--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:49:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplW/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -416.25          -422.90
2       -416.28          -419.88
--------------------------------------
TOTAL     -416.27          -422.25
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897713    0.094207    0.377027    1.535445    0.860498   1501.00   1501.00    1.000
r(A<->C){all}   0.170244    0.019748    0.000041    0.455582    0.138017    227.42    248.97    1.000
r(A<->G){all}   0.160051    0.019068    0.000084    0.457143    0.124902    334.40    348.06    1.000
r(A<->T){all}   0.165224    0.019026    0.000168    0.442449    0.128910    158.95    236.40    1.000
r(C<->G){all}   0.177775    0.021568    0.000072    0.466881    0.142002    212.69    230.71    1.001
r(C<->T){all}   0.156353    0.018470    0.000049    0.435127    0.117947    175.13    201.90    1.015
r(G<->T){all}   0.170354    0.020406    0.000085    0.460001    0.135683    209.91    269.95    1.001
pi(A){all}      0.256115    0.000628    0.208723    0.307644    0.255011   1140.96   1231.89    1.000
pi(C){all}      0.266936    0.000635    0.217559    0.315424    0.266463   1184.57   1238.71    1.000
pi(G){all}      0.266465    0.000661    0.215753    0.316809    0.266090   1320.34   1342.95    1.000
pi(T){all}      0.210484    0.000558    0.165585    0.257112    0.209314   1071.33   1128.97    1.000
alpha{1,2}      0.418777    0.224414    0.000281    1.404044    0.249937   1019.83   1156.00    1.000
alpha{3}        0.450721    0.230578    0.000365    1.464957    0.296121   1020.72   1115.91    1.000
pinvar{all}     0.994617    0.000041    0.981693    0.999999    0.996660   1286.24   1314.89    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-390.639687
Model 2: PositiveSelection	-390.639637
Model 0: one-ratio	-390.639692
Model 7: beta	-390.639717
Model 8: beta&w>1	-390.639598


Model 0 vs 1	1.0000000088439265E-5

Model 2 vs 1	9.999999997489795E-5

Model 8 vs 7	2.380000000812288E-4
>C1
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C2
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C3
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C4
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C5
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C6
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100 

C1              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C2              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C3              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C4              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C5              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C6              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
                **************************************************

C1              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C2              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C3              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C4              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C5              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C6              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
                **************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3000]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3000]--->[3000]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C2              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C3              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C4              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C5              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
C6              MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
                **************************************************

C1              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C2              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C3              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C4              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C5              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
C6              SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA
                **************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C2              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C3              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C4              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C5              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
C6              ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
                **************************************************

C1              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C2              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C3              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C4              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C5              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
C6              GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
                **************************************************

C1              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C2              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C3              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C4              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C5              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
C6              ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
                **************************************************

C1              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C2              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C3              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C4              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C5              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
C6              TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
                **************************************************

C1              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C2              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C3              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C4              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C5              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
C6              GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
                **************************************************

C1              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C2              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C3              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C4              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C5              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
C6              TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
                **************************************************



>C1
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C2
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C3
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C4
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C5
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C6
ATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTC
GGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGC
ATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTC
TCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAA
GCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCG
TCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACCAGCT
>C1
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C2
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C3
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C4
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C5
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA

>C6
MATIADSRDIILAPVISEKSYGLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTSNRKGKCKRTRTGFGRRKNTKRAIVTLAPGSKSIDLFGTPA



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 300 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790899
      Setting output file names to "/data/11res/rplW/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1006042561
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0522985363
      Seed = 824132891
      Swapseed = 1579790899
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -671.414345 -- -24.965149
         Chain 2 -- -671.414281 -- -24.965149
         Chain 3 -- -671.414384 -- -24.965149
         Chain 4 -- -671.414345 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -671.414345 -- -24.965149
         Chain 2 -- -671.414345 -- -24.965149
         Chain 3 -- -671.414384 -- -24.965149
         Chain 4 -- -671.414384 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-671.414] (-671.414) (-671.414) (-671.414) * [-671.414] (-671.414) (-671.414) (-671.414) 
        500 -- [-427.527] (-424.619) (-426.962) (-424.221) * (-424.114) (-427.836) (-421.259) [-423.143] -- 0:00:00
       1000 -- (-427.976) (-431.628) [-426.996] (-428.020) * (-431.520) (-424.321) (-425.415) [-425.854] -- 0:00:00
       1500 -- (-424.209) (-426.386) (-423.527) [-425.490] * (-425.136) [-423.907] (-426.394) (-428.037) -- 0:00:00
       2000 -- [-424.064] (-423.994) (-423.217) (-431.584) * (-426.600) (-430.391) (-421.154) [-426.203] -- 0:00:00
       2500 -- [-422.691] (-419.549) (-428.569) (-424.660) * (-421.222) (-423.495) (-425.605) [-428.967] -- 0:00:00
       3000 -- (-426.529) (-424.153) (-430.760) [-427.139] * (-431.820) [-432.181] (-434.932) (-428.529) -- 0:00:00
       3500 -- (-429.888) [-425.634] (-425.199) (-432.058) * (-426.609) (-425.448) (-437.692) [-425.170] -- 0:00:00
       4000 -- (-432.015) [-425.820] (-430.366) (-429.144) * [-420.849] (-428.772) (-429.521) (-428.417) -- 0:00:00
       4500 -- (-427.153) [-427.739] (-422.600) (-425.219) * (-428.845) [-429.268] (-424.494) (-431.036) -- 0:00:00
       5000 -- (-425.537) (-425.907) [-420.441] (-426.449) * (-427.102) [-424.813] (-429.555) (-423.441) -- 0:00:00

      Average standard deviation of split frequencies: 0.092852

       5500 -- [-431.888] (-426.910) (-424.076) (-424.994) * (-426.219) (-425.301) [-425.284] (-425.541) -- 0:00:00
       6000 -- (-424.125) [-426.960] (-426.837) (-425.120) * [-421.654] (-431.437) (-425.762) (-426.064) -- 0:00:00
       6500 -- (-424.869) [-424.390] (-421.357) (-429.791) * (-427.449) (-427.685) (-426.298) [-430.789] -- 0:00:00
       7000 -- (-425.528) [-422.709] (-424.019) (-430.541) * (-429.621) (-425.469) [-426.496] (-431.407) -- 0:00:00
       7500 -- [-433.408] (-425.788) (-430.811) (-427.312) * (-427.636) [-421.310] (-430.160) (-426.360) -- 0:00:00
       8000 -- (-425.905) [-427.185] (-424.131) (-417.820) * [-424.717] (-429.463) (-420.717) (-424.197) -- 0:00:00
       8500 -- (-437.610) (-429.843) [-425.381] (-416.696) * (-424.040) [-423.448] (-424.390) (-427.776) -- 0:00:00
       9000 -- (-430.489) (-429.013) (-423.401) [-416.058] * (-431.640) (-427.334) (-421.118) [-424.378] -- 0:00:00
       9500 -- (-433.632) (-424.318) (-428.745) [-416.941] * (-422.742) (-430.140) [-425.619] (-426.207) -- 0:01:44
      10000 -- (-437.270) (-422.226) [-423.801] (-415.864) * (-438.060) (-425.694) (-425.794) [-416.009] -- 0:01:39

      Average standard deviation of split frequencies: 0.077340

      10500 -- (-436.680) (-429.870) [-426.770] (-415.882) * (-428.317) (-426.935) (-422.134) [-415.427] -- 0:01:34
      11000 -- (-425.498) [-422.307] (-425.756) (-415.894) * (-430.045) (-425.284) (-430.080) [-418.541] -- 0:01:29
      11500 -- (-433.906) (-426.404) (-429.855) [-415.460] * (-422.542) (-426.669) (-441.137) [-418.104] -- 0:01:25
      12000 -- (-424.571) [-425.537] (-431.142) (-415.826) * (-425.021) (-424.414) [-425.346] (-416.589) -- 0:01:22
      12500 -- [-421.141] (-425.615) (-430.644) (-416.382) * (-425.535) (-428.276) (-430.234) [-416.028] -- 0:01:19
      13000 -- (-425.796) [-422.760] (-425.108) (-426.204) * [-431.340] (-421.755) (-422.035) (-416.605) -- 0:01:15
      13500 -- (-429.284) (-423.841) (-423.867) [-421.570] * (-421.224) [-420.712] (-427.953) (-418.609) -- 0:01:13
      14000 -- (-433.167) (-427.089) (-424.662) [-415.532] * (-422.545) [-428.189] (-425.060) (-417.175) -- 0:01:10
      14500 -- (-433.469) (-432.397) (-428.903) [-418.438] * [-424.922] (-423.696) (-420.554) (-416.277) -- 0:01:07
      15000 -- [-415.792] (-437.119) (-431.204) (-416.322) * (-426.526) (-428.480) [-421.956] (-417.047) -- 0:01:05

