0.0004 152 | 5/9
10 h-m-p 0.0139 0.5903 2.5549 -------------.. | 5/9
11 h-m-p 0.0000 0.0003 98.1593 +++ 390.639717 m 0.0003 188 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 390.639717 m 8.0000 200 | 6/9
13 h-m-p 0.0257 8.0000 0.0015 ----N 390.639717 0 0.0000 219 | 6/9
14 h-m-p 0.0160 8.0000 0.0001 -----Y 390.639717 0 0.0000 239 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 C 390.639717 0 0.0040 254
Out..
lnL = -390.639717
255 lfun, 2805 eigenQcodon, 15300 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.081685 0.016641 0.023618 0.015080 0.081703 0.034497 8.253234 0.900000 1.125390 1.753274 2.852108
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 2.194231
np = 11
lnL0 = -413.484889
Iterating by ming2
Initial: fx= 413.484889
x= 0.08168 0.01664 0.02362 0.01508 0.08170 0.03450 8.25323 0.90000 1.12539 1.75327 2.85211
1 h-m-p 0.0000 0.0002 206.0634 +++ 405.784659 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0001 117.6342 ++ 405.002729 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0002 68.7075 ++ 402.480487 m 0.0002 45 | 3/11
4 h-m-p 0.0007 0.0067 19.4168 ++ 396.492345 m 0.0067 59 | 4/11
5 h-m-p 0.0000 0.0000 15233.1707 ++ 390.640097 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 70.4264 ++ 390.639670 m 0.0000 87 | 6/11
7 h-m-p 0.1870 8.0000 0.0008 +++ 390.639669 m 8.0000 102 | 6/11
8 h-m-p 0.0108 1.9288 0.5655 ++++ 390.639642 m 1.9288 123 | 7/11
9 h-m-p 0.2055 1.0274 3.6363 ----------C 390.639642 0 0.0000 152 | 7/11
10 h-m-p 0.0838 8.0000 0.0000 --------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 390.639642 m 8.0000 199 | 7/11
12 h-m-p 0.0160 8.0000 0.0968 +++++ 390.639638 m 8.0000 220 | 7/11
13 h-m-p 0.2794 8.0000 2.7723 +++ 390.639613 m 8.0000 239 | 7/11
14 h-m-p 1.6000 8.0000 2.5645 ++ 390.639608 m 8.0000 253 | 7/11
15 h-m-p 0.8751 8.0000 23.4450 ++ 390.639598 m 8.0000 267 | 7/11
16 h-m-p 1.6000 8.0000 7.5208 ++ 390.639598 m 8.0000 281 | 7/11
17 h-m-p 0.2398 1.1988 245.3046 ---------Y 390.639598 0 0.0000 304 | 7/11
18 h-m-p 1.6000 8.0000 0.0000 -Y 390.639598 0 0.1000 319 | 7/11
19 h-m-p 0.4908 8.0000 0.0000 Y 390.639598 0 0.4908 337 | 7/11
20 h-m-p 0.0215 8.0000 0.0002 -----------C 390.639598 0 0.0000 366
Out..