      Average standard deviation of split frequencies: 0.072184

      15500 -- (-415.413) [-420.438] (-445.351) (-416.537) * (-425.629) (-429.541) (-424.957) [-415.609] -- 0:01:03
      16000 -- [-415.887] (-423.686) (-429.775) (-417.634) * (-429.283) (-421.255) (-435.386) [-417.190] -- 0:01:01
      16500 -- [-416.211] (-423.955) (-421.173) (-417.739) * (-427.918) [-422.067] (-428.468) (-415.945) -- 0:00:59
      17000 -- (-416.781) [-426.576] (-423.361) (-416.563) * (-429.054) (-423.194) (-416.294) [-417.710] -- 0:00:57
      17500 -- (-418.927) [-418.709] (-419.982) (-414.952) * (-436.882) [-425.005] (-415.700) (-417.764) -- 0:00:56
      18000 -- (-418.230) (-416.685) (-419.017) [-416.863] * [-419.320] (-426.872) (-416.774) (-417.111) -- 0:00:54
      18500 -- [-422.102] (-421.084) (-416.677) (-415.837) * [-416.220] (-421.213) (-415.526) (-417.050) -- 0:00:53
      19000 -- [-415.364] (-416.442) (-415.861) (-416.925) * (-415.527) (-429.243) [-416.863] (-418.201) -- 0:00:51
      19500 -- (-415.408) [-415.088] (-416.242) (-418.207) * (-416.336) [-427.015] (-415.120) (-416.797) -- 0:00:50
      20000 -- (-415.599) (-420.369) (-416.374) [-420.054] * (-416.035) (-429.988) [-416.085] (-419.532) -- 0:00:49

      Average standard deviation of split frequencies: 0.060026

      20500 -- [-416.855] (-416.946) (-419.383) (-416.078) * [-417.332] (-428.540) (-415.740) (-417.223) -- 0:00:47
      21000 -- [-417.624] (-417.235) (-417.529) (-415.794) * (-417.797) (-429.317) [-416.083] (-415.671) -- 0:00:46
      21500 -- (-425.732) [-416.473] (-417.945) (-417.287) * (-417.287) (-424.022) (-417.860) [-415.503] -- 0:00:45
      22000 -- (-417.565) [-417.596] (-419.607) (-418.788) * (-419.111) (-427.526) (-416.078) [-417.255] -- 0:00:44
      22500 -- (-416.677) [-419.131] (-421.400) (-421.357) * (-419.674) (-434.310) (-418.284) [-417.191] -- 0:00:43
      23000 -- (-417.407) [-419.533] (-417.886) (-415.812) * (-419.625) [-425.002] (-415.954) (-415.581) -- 0:00:42
      23500 -- (-416.730) (-415.526) (-415.218) [-417.118] * (-417.058) (-423.630) (-414.897) [-419.181] -- 0:00:41
      24000 -- [-416.139] (-415.622) (-415.368) (-419.542) * (-417.812) (-432.387) [-416.810] (-417.346) -- 0:00:40
      24500 -- [-416.975] (-415.624) (-417.570) (-416.602) * (-415.366) [-421.620] (-418.999) (-415.177) -- 0:00:39
      25000 -- (-415.952) (-416.573) [-416.724] (-417.066) * [-418.738] (-427.380) (-417.829) (-416.359) -- 0:00:39

      Average standard deviation of split frequencies: 0.043679

      25500 -- (-419.439) [-416.080] (-415.842) (-416.997) * (-415.578) (-426.996) (-415.809) [-417.515] -- 0:00:38
      26000 -- (-417.698) (-416.833) (-420.857) [-417.239] * (-419.242) [-414.796] (-418.322) (-416.556) -- 0:00:37
      26500 -- (-414.935) [-415.579] (-419.333) (-415.438) * (-417.155) (-417.472) [-415.710] (-416.061) -- 0:01:13
      27000 -- (-417.834) [-416.271] (-417.770) (-417.074) * (-419.391) (-415.462) (-417.090) [-418.752] -- 0:01:12
      27500 -- (-415.595) [-416.078] (-419.830) (-416.277) * (-416.651) [-417.462] (-415.767) (-423.003) -- 0:01:10
      28000 -- [-421.452] (-415.594) (-416.939) (-415.998) * (-416.170) (-418.894) [-416.144] (-421.100) -- 0:01:09
      28500 -- (-418.399) (-421.783) (-418.614) [-415.360] * (-415.760) [-417.868] (-416.406) (-417.943) -- 0:01:08
      29000 -- (-421.557) (-419.219) [-415.698] (-415.807) * [-416.046] (-422.231) (-416.012) (-415.451) -- 0:01:06
      29500 -- (-417.210) (-417.980) (-415.133) [-416.821] * [-415.424] (-415.876) (-415.286) (-416.942) -- 0:01:05
      30000 -- (-417.774) [-416.180] (-414.599) (-419.625) * (-415.494) (-417.089) (-415.864) [-417.778] -- 0:01:04

      Average standard deviation of split frequencies: 0.041724

      30500 -- (-414.671) (-416.094) (-420.302) [-417.707] * (-415.836) (-415.463) (-416.719) [-415.250] -- 0:01:03
      31000 -- (-417.681) (-416.092) (-416.556) [-418.452] * (-414.805) (-417.707) (-419.037) [-418.528] -- 0:01:02
      31500 -- [-414.885] (-422.881) (-416.503) (-415.790) * [-414.722] (-420.826) (-417.783) (-416.909) -- 0:01:01
      32000 -- [-416.433] (-417.887) (-416.899) (-416.331) * (-416.315) [-414.705] (-419.616) (-417.865) -- 0:01:00
      32500 -- [-417.284] (-418.498) (-417.677) (-419.018) * (-415.543) [-420.815] (-417.317) (-415.980) -- 0:00:59
      33000 -- (-417.636) [-414.827] (-417.621) (-417.740) * [-414.902] (-416.822) (-416.860) (-419.405) -- 0:00:58
      33500 -- (-418.198) [-416.843] (-418.555) (-416.208) * (-417.362) [-417.225] (-420.031) (-416.087) -- 0:00:57
      34000 -- (-416.418) [-416.709] (-417.660) (-415.380) * (-417.063) (-425.036) (-418.064) [-415.696] -- 0:00:56
      34500 -- (-422.324) (-418.011) (-415.819) [-416.944] * [-417.134] (-418.897) (-416.327) (-416.517) -- 0:00:55
      35000 -- (-416.329) [-415.568] (-416.855) (-416.944) * (-418.231) (-418.800) (-417.537) [-416.868] -- 0:00:55

      Average standard deviation of split frequencies: 0.039879

      35500 -- (-415.431) (-416.547) [-417.076] (-418.833) * (-416.645) (-418.291) (-417.590) [-415.971] -- 0:00:54
      36000 -- (-416.546) (-415.330) [-418.148] (-416.581) * [-416.911] (-417.503) (-416.338) (-415.865) -- 0:00:53
      36500 -- (-415.220) (-416.648) (-416.052) [-418.875] * (-419.639) (-414.964) [-415.443] (-415.810) -- 0:00:52
      37000 -- [-415.616] (-417.895) (-416.347) (-422.247) * [-415.947] (-416.479) (-417.220) (-416.685) -- 0:00:52
      37500 -- [-418.796] (-419.365) (-414.709) (-418.184) * [-416.992] (-417.193) (-415.713) (-417.610) -- 0:00:51
      38000 -- (-418.823) [-414.716] (-415.955) (-419.759) * [-415.831] (-419.585) (-415.179) (-418.137) -- 0:00:50
      38500 -- (-416.329) (-414.839) (-418.541) [-416.817] * (-417.498) (-426.485) [-418.534] (-415.181) -- 0:00:49
      39000 -- [-415.385] (-415.604) (-417.400) (-416.167) * [-415.468] (-417.240) (-416.461) (-417.266) -- 0:00:49
      39500 -- (-416.492) [-415.994] (-415.331) (-418.132) * (-420.064) (-415.994) (-415.829) [-415.520] -- 0:00:48
      40000 -- (-415.338) [-418.354] (-416.723) (-418.572) * [-416.077] (-416.347) (-415.513) (-416.780) -- 0:00:48

      Average standard deviation of split frequencies: 0.043056

      40500 -- (-417.029) [-417.205] (-418.320) (-416.836) * (-417.984) [-416.951] (-421.209) (-417.983) -- 0:00:47
      41000 -- (-416.404) [-417.117] (-417.724) (-420.875) * (-416.008) (-418.361) (-417.999) [-416.832] -- 0:00:46
      41500 -- (-416.226) (-418.615) (-419.673) [-417.634] * (-415.994) (-416.237) [-418.944] (-417.530) -- 0:00:46
      42000 -- (-415.406) (-417.425) [-415.887] (-415.790) * (-420.151) (-416.668) (-416.962) [-418.885] -- 0:00:45
      42500 -- (-416.301) [-416.978] (-419.323) (-416.814) * (-416.383) (-417.884) (-414.795) [-414.856] -- 0:00:45
      43000 -- (-416.595) [-418.552] (-418.229) (-418.919) * (-417.864) (-418.115) (-417.994) [-417.733] -- 0:00:44
      43500 -- (-418.256) [-416.629] (-421.712) (-416.259) * (-416.897) [-418.305] (-416.331) (-416.417) -- 0:00:43
      44000 -- (-416.487) (-416.901) [-416.223] (-415.408) * (-416.918) [-417.673] (-416.331) (-415.891) -- 0:01:05
      44500 -- (-420.949) (-416.722) [-416.425] (-418.227) * (-420.860) (-416.100) [-417.917] (-418.672) -- 0:01:04
      45000 -- (-417.017) [-417.151] (-415.391) (-418.726) * (-418.035) [-418.326] (-415.968) (-421.307) -- 0:01:03

      Average standard deviation of split frequencies: 0.038552

      45500 -- (-420.436) [-415.753] (-416.863) (-415.665) * (-417.358) [-416.287] (-416.190) (-419.967) -- 0:01:02
      46000 -- (-417.118) (-421.120) (-416.112) [-415.811] * (-420.749) [-415.270] (-416.976) (-418.581) -- 0:01:02
      46500 -- (-417.614) [-416.364] (-417.546) (-416.420) * (-417.685) [-418.899] (-416.290) (-417.642) -- 0:01:01
      47000 -- (-415.264) (-416.564) (-418.021) [-415.893] * (-415.941) (-415.571) [-420.565] (-416.985) -- 0:01:00
      47500 -- (-418.216) [-415.476] (-416.948) (-417.604) * (-415.913) (-416.295) (-417.804) [-418.727] -- 0:01:00
      48000 -- (-417.663) [-415.455] (-419.766) (-416.473) * [-416.989] (-416.750) (-419.013) (-418.978) -- 0:00:59
      48500 -- (-415.406) (-417.115) (-416.636) [-418.131] * (-417.207) (-416.563) (-419.891) [-418.688] -- 0:00:58
      49000 -- (-417.070) (-416.939) (-418.451) [-416.514] * (-417.967) (-419.816) [-418.788] (-416.093) -- 0:00:58
      49500 -- [-420.013] (-416.730) (-417.267) (-416.522) * (-418.541) [-416.549] (-416.234) (-416.799) -- 0:00:57
      50000 -- (-418.450) (-416.431) (-417.621) [-415.431] * (-416.642) (-417.655) (-416.900) [-415.198] -- 0:00:57

      Average standard deviation of split frequencies: 0.028355

      50500 -- [-415.592] (-417.665) (-416.326) (-416.000) * (-416.386) (-417.603) (-418.868) [-416.485] -- 0:00:56
      51000 -- (-417.419) [-417.843] (-416.104) (-415.024) * (-418.117) [-419.062] (-416.614) (-416.025) -- 0:00:55
      51500 -- (-416.048) (-417.576) [-415.558] (-414.642) * (-419.901) (-419.115) [-417.208] (-418.403) -- 0:00:55
      52000 -- (-418.562) [-419.903] (-416.203) (-415.281) * (-420.288) (-416.310) (-415.797) [-415.240] -- 0:00:54
      52500 -- (-425.355) (-420.238) (-417.296) [-416.903] * (-417.444) [-419.443] (-416.269) (-420.123) -- 0:00:54
      53000 -- (-422.027) (-417.236) [-415.801] (-422.921) * (-417.382) (-415.423) [-417.759] (-418.786) -- 0:00:53
      53500 -- (-416.119) (-415.590) (-414.859) [-421.473] * (-417.040) (-416.879) (-415.385) [-415.187] -- 0:00:53
      54000 -- [-417.046] (-418.626) (-415.780) (-421.881) * [-415.457] (-416.226) (-416.911) (-420.460) -- 0:00:52
      54500 -- (-415.052) [-415.319] (-416.464) (-415.321) * [-414.830] (-419.995) (-418.845) (-418.494) -- 0:00:52
      55000 -- [-414.875] (-416.305) (-415.991) (-415.686) * (-418.030) [-415.853] (-416.120) (-418.962) -- 0:00:51

      Average standard deviation of split frequencies: 0.029884

      55500 -- [-415.678] (-417.302) (-420.523) (-416.409) * [-416.859] (-414.881) (-416.462) (-416.299) -- 0:00:51
      56000 -- (-416.118) (-416.144) (-418.685) [-416.834] * [-415.262] (-414.810) (-420.363) (-416.571) -- 0:00:50
      56500 -- [-417.975] (-416.035) (-417.033) (-416.574) * (-416.180) (-416.592) (-421.388) [-416.344] -- 0:00:50
      57000 -- (-420.054) (-420.293) [-418.827] (-415.631) * (-418.795) (-419.078) [-418.036] (-418.780) -- 0:00:49
      57500 -- (-418.127) [-415.211] (-415.072) (-415.785) * (-417.759) (-417.435) (-418.660) [-415.734] -- 0:00:49
      58000 -- [-417.860] (-417.480) (-418.001) (-417.257) * (-418.238) (-415.889) [-416.152] (-416.058) -- 0:00:48
      58500 -- [-417.643] (-420.761) (-416.885) (-416.508) * (-415.251) (-416.243) [-419.246] (-419.004) -- 0:00:48
      59000 -- (-417.400) (-415.263) (-422.574) [-415.770] * (-417.879) [-417.367] (-416.092) (-415.764) -- 0:00:47
      59500 -- (-415.629) (-414.830) [-418.429] (-419.190) * (-416.689) (-418.210) (-415.951) [-416.869] -- 0:00:47
      60000 -- [-417.939] (-414.906) (-415.573) (-415.525) * (-418.488) [-416.430] (-416.989) (-417.335) -- 0:00:47

      Average standard deviation of split frequencies: 0.028862

      60500 -- [-417.999] (-415.802) (-416.338) (-417.039) * [-417.416] (-415.017) (-417.378) (-415.929) -- 0:01:02
      61000 -- (-416.223) [-418.239] (-416.931) (-416.013) * [-417.118] (-414.996) (-417.206) (-416.028) -- 0:01:01
      61500 -- [-416.718] (-417.510) (-417.943) (-417.214) * (-416.408) (-416.195) [-415.751] (-417.275) -- 0:01:01
      62000 -- (-415.548) [-417.087] (-416.612) (-418.634) * (-416.201) [-416.735] (-416.367) (-417.106) -- 0:01:00
      62500 -- (-419.423) (-416.628) [-414.985] (-417.678) * (-416.261) (-416.833) [-415.704] (-415.316) -- 0:01:00
      63000 -- (-419.006) [-417.644] (-417.667) (-416.783) * [-416.151] (-419.733) (-419.225) (-415.789) -- 0:00:59
      63500 -- (-418.337) (-415.464) (-415.990) [-415.466] * (-418.275) (-420.821) (-419.193) [-416.035] -- 0:00:58
      64000 -- [-416.838] (-415.250) (-415.989) (-415.829) * (-417.915) [-418.349] (-416.383) (-422.318) -- 0:00:58
      64500 -- [-415.294] (-416.089) (-416.672) (-418.912) * (-426.184) (-416.850) (-415.626) [-418.112] -- 0:00:58
      65000 -- (-415.436) (-415.130) [-420.603] (-418.477) * (-419.177) (-417.512) (-417.879) [-416.131] -- 0:00:57

      Average standard deviation of split frequencies: 0.023601

      65500 -- (-417.639) (-416.400) (-416.775) [-416.661] * (-414.920) [-416.074] (-414.809) (-420.006) -- 0:00:57
      66000 -- (-416.847) (-416.197) (-416.979) [-415.022] * (-420.556) (-416.665) (-415.394) [-417.526] -- 0:00:56
      66500 -- [-415.713] (-416.135) (-421.095) (-418.736) * (-415.852) (-416.626) (-416.545) [-418.221] -- 0:00:56
      67000 -- (-415.676) (-416.393) (-419.221) [-419.493] * (-416.298) (-416.568) [-414.632] (-416.927) -- 0:00:55
      67500 -- [-418.500] (-417.016) (-418.323) (-418.132) * (-418.121) [-417.792] (-414.766) (-415.458) -- 0:00:55
      68000 -- (-418.686) [-416.262] (-420.123) (-416.831) * [-415.676] (-420.910) (-417.590) (-416.420) -- 0:00:54
      68500 -- (-417.064) (-415.232) (-417.370) [-418.434] * [-417.815] (-420.688) (-416.361) (-416.613) -- 0:00:54
      69000 -- (-421.054) (-418.262) (-416.103) [-417.005] * [-416.228] (-418.274) (-415.666) (-417.074) -- 0:00:53
      69500 -- [-420.065] (-415.519) (-416.532) (-417.952) * [-418.690] (-416.501) (-417.278) (-416.763) -- 0:00:53
      70000 -- (-418.371) [-420.437] (-415.968) (-416.106) * (-418.368) (-417.800) (-418.943) [-417.566] -- 0:00:53

      Average standard deviation of split frequencies: 0.022821

      70500 -- (-420.138) (-416.879) (-415.448) [-416.838] * (-417.345) (-417.917) [-416.908] (-420.622) -- 0:00:52
      71000 -- [-416.079] (-420.337) (-417.024) (-416.566) * [-417.521] (-416.682) (-417.861) (-416.432) -- 0:00:52
      71500 -- [-417.414] (-420.606) (-416.166) (-415.173) * [-416.533] (-418.627) (-418.990) (-418.263) -- 0:00:51
      72000 -- (-418.647) [-416.624] (-415.539) (-415.180) * (-417.119) (-419.781) (-416.827) [-416.866] -- 0:00:51
      72500 -- [-415.249] (-416.275) (-414.918) (-415.651) * [-416.771] (-418.928) (-415.623) (-417.635) -- 0:00:51
      73000 -- [-415.652] (-416.878) (-416.856) (-415.816) * [-415.974] (-416.268) (-417.197) (-415.811) -- 0:00:50
      73500 -- [-418.145] (-416.948) (-417.108) (-416.716) * (-415.450) (-418.055) [-418.762] (-415.667) -- 0:00:50
      74000 -- (-417.152) [-415.765] (-415.754) (-416.559) * (-416.225) (-417.411) (-416.951) [-415.575] -- 0:00:50
      74500 -- [-416.553] (-417.646) (-417.260) (-415.341) * [-414.993] (-416.951) (-425.834) (-419.384) -- 0:00:49
      75000 -- (-417.593) (-415.559) [-416.355] (-416.601) * (-417.859) [-416.469] (-417.849) (-418.669) -- 0:00:49