lnL = -390.639598
367 lfun, 4404 eigenQcodon, 24222 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -390.637352 S = -390.637324 -0.000012
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:15
did 20 / 42 patterns 0:15
did 30 / 42 patterns 0:15
did 40 / 42 patterns 0:15
did 42 / 42 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
NC_011896_1_WP_010908584_1_1988_MLBR_RS09435 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
NC_002677_1_NP_302263_1_1135_rplW MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
**************************************************
NC_011896_1_WP_010908584_1_1988_MLBR_RS09435 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
NC_002677_1_NP_302263_1_1135_rplW SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505 SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
**************************************************
>NC_011896_1_WP_010908584_1_1988_MLBR_RS09435 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT >NC_002677_1_NP_302263_1_1135_rplW ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT >NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT >NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT >NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT >NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505 ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>NC_011896_1_WP_010908584_1_1988_MLBR_RS09435 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA >NC_002677_1_NP_302263_1_1135_rplW MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA >NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA >NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA >NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA >NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505 MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
#NEXUS
[ID: 0522985363]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908584_1_1988_MLBR_RS09435
NC_002677_1_NP_302263_1_1135_rplW
NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580
NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200
NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235
NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908584_1_1988_MLBR_RS09435,
2 NC_002677_1_NP_302263_1_1135_rplW,
3 NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580,
4 NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200,
5 NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235,
6 NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06986189,2:0.06997927,3:0.07036913,4:0.06974128,5:0.0697499,6:0.06635971);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06986189,2:0.06997927,3:0.07036913,4:0.06974128,5:0.0697499,6:0.06635971);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -416.25 -422.90
2 -416.28 -419.88
--------------------------------------
TOTAL -416.27 -422.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897713 0.094207 0.377027 1.535445 0.860498 1501.00 1501.00 1.000
r(A<->C){all} 0.170244 0.019748 0.000041 0.455582 0.138017 227.42 248.97 1.000
r(A<->G){all} 0.160051 0.019068 0.000084 0.457143 0.124902 334.40 348.06 1.000
r(A<->T){all} 0.165224 0.019026 0.000168 0.442449 0.128910 158.95 236.40 1.000
r(C<->G){all} 0.177775 0.021568 0.000072 0.466881 0.142002 212.69 230.71 1.001
r(C<->T){all} 0.156353 0.018470 0.000049 0.435127 0.117947 175.13 201.90 1.015
r(G<->T){all} 0.170354 0.020406 0.000085 0.460001 0.135683 209.91 269.95 1.001
pi(A){all} 0.256115 0.000628 0.208723 0.307644 0.255011 1140.96 1231.89 1.000
pi(C){all} 0.266936 0.000635 0.217559 0.315424 0.266463 1184.57 1238.71 1.000
pi(G){all} 0.266465 0.000661 0.215753 0.316809 0.266090 1320.34 1342.95 1.000
pi(T){all} 0.210484 0.000558 0.165585 0.257112 0.209314 1071.33 1128.97 1.000
alpha{1,2} 0.418777 0.224414 0.000281 1.404044 0.249937 1019.83 1156.00 1.000
alpha{3} 0.450721 0.230578 0.000365 1.464957 0.296121 1020.72 1115.91 1.000
pinvar{all} 0.994617 0.000041 0.981693 0.999999 0.996660 1286.24 1314.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplW/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 100
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 11 11 11 11 11 11 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 2 2 2 2 2 2 | GAC 5 5 5 5 5 5 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 2 2 2 2 2 2
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908584_1_1988_MLBR_RS09435
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
#2: NC_002677_1_NP_302263_1_1135_rplW
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
#3: NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
#4: NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
#5: NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
#6: NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 6 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 0 | CGC 18
CTA 0 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 30 | CCG 12 | CAG 6 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 0