      Average standard deviation of split frequencies: 0.029773

      75500 -- [-414.791] (-417.340) (-416.785) (-416.232) * (-421.096) (-416.991) [-417.343] (-416.402) -- 0:00:48
      76000 -- (-416.873) (-416.178) (-416.301) [-415.145] * (-416.310) (-417.718) [-416.385] (-416.584) -- 0:00:48
      76500 -- (-414.996) (-417.449) [-415.875] (-418.349) * (-415.338) [-415.850] (-419.633) (-416.047) -- 0:00:48
      77000 -- [-416.128] (-417.018) (-417.723) (-416.568) * [-416.408] (-419.512) (-415.819) (-416.869) -- 0:00:47
      77500 -- (-414.834) (-416.709) (-418.881) [-416.103] * (-418.401) [-414.926] (-417.254) (-418.004) -- 0:00:47
      78000 -- (-417.577) (-419.518) (-419.021) [-415.628] * (-418.140) (-415.374) (-418.284) [-420.019] -- 0:00:59
      78500 -- (-416.882) [-418.323] (-419.611) (-415.156) * (-416.530) (-416.713) [-418.230] (-421.008) -- 0:00:58
      79000 -- (-417.462) (-416.472) [-418.025] (-423.632) * (-419.038) [-416.166] (-417.673) (-417.848) -- 0:00:58
      79500 -- (-417.322) [-416.030] (-419.080) (-420.905) * (-416.397) [-415.776] (-416.161) (-417.507) -- 0:00:57
      80000 -- [-417.076] (-415.638) (-415.280) (-420.482) * [-414.668] (-417.963) (-418.700) (-417.612) -- 0:00:57

      Average standard deviation of split frequencies: 0.032559

      80500 -- (-418.883) [-415.691] (-415.802) (-416.082) * (-415.688) [-415.945] (-416.519) (-419.978) -- 0:00:57
      81000 -- (-416.146) (-416.432) (-416.869) [-416.369] * (-418.116) [-416.096] (-417.456) (-418.335) -- 0:00:56
      81500 -- (-417.480) (-415.510) [-416.226] (-419.502) * (-417.407) [-415.830] (-419.212) (-416.547) -- 0:00:56
      82000 -- (-416.643) (-417.905) (-415.291) [-417.941] * [-424.610] (-417.654) (-416.791) (-415.748) -- 0:00:55
      82500 -- (-416.892) (-414.954) (-417.780) [-415.879] * (-415.902) (-419.292) (-415.392) [-417.132] -- 0:00:55
      83000 -- (-415.336) [-416.855] (-415.753) (-415.298) * [-415.105] (-421.183) (-414.942) (-422.586) -- 0:00:55
      83500 -- (-417.311) [-418.594] (-416.754) (-414.797) * (-415.589) (-415.525) (-419.268) [-419.284] -- 0:00:54
      84000 -- [-415.468] (-418.599) (-417.004) (-416.981) * (-418.317) (-418.464) [-416.692] (-415.975) -- 0:00:54
      84500 -- [-417.698] (-417.821) (-418.233) (-416.153) * (-415.210) (-415.451) (-416.167) [-414.819] -- 0:00:54
      85000 -- (-421.190) (-416.167) (-419.823) [-418.031] * [-418.188] (-416.364) (-418.201) (-418.829) -- 0:00:53

      Average standard deviation of split frequencies: 0.030982

      85500 -- [-416.630] (-414.683) (-416.066) (-416.525) * (-416.330) (-418.621) [-417.631] (-416.736) -- 0:00:53
      86000 -- (-417.646) (-415.402) [-415.079] (-417.096) * (-420.730) (-415.580) [-416.051] (-419.951) -- 0:00:53
      86500 -- (-417.604) (-430.048) (-415.205) [-415.554] * (-419.660) [-415.617] (-420.984) (-416.363) -- 0:00:52
      87000 -- [-417.706] (-419.348) (-416.015) (-415.429) * (-420.109) [-416.674] (-418.009) (-417.717) -- 0:00:52
      87500 -- (-417.861) (-417.093) (-415.654) [-415.050] * (-418.651) (-417.550) [-417.594] (-418.939) -- 0:00:52
      88000 -- (-416.806) (-420.057) (-415.860) [-416.413] * [-415.113] (-417.169) (-417.812) (-419.576) -- 0:00:51
      88500 -- [-417.095] (-416.742) (-416.019) (-415.799) * (-415.081) (-419.128) [-416.317] (-418.055) -- 0:00:51
      89000 -- (-417.201) [-416.910] (-414.712) (-417.752) * (-416.547) (-419.848) [-416.801] (-417.451) -- 0:00:51
      89500 -- [-417.188] (-416.759) (-419.009) (-416.526) * (-416.476) [-421.792] (-416.692) (-417.464) -- 0:00:50
      90000 -- (-421.081) (-418.151) [-415.757] (-416.371) * (-416.058) [-419.128] (-417.632) (-420.278) -- 0:00:50

      Average standard deviation of split frequencies: 0.029613

      90500 -- (-417.783) (-419.854) (-422.303) [-415.169] * (-415.558) [-421.841] (-417.501) (-416.696) -- 0:00:50
      91000 -- (-417.074) (-416.250) (-420.504) [-416.406] * (-418.254) (-417.263) [-414.994] (-415.393) -- 0:00:49
      91500 -- (-417.664) (-415.987) (-425.261) [-415.072] * (-418.843) (-417.112) [-420.240] (-416.594) -- 0:00:49
      92000 -- (-415.756) (-420.474) (-416.286) [-416.949] * [-415.731] (-418.530) (-421.007) (-418.668) -- 0:00:49
      92500 -- (-417.525) (-418.624) [-416.716] (-416.495) * (-416.781) (-417.118) (-420.522) [-416.890] -- 0:00:49
      93000 -- (-419.760) (-414.688) (-416.849) [-418.894] * (-415.441) (-418.427) (-416.537) [-417.020] -- 0:00:48
      93500 -- (-416.391) (-419.001) [-416.394] (-415.265) * (-418.399) (-422.124) (-416.097) [-415.984] -- 0:00:58
      94000 -- (-416.247) (-418.754) (-416.117) [-416.609] * (-415.517) [-418.803] (-418.499) (-415.606) -- 0:00:57
      94500 -- (-421.568) [-416.718] (-416.065) (-417.671) * (-417.707) (-419.645) (-417.179) [-414.978] -- 0:00:57
      95000 -- (-424.283) [-415.045] (-420.170) (-416.872) * [-415.596] (-420.245) (-417.941) (-417.093) -- 0:00:57

      Average standard deviation of split frequencies: 0.026657

      95500 -- (-416.241) (-417.943) [-415.631] (-415.984) * (-419.774) [-420.457] (-416.568) (-417.205) -- 0:00:56
      96000 -- (-417.989) (-417.258) (-419.680) [-416.001] * [-415.720] (-416.086) (-416.731) (-417.415) -- 0:00:56
      96500 -- [-417.891] (-417.832) (-420.249) (-419.096) * (-420.586) (-418.251) (-418.209) [-415.258] -- 0:00:56
      97000 -- (-415.644) [-415.403] (-420.491) (-421.013) * (-420.478) (-419.550) [-420.342] (-416.605) -- 0:00:55
      97500 -- [-415.229] (-415.458) (-416.477) (-417.630) * (-417.125) (-416.277) [-417.465] (-415.915) -- 0:00:55
      98000 -- (-416.977) (-415.246) (-418.607) [-417.046] * (-417.982) (-417.114) [-417.955] (-420.140) -- 0:00:55
      98500 -- (-416.164) (-416.144) [-416.814] (-415.040) * [-416.338] (-417.768) (-415.812) (-415.640) -- 0:00:54
      99000 -- [-414.974] (-416.419) (-419.824) (-417.177) * (-416.473) (-415.780) [-415.252] (-415.423) -- 0:00:54
      99500 -- (-418.408) [-418.017] (-417.475) (-421.167) * (-417.585) (-417.727) (-416.797) [-418.009] -- 0:00:54
      100000 -- (-418.270) (-416.703) [-415.166] (-417.664) * (-416.725) (-418.312) (-416.464) [-415.536] -- 0:00:54

      Average standard deviation of split frequencies: 0.029199

      100500 -- (-417.761) (-418.694) [-416.981] (-423.221) * (-416.857) [-415.555] (-415.945) (-417.085) -- 0:00:53
      101000 -- (-416.249) [-415.967] (-416.034) (-417.174) * (-417.776) (-415.608) [-417.209] (-416.269) -- 0:00:53
      101500 -- (-416.819) (-416.247) [-416.905] (-419.783) * (-415.862) (-416.415) (-415.983) [-415.628] -- 0:00:53
      102000 -- (-416.849) (-419.511) (-415.043) [-415.101] * [-417.530] (-416.025) (-418.007) (-417.609) -- 0:00:52
      102500 -- (-416.233) (-416.206) [-418.883] (-418.898) * (-416.596) (-415.620) [-421.485] (-426.062) -- 0:00:52
      103000 -- (-419.105) (-418.385) (-418.200) [-420.594] * (-416.023) (-417.061) (-417.666) [-419.406] -- 0:00:52
      103500 -- (-418.895) (-415.878) (-418.294) [-417.903] * [-416.211] (-423.321) (-417.866) (-417.456) -- 0:00:51
      104000 -- (-417.692) (-415.521) [-415.737] (-417.760) * (-415.275) [-415.131] (-415.326) (-417.447) -- 0:00:51
      104500 -- [-418.570] (-417.102) (-420.964) (-415.898) * (-417.816) [-415.756] (-415.384) (-418.907) -- 0:00:51
      105000 -- [-414.843] (-415.823) (-416.559) (-418.104) * [-416.661] (-418.170) (-415.899) (-420.161) -- 0:00:51

      Average standard deviation of split frequencies: 0.025413

      105500 -- [-417.508] (-416.403) (-416.494) (-416.730) * (-420.112) (-423.681) (-416.816) [-415.790] -- 0:00:50
      106000 -- (-416.202) (-419.000) [-418.164] (-418.819) * (-418.231) (-421.371) [-416.650] (-417.281) -- 0:00:50
      106500 -- [-416.511] (-416.739) (-416.944) (-417.805) * (-416.952) (-417.835) (-415.843) [-415.805] -- 0:00:50
      107000 -- (-417.322) (-419.101) [-418.702] (-415.150) * (-419.405) (-415.018) (-415.531) [-415.957] -- 0:00:50
      107500 -- (-417.067) (-417.227) [-417.065] (-415.341) * (-422.234) (-418.887) (-416.166) [-415.516] -- 0:00:49
      108000 -- (-422.935) (-415.709) (-416.460) [-415.833] * [-417.277] (-417.242) (-417.661) (-415.503) -- 0:00:49
      108500 -- (-416.681) (-416.412) [-417.676] (-417.652) * (-417.672) [-417.032] (-417.771) (-415.100) -- 0:00:49
      109000 -- [-419.055] (-416.191) (-416.878) (-415.104) * (-418.749) [-420.973] (-419.316) (-416.110) -- 0:00:57
      109500 -- (-417.972) [-417.436] (-416.311) (-420.339) * (-421.405) [-420.004] (-418.394) (-416.890) -- 0:00:56
      110000 -- (-420.495) [-418.308] (-415.598) (-418.866) * [-415.017] (-416.611) (-416.900) (-416.411) -- 0:00:56

      Average standard deviation of split frequencies: 0.028248

      110500 -- [-419.998] (-416.105) (-418.661) (-416.004) * [-417.167] (-416.082) (-418.578) (-415.415) -- 0:00:56
      111000 -- (-418.893) (-417.300) (-418.231) [-418.177] * (-417.215) (-420.558) [-416.620] (-417.931) -- 0:00:56
      111500 -- (-416.998) (-417.126) [-417.458] (-418.971) * (-420.823) (-418.558) [-418.415] (-417.720) -- 0:00:55
      112000 -- (-418.914) (-416.317) (-415.400) [-416.383] * (-418.826) [-417.916] (-415.626) (-415.051) -- 0:00:55
      112500 -- (-415.749) (-415.271) (-417.821) [-417.136] * (-418.106) [-415.388] (-415.874) (-415.137) -- 0:00:55
      113000 -- (-419.303) (-414.901) [-416.724] (-419.578) * (-421.693) (-416.404) [-417.321] (-415.888) -- 0:00:54
      113500 -- (-417.243) [-414.831] (-417.976) (-415.422) * [-415.494] (-417.325) (-418.557) (-415.869) -- 0:00:54
      114000 -- (-416.165) (-416.350) (-415.262) [-416.758] * [-415.320] (-420.424) (-416.337) (-415.440) -- 0:00:54
      114500 -- (-414.785) [-416.937] (-416.814) (-420.439) * (-416.292) (-415.478) (-417.047) [-417.269] -- 0:00:54
      115000 -- (-416.174) (-417.859) (-422.164) [-421.499] * (-415.879) (-417.488) [-417.276] (-416.186) -- 0:00:53

      Average standard deviation of split frequencies: 0.027995

      115500 -- (-418.337) (-421.985) [-416.504] (-422.046) * (-416.962) (-418.843) (-419.340) [-417.361] -- 0:00:53
      116000 -- [-415.479] (-419.116) (-415.676) (-415.793) * (-415.448) (-418.644) (-419.858) [-416.931] -- 0:00:53
      116500 -- [-415.016] (-419.147) (-416.384) (-418.630) * (-416.424) (-415.220) (-418.266) [-416.120] -- 0:00:53
      117000 -- (-415.751) (-421.867) (-416.070) [-415.377] * (-416.744) (-417.910) (-415.438) [-416.447] -- 0:00:52
      117500 -- (-415.195) [-416.514] (-418.927) (-416.130) * (-419.335) [-415.503] (-417.888) (-416.731) -- 0:00:52
      118000 -- (-417.945) (-417.735) (-418.074) [-415.699] * [-415.589] (-415.005) (-415.416) (-418.868) -- 0:00:52
      118500 -- [-416.574] (-423.961) (-418.701) (-418.748) * (-416.244) (-420.503) [-416.246] (-416.242) -- 0:00:52
      119000 -- (-416.607) (-419.049) (-415.665) [-415.547] * (-417.684) (-419.408) [-416.000] (-416.165) -- 0:00:51
      119500 -- (-418.603) [-417.546] (-416.295) (-416.401) * (-421.071) [-415.262] (-416.177) (-416.568) -- 0:00:51
      120000 -- (-418.901) (-416.607) [-416.849] (-416.144) * (-418.757) (-416.202) [-416.516] (-415.795) -- 0:00:51

      Average standard deviation of split frequencies: 0.025882

      120500 -- [-416.669] (-415.511) (-418.520) (-417.247) * (-419.473) (-417.920) [-415.002] (-415.817) -- 0:00:51
      121000 -- [-416.239] (-414.700) (-421.894) (-417.244) * [-416.837] (-417.436) (-416.393) (-417.464) -- 0:00:50
      121500 -- [-417.277] (-418.112) (-420.590) (-416.201) * [-421.050] (-416.540) (-417.203) (-416.472) -- 0:00:50
      122000 -- (-419.658) (-418.806) (-420.090) [-417.667] * (-419.812) (-417.494) [-416.780] (-418.944) -- 0:00:50
      122500 -- (-417.175) (-416.366) (-416.546) [-415.550] * [-420.071] (-418.216) (-417.216) (-418.079) -- 0:00:57
      123000 -- [-415.479] (-415.048) (-415.187) (-415.332) * [-417.978] (-417.164) (-416.968) (-418.053) -- 0:00:57
      123500 -- [-415.907] (-416.750) (-417.481) (-414.657) * (-415.443) [-419.166] (-415.478) (-416.636) -- 0:00:56
      124000 -- [-416.843] (-417.612) (-416.043) (-417.199) * (-422.474) (-416.691) [-414.810] (-416.794) -- 0:00:56
      124500 -- (-416.896) (-415.971) (-415.596) [-415.294] * [-418.559] (-419.909) (-420.797) (-415.247) -- 0:00:56
      125000 -- [-417.132] (-417.043) (-416.239) (-415.048) * (-416.384) (-416.623) [-417.041] (-415.033) -- 0:00:56

      Average standard deviation of split frequencies: 0.025150

      125500 -- [-415.994] (-414.737) (-416.921) (-417.543) * (-422.838) (-420.585) (-415.305) [-416.341] -- 0:00:55
      126000 -- [-417.569] (-419.212) (-418.106) (-416.540) * [-417.294] (-417.228) (-416.955) (-415.878) -- 0:00:55
      126500 -- (-418.483) [-417.380] (-415.248) (-421.343) * (-416.863) [-418.283] (-415.321) (-421.271) -- 0:00:55
      127000 -- (-416.669) (-415.873) [-417.821] (-417.580) * (-415.884) (-419.302) (-417.554) [-417.136] -- 0:00:54
      127500 -- (-419.576) [-415.750] (-420.913) (-418.196) * (-418.688) [-415.214] (-419.760) (-416.703) -- 0:00:54
      128000 -- (-415.516) [-415.299] (-418.268) (-417.250) * [-416.445] (-416.538) (-417.822) (-416.910) -- 0:00:54
      128500 -- (-422.981) (-415.917) (-416.738) [-416.444] * (-420.189) (-415.547) (-418.990) [-417.998] -- 0:00:54
      129000 -- (-417.227) (-418.405) (-415.422) [-415.909] * (-418.624) [-417.508] (-415.994) (-416.582) -- 0:00:54
      129500 -- (-416.654) [-416.737] (-419.626) (-415.179) * (-420.487) (-417.532) [-415.130] (-416.005) -- 0:00:53
      130000 -- (-422.138) (-417.040) (-416.305) [-418.265] * (-416.894) (-416.935) (-415.883) [-416.391] -- 0:00:53