ATC 42 | ACC 18 | AAC 12 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 66 | AGG 18
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 6 | Gly G GGT 12
GTC 24 | GCC 12 | GAC 30 | GGC 6
GTA 6 | GCA 12 | Glu E GAA 0 | GGA 12
GTG 18 | GCG 6 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15000 C:0.15000 A:0.40000 G:0.30000
position 2: T:0.28000 C:0.29000 A:0.28000 G:0.15000
position 3: T:0.20000 C:0.36000 A:0.09000 G:0.35000
Average T:0.21000 C:0.26667 A:0.25667 G:0.26667
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -390.639692 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.497983 0.960415
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908584_1_1988_MLBR_RS09435: 0.000004, NC_002677_1_NP_302263_1_1135_rplW: 0.000004, NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580: 0.000004, NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200: 0.000004, NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235: 0.000004, NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.49798
omega (dN/dS) = 0.96042
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
7..2 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
7..3 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
7..4 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
7..5 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
7..6 0.000 235.8 64.2 0.9604 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -390.639687 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 2.235348 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908584_1_1988_MLBR_RS09435: 0.000004, NC_002677_1_NP_302263_1_1135_rplW: 0.000004, NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580: 0.000004, NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200: 0.000004, NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235: 0.000004, NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.23535
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 233.2 66.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -390.639637 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 8.253238 0.000000 0.000017 0.000001 4.961995
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908584_1_1988_MLBR_RS09435: 0.000004, NC_002677_1_NP_302263_1_1135_rplW: 0.000004, NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580: 0.000004, NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200: 0.000004, NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235: 0.000004, NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 8.25324
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00002 0.99998
w: 0.00000 1.00000 4.96200
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
7..2 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
7..3 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
7..4 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
7..5 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
7..6 0.000 226.2 73.8 4.9619 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908584_1_1988_MLBR_RS09435)
Pr(w>1) post mean +- SE for w
1 M 1.000** 4.962
2 A 1.000** 4.962
3 T 1.000** 4.962
4 I 1.000** 4.962
5 A 1.000** 4.962
6 D 1.000** 4.962
7 S 1.000** 4.962
8 R 1.000** 4.962
9 D 1.000** 4.962
10 I 1.000** 4.962
11 I 1.000** 4.962
12 L 1.000** 4.962
13 A 1.000** 4.962
14 P 1.000** 4.962
15 V 1.000** 4.962
16 I 1.000** 4.962
17 S 1.000** 4.962
18 E 1.000** 4.962
19 K 1.000** 4.962
20 S 1.000** 4.962
21 Y 1.000** 4.962
22 G 1.000** 4.962
23 L 1.000** 4.962
24 L 1.000** 4.962
25 D 1.000** 4.962
26 D 1.000** 4.962
27 N 1.000** 4.962
28 V 1.000** 4.962
29 Y 1.000** 4.962
30 T 1.000** 4.962
31 F 1.000** 4.962
32 V 1.000** 4.962
33 V 1.000** 4.962
34 H 1.000** 4.962
35 P 1.000** 4.962
36 D 1.000** 4.962
37 S 1.000** 4.962
38 N 1.000** 4.962
39 K 1.000** 4.962
40 T 1.000** 4.962
41 Q 1.000** 4.962
42 I 1.000** 4.962
43 K 1.000** 4.962
44 I 1.000** 4.962
45 A 1.000** 4.962
46 I 1.000** 4.962
47 E 1.000** 4.962
48 K 1.000** 4.962
49 I 1.000** 4.962
50 F 1.000** 4.962
51 S 1.000** 4.962
52 V 1.000** 4.962
53 K 1.000** 4.962
54 V 1.000** 4.962
55 A 1.000** 4.962
56 S 1.000** 4.962
57 V 1.000** 4.962
58 N 1.000** 4.962
59 T 1.000** 4.962
60 S 1.000** 4.962
61 N 1.000** 4.962
62 R 1.000** 4.962
63 K 1.000** 4.962
64 G 1.000** 4.962
65 K 1.000** 4.962
66 C 1.000** 4.962
67 K 1.000** 4.962
68 R 1.000** 4.962
69 T 1.000** 4.962
70 R 1.000** 4.962
71 T 1.000** 4.962
72 G 1.000** 4.962
73 F 1.000** 4.962
74 G 1.000** 4.962
75 R 1.000** 4.962
76 R 1.000** 4.962
77 K 1.000** 4.962
78 N 1.000** 4.962
79 T 1.000** 4.962
80 K 1.000** 4.962
81 R 1.000** 4.962
82 A 1.000** 4.962
83 I 1.000** 4.962
84 V 1.000** 4.962
85 T 1.000** 4.962
86 L 1.000** 4.962
87 A 1.000** 4.962
88 P 1.000** 4.962
89 G 1.000** 4.962
90 S 1.000** 4.962
91 K 1.000** 4.962
92 S 1.000** 4.962
93 I 1.000** 4.962
94 D 1.000** 4.962
95 L 1.000** 4.962
96 F 1.000** 4.962
97 G 1.000** 4.962
98 T 1.000** 4.962
99 P 1.000** 4.962
100 A 1.000** 4.962
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908584_1_1988_MLBR_RS09435)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -390.639717 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 8.253234 0.792568 1.273422
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908584_1_1988_MLBR_RS09435: 0.000004, NC_002677_1_NP_302263_1_1135_rplW: 0.000004, NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580: 0.000004, NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200: 0.000004, NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235: 0.000004, NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 8.25323
Parameters in M7 (beta):
p = 0.79257 q = 1.27342
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01766 0.07121 0.13712 0.21235 0.29600 0.38812 0.48946 0.60183 0.72924 0.88384
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
7..2 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
7..3 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
7..4 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
7..5 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
7..6 0.000 226.2 73.8 0.3827 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -390.639598 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 138.372363 0.000010 0.459305 2.121354 264.092972
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908584_1_1988_MLBR_RS09435: 0.000004, NC_002677_1_NP_302263_1_1135_rplW: 0.000004, NZ_LVXE01000034_1_WP_010908584_1_1547_A3216_RS09580: 0.000004, NZ_LYPH01000037_1_WP_010908584_1_1503_A8144_RS07200: 0.000004, NZ_CP029543_1_WP_010908584_1_2011_DIJ64_RS10235: 0.000004, NZ_AP014567_1_WP_010908584_1_2065_JK2ML_RS10505: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 138.37236
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.45930 q = 2.12135
(p1 = 0.99999) w = 264.09297
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00060 0.00664 0.02041 0.04321 0.07666 0.12310 0.18632 0.27324 0.39922 0.61814 264.09297
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
7..2 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
7..3 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
7..4 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
7..5 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
7..6 0.000 221.7 78.3 264.0903 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908584_1_1988_MLBR_RS09435)
Pr(w>1) post mean +- SE for w
1 M 1.000** 264.090
2 A 1.000** 264.090
3 T 1.000** 264.090
4 I 1.000** 264.090
5 A 1.000** 264.090
6 D 1.000** 264.090
7 S 1.000** 264.090
8 R 1.000** 264.090
9 D 1.000** 264.090
10 I 1.000** 264.090
11 I 1.000** 264.090
12 L 1.000** 264.090
13 A 1.000** 264.090
14 P 1.000** 264.090
15 V 1.000** 264.090
16 I 1.000** 264.090
17 S 1.000** 264.090
18 E 1.000** 264.090
19 K 1.000** 264.090
20 S 1.000** 264.090
21 Y 1.000** 264.090
22 G 1.000** 264.090
23 L 1.000** 264.090
24 L 1.000** 264.090
25 D 1.000** 264.090
26 D 1.000** 264.090
27 N 1.000** 264.090
28 V 1.000** 264.090
29 Y 1.000** 264.090
30 T 1.000** 264.090
31 F 1.000** 264.090
32 V 1.000** 264.090
33 V 1.000** 264.090
34 H 1.000** 264.090
35 P 1.000** 264.090
36 D 1.000** 264.090
37 S 1.000** 264.090
38 N 1.000** 264.090
39 K 1.000** 264.090
40 T 1.000** 264.090
41 Q 1.000** 264.090
42 I 1.000** 264.090
43 K 1.000** 264.090
44 I 1.000** 264.090
45 A 1.000** 264.090
46 I 1.000** 264.090
47 E 1.000** 264.090
48 K 1.000** 264.090
49 I 1.000** 264.090
50 F 1.000** 264.090
51 S 1.000** 264.090
52 V 1.000** 264.090
53 K 1.000** 264.090
54 V 1.000** 264.090
55 A 1.000** 264.090
56 S 1.000** 264.090
57 V 1.000** 264.090
58 N 1.000** 264.090
59 T 1.000** 264.090
60 S 1.000** 264.090
61 N 1.000** 264.090
62 R 1.000** 264.090
63 K 1.000** 264.090
64 G 1.000** 264.090
65 K 1.000** 264.090
66 C 1.000** 264.090
67 K 1.000** 264.090
68 R 1.000** 264.090
69 T 1.000** 264.090
70 R 1.000** 264.090
71 T 1.000** 264.090
72 G 1.000** 264.090
73 F 1.000** 264.090
74 G 1.000** 264.090
75 R 1.000** 264.090
76 R 1.000** 264.090
77 K 1.000** 264.090
78 N 1.000** 264.090
79 T 1.000** 264.090
80 K 1.000** 264.090
81 R 1.000** 264.090
82 A 1.000** 264.090
83 I 1.000** 264.090
84 V 1.000** 264.090
85 T 1.000** 264.090
86 L 1.000** 264.090
87 A 1.000** 264.090
88 P 1.000** 264.090
89 G 1.000** 264.090
90 S 1.000** 264.090
91 K 1.000** 264.090
92 S 1.000** 264.090
93 I 1.000** 264.090
94 D 1.000** 264.090
95 L 1.000** 264.090
96 F 1.000** 264.090
97 G 1.000** 264.090
98 T 1.000** 264.090
99 P 1.000** 264.090
100 A 1.000** 264.090
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908584_1_1988_MLBR_RS09435)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -390.639687 Model 2: PositiveSelection -390.639637 Model 0: one-ratio -390.639692 Model 7: beta -390.639717 Model 8: beta&w>1 -390.639598 Model 0 vs 1 1.0000000088439265E-5 Model 2 vs 1 9.999999997489795E-5 Model 8 vs 7 2.380000000812288E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