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-416.727) (-416.881) [-415.146] (-416.026) * (-416.608) (-417.579) [-415.069] (-416.246) -- 0:00:53
      131000 -- (-415.773) [-417.328] (-417.864) (-416.509) * (-415.630) (-416.943) [-415.986] (-416.643) -- 0:00:53
      131500 -- (-418.775) [-416.963] (-416.172) (-416.258) * (-418.330) (-420.252) (-416.931) [-416.758] -- 0:00:52
      132000 -- (-415.530) [-415.966] (-415.997) (-416.667) * [-419.919] (-424.325) (-419.219) (-416.780) -- 0:00:52
      132500 -- [-416.176] (-415.872) (-418.793) (-416.749) * (-420.329) (-418.895) [-418.031] (-417.760) -- 0:00:52
      133000 -- (-416.273) (-420.010) (-417.731) [-417.044] * (-420.985) [-420.645] (-417.666) (-417.555) -- 0:00:52
      133500 -- (-415.090) (-417.566) [-418.859] (-418.885) * (-418.410) [-418.593] (-416.351) (-415.894) -- 0:00:51
      134000 -- (-416.789) (-415.542) [-416.052] (-417.154) * [-419.313] (-417.318) (-416.591) (-417.492) -- 0:00:51
      134500 -- (-417.914) (-416.139) (-418.933) [-417.468] * [-417.269] (-416.166) (-417.119) (-417.132) -- 0:00:51
      135000 -- (-417.150) (-416.538) [-416.052] (-418.362) * (-416.028) [-415.786] (-417.970) (-416.109) -- 0:00:51

      Average standard deviation of split frequencies: 0.023856

      135500 -- (-417.053) (-416.897) (-419.332) [-420.923] * [-417.869] (-420.186) (-417.364) (-418.404) -- 0:00:51
      136000 -- [-419.148] (-416.412) (-417.604) (-417.588) * [-415.062] (-417.936) (-416.832) (-415.228) -- 0:00:50
      136500 -- (-415.880) [-420.671] (-415.918) (-416.044) * (-415.129) (-418.792) [-416.648] (-420.936) -- 0:00:50
      137000 -- (-417.115) (-416.115) [-415.007] (-414.831) * [-419.288] (-418.997) (-418.616) (-417.016) -- 0:00:50
      137500 -- (-418.197) (-417.252) [-415.260] (-418.317) * (-416.900) [-418.826] (-416.731) (-418.166) -- 0:00:56
      138000 -- (-416.861) [-417.895] (-415.035) (-418.181) * [-414.811] (-418.334) (-416.385) (-419.689) -- 0:00:56
      138500 -- [-417.712] (-415.878) (-415.552) (-424.338) * (-416.447) (-418.491) [-415.967] (-421.714) -- 0:00:55
      139000 -- (-420.241) [-416.504] (-416.324) (-418.502) * [-417.442] (-415.369) (-415.588) (-415.852) -- 0:00:55
      139500 -- (-417.423) (-416.383) [-416.649] (-417.030) * (-417.374) [-418.016] (-415.807) (-416.492) -- 0:00:55
      140000 -- [-417.513] (-417.048) (-417.613) (-416.548) * (-416.295) [-416.257] (-418.144) (-417.193) -- 0:00:55

      Average standard deviation of split frequencies: 0.023459

      140500 -- (-421.834) (-418.944) (-416.956) [-419.046] * [-416.123] (-416.336) (-415.491) (-415.538) -- 0:00:55
      141000 -- [-416.652] (-416.885) (-421.278) (-417.504) * (-417.156) (-415.795) (-418.908) [-416.107] -- 0:00:54
      141500 -- (-415.183) (-415.490) (-416.717) [-422.417] * (-424.917) (-416.878) [-415.572] (-416.128) -- 0:00:54
      142000 -- (-416.338) (-419.083) (-415.554) [-415.310] * (-420.496) (-418.050) (-416.946) [-415.804] -- 0:00:54
      142500 -- (-415.462) [-416.158] (-417.823) (-416.097) * (-417.903) (-416.818) [-415.493] (-416.475) -- 0:00:54
      143000 -- (-417.297) (-419.392) (-415.327) [-415.203] * (-417.957) [-415.355] (-417.970) (-417.536) -- 0:00:53
      143500 -- (-415.512) [-416.370] (-417.576) (-417.490) * (-418.030) (-416.597) (-419.009) [-418.559] -- 0:00:53
      144000 -- [-415.315] (-416.498) (-416.376) (-417.227) * (-419.585) [-418.936] (-420.661) (-418.773) -- 0:00:53
      144500 -- (-416.772) (-417.264) [-415.765] (-419.027) * (-415.877) (-418.482) (-414.997) [-417.564] -- 0:00:53
      145000 -- [-418.160] (-416.745) (-415.138) (-420.125) * (-423.361) (-415.509) [-419.778] (-419.982) -- 0:00:53

      Average standard deviation of split frequencies: 0.022602

      145500 -- (-417.863) (-415.359) [-416.772] (-426.600) * (-416.620) (-416.464) (-416.651) [-418.928] -- 0:00:52
      146000 -- [-416.397] (-415.628) (-417.015) (-414.838) * [-416.347] (-418.346) (-418.276) (-418.412) -- 0:00:52
      146500 -- (-416.569) (-414.952) [-415.216] (-416.837) * (-417.243) (-416.137) (-416.787) [-416.229] -- 0:00:52
      147000 -- (-419.788) [-415.465] (-415.157) (-420.608) * [-417.558] (-416.944) (-419.917) (-416.242) -- 0:00:52
      147500 -- (-419.812) (-415.469) (-415.854) [-418.146] * (-419.627) (-416.045) (-418.133) [-419.407] -- 0:00:52
      148000 -- (-417.822) (-416.643) (-416.776) [-415.330] * (-416.774) (-417.375) [-419.886] (-417.033) -- 0:00:51
      148500 -- (-415.737) (-418.587) [-416.239] (-414.787) * (-417.851) (-416.164) [-417.070] (-417.538) -- 0:00:51
      149000 -- (-417.711) (-417.247) [-414.865] (-414.912) * (-417.724) (-416.304) [-416.625] (-415.995) -- 0:00:51
      149500 -- (-415.797) (-417.810) [-417.102] (-416.599) * (-418.390) [-417.236] (-416.533) (-415.445) -- 0:00:51
      150000 -- [-417.324] (-418.408) (-416.499) (-415.590) * (-418.773) [-419.593] (-417.609) (-420.441) -- 0:00:51

      Average standard deviation of split frequencies: 0.021380

      150500 -- [-416.101] (-417.552) (-417.663) (-415.316) * (-418.114) (-418.611) [-418.179] (-417.517) -- 0:00:50
      151000 -- (-417.811) (-415.125) [-418.193] (-416.131) * (-420.666) (-418.342) [-418.569] (-422.274) -- 0:00:50
      151500 -- (-415.609) (-417.192) [-416.842] (-417.099) * (-415.348) (-416.250) [-417.536] (-417.645) -- 0:00:50
      152000 -- [-418.591] (-415.774) (-418.205) (-416.226) * (-416.797) (-417.287) [-415.770] (-417.454) -- 0:00:50
      152500 -- (-419.403) (-417.345) [-415.255] (-417.219) * (-416.938) (-419.276) [-416.343] (-421.086) -- 0:00:50
      153000 -- [-415.983] (-417.586) (-415.304) (-419.740) * (-417.931) (-415.398) (-416.545) [-419.601] -- 0:00:49
      153500 -- (-417.373) (-415.789) [-418.419] (-415.602) * (-416.360) (-416.810) (-419.786) [-416.219] -- 0:00:49
      154000 -- (-418.987) (-414.890) (-416.527) [-414.843] * (-417.635) [-415.457] (-416.864) (-415.652) -- 0:00:54
      154500 -- (-418.043) [-417.100] (-416.575) (-417.044) * (-417.005) (-416.762) [-414.870] (-416.860) -- 0:00:54
      155000 -- (-416.210) (-417.882) (-415.606) [-417.418] * (-417.036) [-417.562] (-416.899) (-420.992) -- 0:00:54

      Average standard deviation of split frequencies: 0.019810

      155500 -- (-420.013) [-417.606] (-416.303) (-414.895) * (-419.968) (-416.481) [-419.855] (-416.639) -- 0:00:54
      156000 -- (-416.463) [-416.606] (-417.364) (-415.779) * [-419.695] (-416.435) (-421.964) (-416.301) -- 0:00:54
      156500 -- [-417.271] (-417.320) (-416.652) (-415.594) * [-420.191] (-417.329) (-416.437) (-415.721) -- 0:00:53
      157000 -- (-417.946) [-420.380] (-417.509) (-415.197) * (-417.770) (-416.288) [-417.715] (-418.038) -- 0:00:53
      157500 -- [-416.768] (-420.170) (-415.584) (-416.655) * (-415.353) (-417.825) (-418.491) [-416.015] -- 0:00:53
      158000 -- (-417.847) (-417.951) (-420.106) [-424.022] * [-416.824] (-416.674) (-417.749) (-416.288) -- 0:00:53
      158500 -- (-416.054) (-415.675) [-415.818] (-422.978) * (-417.316) (-421.316) [-416.028] (-417.730) -- 0:00:53
      159000 -- (-419.434) (-415.876) [-417.135] (-415.734) * [-417.764] (-418.185) (-423.564) (-416.533) -- 0:00:52
      159500 -- (-418.863) (-415.472) [-416.176] (-418.470) * [-414.780] (-420.382) (-419.920) (-416.492) -- 0:00:52
      160000 -- (-420.187) [-415.428] (-419.349) (-418.675) * (-416.209) (-416.413) [-417.425] (-417.255) -- 0:00:52

      Average standard deviation of split frequencies: 0.021919

      160500 -- (-423.666) [-417.337] (-416.875) (-421.660) * (-417.259) [-419.911] (-419.741) (-416.631) -- 0:00:52
      161000 -- (-416.541) [-416.578] (-416.028) (-418.266) * (-417.503) (-415.552) (-417.469) [-416.371] -- 0:00:52
      161500 -- (-416.712) (-416.131) (-417.248) [-421.833] * [-418.713] (-420.486) (-417.530) (-418.616) -- 0:00:51
      162000 -- [-417.135] (-420.553) (-416.806) (-416.675) * (-416.022) [-417.858] (-415.248) (-419.181) -- 0:00:51
      162500 -- (-417.914) (-416.030) [-416.743] (-416.729) * (-418.132) (-420.089) [-416.283] (-419.959) -- 0:00:51
      163000 -- (-416.666) (-417.004) (-418.244) [-418.476] * (-417.103) [-417.990] (-419.378) (-419.561) -- 0:00:51
      163500 -- (-419.753) (-415.725) (-419.248) [-422.730] * (-415.611) [-416.640] (-418.269) (-421.535) -- 0:00:51
      164000 -- (-415.900) (-416.324) [-419.843] (-417.369) * (-417.180) [-416.111] (-420.626) (-417.692) -- 0:00:50
      164500 -- (-415.834) [-415.592] (-417.005) (-418.372) * (-415.914) (-415.744) [-418.878] (-415.980) -- 0:00:50
      165000 -- (-419.194) [-417.407] (-415.977) (-415.698) * [-415.703] (-416.080) (-417.527) (-415.068) -- 0:00:50

      Average standard deviation of split frequencies: 0.019879

      165500 -- (-415.116) (-419.141) (-417.807) [-415.510] * [-415.130] (-416.710) (-417.043) (-415.524) -- 0:00:50
      166000 -- (-419.331) (-418.738) [-419.716] (-415.675) * (-415.078) [-417.248] (-417.649) (-417.535) -- 0:00:50
      166500 -- (-417.192) [-414.840] (-415.430) (-416.150) * (-418.423) (-417.392) [-415.291] (-418.523) -- 0:00:50
      167000 -- [-417.266] (-416.632) (-415.582) (-421.865) * (-418.405) [-418.590] (-416.214) (-415.538) -- 0:00:54
      167500 -- [-419.076] (-415.744) (-416.635) (-418.565) * (-416.745) (-416.448) (-414.769) [-415.174] -- 0:00:54
      168000 -- (-418.859) (-416.568) [-417.160] (-420.193) * (-418.777) (-417.565) [-417.702] (-414.642) -- 0:00:54
      168500 -- [-417.398] (-417.995) (-416.072) (-414.851) * (-422.800) (-416.875) [-415.546] (-415.554) -- 0:00:54
      169000 -- (-418.119) (-416.981) (-417.425) [-420.275] * (-419.141) (-417.609) (-415.752) [-419.128] -- 0:00:54
      169500 -- (-415.922) [-417.532] (-415.743) (-416.440) * (-416.971) [-415.948] (-419.413) (-417.033) -- 0:00:53
      170000 -- [-416.855] (-416.651) (-419.165) (-418.809) * [-417.165] (-420.649) (-416.753) (-415.472) -- 0:00:53

      Average standard deviation of split frequencies: 0.020797

      170500 -- (-416.977) (-419.204) [-417.032] (-418.319) * (-414.864) (-419.061) [-416.746] (-420.367) -- 0:00:53
      171000 -- (-420.942) [-416.935] (-417.927) (-415.383) * [-419.847] (-416.074) (-416.600) (-416.879) -- 0:00:53
      171500 -- [-416.526] (-416.969) (-419.082) (-415.279) * (-417.540) (-418.082) [-418.856] (-418.582) -- 0:00:53
      172000 -- (-415.926) [-415.889] (-417.630) (-417.021) * (-416.900) (-414.843) (-417.467) [-416.258] -- 0:00:52
      172500 -- [-415.881] (-417.469) (-417.868) (-419.375) * (-417.822) (-418.269) (-415.623) [-415.285] -- 0:00:52
      173000 -- (-416.923) [-417.554] (-416.056) (-417.534) * (-419.585) (-419.049) [-415.674] (-417.862) -- 0:00:52
      173500 -- (-417.515) (-417.699) [-418.851] (-415.511) * [-417.074] (-419.242) (-420.431) (-418.345) -- 0:00:52
      174000 -- (-417.140) (-416.362) [-421.337] (-415.832) * (-416.768) (-420.325) [-425.864] (-418.547) -- 0:00:52
      174500 -- (-419.660) (-418.763) [-415.509] (-417.183) * (-425.301) (-420.692) (-418.269) [-416.576] -- 0:00:52
      175000 -- (-415.389) (-417.239) (-417.894) [-416.212] * (-415.322) (-418.375) (-417.074) [-418.149] -- 0:00:51

      Average standard deviation of split frequencies: 0.018749

      175500 -- [-415.670] (-415.479) (-414.876) (-416.440) * [-415.395] (-418.813) (-416.336) (-416.064) -- 0:00:51
      176000 -- (-415.462) [-415.529] (-416.057) (-421.139) * [-421.018] (-415.496) (-415.794) (-417.057) -- 0:00:51
      176500 -- (-418.751) (-417.738) [-417.705] (-417.608) * (-418.751) (-416.336) (-419.182) [-417.038] -- 0:00:51
      177000 -- (-417.382) (-418.385) (-415.864) [-414.928] * (-416.571) (-418.804) [-415.847] (-414.995) -- 0:00:51
      177500 -- (-416.812) [-415.756] (-415.367) (-418.855) * (-420.712) (-415.969) [-418.485] (-417.946) -- 0:00:50
      178000 -- [-416.047] (-416.088) (-416.608) (-418.210) * (-414.984) (-418.425) (-416.742) [-423.235] -- 0:00:50
      178500 -- [-418.356] (-419.544) (-419.307) (-414.986) * [-415.508] (-417.299) (-414.940) (-422.060) -- 0:00:50
      179000 -- [-416.649] (-415.286) (-420.603) (-418.423) * [-420.749] (-422.038) (-417.081) (-417.142) -- 0:00:50
      179500 -- (-415.232) [-416.406] (-418.937) (-416.839) * [-418.415] (-416.247) (-416.343) (-415.397) -- 0:00:50
      180000 -- [-416.047] (-421.189) (-421.760) (-415.837) * (-424.172) (-415.256) (-415.894) [-414.997] -- 0:00:50

      Average standard deviation of split frequencies: 0.018265

      180500 -- [-415.338] (-420.016) (-418.099) (-419.844) * (-419.896) [-416.488] (-417.698) (-416.663) -- 0:00:49
      181000 -- (-415.222) (-422.053) [-417.456] (-418.336) * [-418.974] (-418.229) (-422.865) (-415.454) -- 0:00:54
      181500 -- [-414.931] (-417.545) (-418.257) (-416.750) * (-419.809) (-415.804) (-417.036) [-417.233] -- 0:00:54
      182000 -- (-414.954) (-418.903) [-418.709] (-416.942) * (-415.686) [-416.895] (-419.749) (-417.039) -- 0:00:53
      182500 -- (-418.217) (-417.713) (-416.342) [-416.908] * (-418.491) (-416.866) (-415.650) [-419.295] -- 0:00:53
      183000 -- (-415.352) (-419.862) (-415.419) [-421.002] * (-419.625) [-418.748] (-416.469) (-418.466) -- 0:00:53
      183500 -- (-416.941) (-418.180) [-415.318] (-416.820) * (-417.357) (-416.398) [-415.870] (-418.016) -- 0:00:53
      184000 -- [-416.289] (-416.125) (-417.562) (-416.796) * [-417.638] (-417.586) (-417.381) (-417.479) -- 0:00:53
      184500 -- (-415.042) [-419.015] (-417.770) (-416.111) * (-416.325) (-415.055) (-418.551) [-418.737] -- 0:00:53
      185000 -- [-417.250] (-421.706) (-418.321) (-417.936) * (-416.391) [-416.734] (-418.337) (-416.156) -- 0:00:52

      Average standard deviation of split frequencies: 0.018141

      185500 -- [-417.826] (-415.405) (-417.733) (-415.358) * (-416.437) [-416.288] (-417.066) (-417.134) -- 0:00:52
      186000 -- [-415.405] (-415.537) (-419.203) (-416.293) * (-415.893) (-417.355) (-415.750) [-416.789] -- 0:00:52
      186500 -- (-417.737) (-416.518) [-418.807] (-418.474) * [-417.419] (-422.649) (-416.385) (-416.490) -- 0:00:52
      187000 -- (-415.584) (-416.147) (-417.345) [-417.086] * [-415.627] (-416.964) (-418.135) (-418.933) -- 0:00:52
      187500 -- (-419.533) (-415.930) [-416.806] (-421.883) * (-416.837) (-420.116) [-416.009] (-418.924) -- 0:00:52
      188000 -- (-415.843) (-415.905) (-422.771) [-419.568] * [-417.662] (-419.867) (-419.300) (-416.397) -- 0:00:51
      188500 -- (-415.856) (-415.602) (-420.026) [-415.855] * (-421.241) (-418.234) (-418.826) [-416.543] -- 0:00:51
      189000 -- [-418.263] (-417.883) (-417.609) (-419.818) * (-418.336) (-416.006) (-422.873) [-415.353] -- 0:00:51
      189500 -- [-418.491] (-415.192) (-417.676) (-418.649) * (-415.966) (-416.403) [-420.646] (-416.237) -- 0:00:51
      190000 -- (-420.124) (-414.906) (-417.844) [-417.398] * (-416.487) (-416.455) (-420.370) [-417.266] -- 0:00:51

      Average standard deviation of split frequencies: 0.018088

      190500 -- (-421.643) (-418.218) [-417.141] (-415.675) * [-417.716] (-415.367) (-414.891) (-415.903) -- 0:00:50
      191000 -- [-415.981] (-419.350) (-417.729) (-415.550) * [-417.721] (-415.484) (-416.027) (-417.853) -- 0:00:50
      191500 -- (-417.804) (-418.084) [-416.485] (-416.616) * (-418.722) [-415.410] (-415.513) (-415.531) -- 0:00:50
      192000 -- (-416.271) (-416.338) [-417.591] (-416.841) * (-415.559) (-415.901) (-417.479) [-417.714] -- 0:00:50
      192500 -- [-417.934] (-418.112) (-415.891) (-416.191) * (-418.530) (-425.386) (-416.474) [-416.425] -- 0:00:50
      193000 -- (-416.823) (-420.006) [-417.473] (-417.099) * (-421.944) (-415.423) [-415.185] (-416.340) -- 0:00:50
      193500 -- (-416.491) (-417.707) (-418.393) [-415.590] * (-424.001) (-416.706) (-416.274) [-417.411] -- 0:00:50
      194000 -- [-418.292] (-415.447) (-415.676) (-417.233) * (-416.397) (-417.215) (-419.491) [-416.148] -- 0:00:49
      194500 -- (-416.194) [-416.314] (-415.193) (-418.015) * (-421.883) (-418.359) [-416.044] (-415.100) -- 0:00:49
      195000 -- (-416.306) [-417.501] (-417.778) (-417.545) * (-416.634) (-420.641) [-415.097] (-417.140) -- 0:00:49

      Average standard deviation of split frequencies: 0.018988

      195500 -- (-416.633) (-415.963) (-417.424) [-418.304] * (-415.619) (-416.777) [-415.417] (-417.162) -- 0:00:49
      196000 -- (-417.729) (-416.248) [-417.410] (-415.545) * [-414.792] (-416.135) (-419.071) (-417.803) -- 0:00:49
      196500 -- (-418.498) (-418.986) [-415.583] (-419.312) * (-420.126) [-415.979] (-420.732) (-415.272) -- 0:00:53
      197000 -- (-417.030) [-416.068] (-416.008) (-417.980) * [-420.037] (-418.237) (-416.458) (-416.630) -- 0:00:52
      197500 -- (-415.539) (-417.318) [-415.902] (-417.358) * [-416.319] (-419.577) (-415.632) (-419.498) -- 0:00:52
      198000 -- (-414.759) (-416.694) (-421.937) [-416.696] * [-417.666] (-416.782) (-416.888) (-419.385) -- 0:00:52
      198500 -- (-416.628) (-421.877) [-416.281] (-415.366) * (-416.391) [-418.643] (-417.625) (-418.489) -- 0:00:52
      199000 -- (-416.181) (-420.564) [-415.310] (-418.141) * (-418.998) (-417.589) [-417.660] (-421.189) -- 0:00:52
      199500 -- [-416.084] (-417.721) (-416.611) (-417.918) * (-418.241) (-418.915) (-417.164) [-417.077] -- 0:00:52
      200000 -- (-416.892) [-417.858] (-416.122) (-421.143) * (-417.229) (-418.866) (-418.059) [-416.948] -- 0:00:51

      Average standard deviation of split frequencies: 0.020277

      200500 -- (-418.070) [-418.086] (-416.866) (-415.128) * (-416.155) (-421.752) [-415.695] (-420.254) -- 0:00:51
      201000 -- [-416.986] (-417.012) (-419.800) (-416.040) * (-416.471) [-416.481] (-418.292) (-418.558) -- 0:00:51
      201500 -- (-423.290) (-419.585) [-417.944] (-416.990) * (-418.784) [-416.767] (-417.092) (-420.670) -- 0:00:51
      202000 -- [-423.609] (-418.270) (-420.591) (-416.624) * (-418.339) [-415.511] (-415.708) (-416.058) -- 0:00:51
      202500 -- (-417.424) (-418.665) [-418.973] (-416.152) * [-416.944] (-416.670) (-416.985) (-415.530) -- 0:00:51
      203000 -- [-416.522] (-419.574) (-417.213) (-415.719) * (-415.323) (-420.748) (-415.264) [-415.868] -- 0:00:51
      203500 -- [-418.892] (-417.063) (-420.527) (-417.515) * [-415.438] (-424.774) (-416.042) (-418.737) -- 0:00:50
      204000 -- (-418.415) (-420.101) [-416.463] (-420.087) * (-417.383) [-417.846] (-417.635) (-415.296) -- 0:00:50
      204500 -- (-417.021) (-419.133) (-415.540) [-417.911] * (-415.313) (-415.621) (-415.542) [-414.744] -- 0:00:50
      205000 -- (-420.754) (-417.249) [-415.239] (-416.587) * (-417.261) (-416.805) (-415.471) [-416.105] -- 0:00:50

      Average standard deviation of split frequencies: 0.019511

      205500 -- (-419.731) [-417.552] (-416.671) (-419.519) * (-416.902) [-415.406] (-416.510) (-417.346) -- 0:00:50
      206000 -- (-417.369) (-417.887) (-417.539) [-415.183] * (-417.319) [-417.369] (-417.405) (-417.227) -- 0:00:50
      206500 -- (-418.753) (-418.185) (-417.382) [-417.195] * [-418.273] (-416.282) (-416.804) (-415.765) -- 0:00:49
      207000 -- (-417.729) [-417.424] (-415.219) (-416.099) * (-417.939) (-417.303) [-416.565] (-416.825) -- 0:00:49
      207500 -- (-416.600) (-417.884) [-415.885] (-415.186) * [-416.491] (-415.749) (-419.333) (-417.766) -- 0:00:49
      208000 -- [-417.623] (-418.271) (-419.680) (-418.029) * [-416.156] (-420.000) (-416.524) (-417.569) -- 0:00:49
      208500 -- [-416.658] (-415.466) (-416.306) (-416.735) * (-418.790) (-416.486) [-415.614] (-415.977) -- 0:00:49
      209000 -- [-418.843] (-418.593) (-417.015) (-416.556) * (-417.243) [-416.350] (-417.751) (-418.818) -- 0:00:49
      209500 -- (-415.802) (-422.336) (-415.795) [-417.003] * (-418.463) (-414.954) [-417.081] (-416.389) -- 0:00:49
      210000 -- (-418.593) (-424.718) (-416.224) [-414.839] * [-417.777] (-415.250) (-420.303) (-417.460) -- 0:00:48

      Average standard deviation of split frequencies: 0.020512

      210500 -- (-419.293) [-423.624] (-418.121) (-421.923) * (-416.233) (-420.908) [-418.430] (-418.863) -- 0:00:48
      211000 -- (-416.933) [-418.894] (-419.407) (-417.519) * (-418.304) (-415.202) [-417.439] (-420.856) -- 0:00:48
      211500 -- (-421.395) (-418.738) (-418.663) [-416.608] * (-415.383) (-419.792) (-417.222) [-417.792] -- 0:00:48
      212000 -- (-417.919) (-417.713) (-419.179) [-418.509] * (-416.953) (-416.100) (-418.526) [-415.165] -- 0:00:48
      212500 -- (-417.304) (-417.531) [-416.288] (-416.265) * (-422.271) (-417.937) (-417.308) [-415.867] -- 0:00:48
      213000 -- [-415.396] (-417.490) (-417.762) (-415.350) * (-419.058) [-417.757] (-415.350) (-417.945) -- 0:00:48
      213500 -- (-416.074) [-416.226] (-418.639) (-419.184) * [-416.454] (-419.439) (-416.768) (-416.833) -- 0:00:51
      214000 -- (-415.533) (-416.270) (-418.616) [-416.409] * (-418.340) (-419.458) (-417.223) [-417.709] -- 0:00:51
      214500 -- (-418.633) (-416.629) [-417.822] (-416.543) * (-415.407) (-418.080) [-416.286] (-415.263) -- 0:00:51
      215000 -- [-417.506] (-416.061) (-420.571) (-415.613) * [-418.052] (-418.524) (-417.283) (-415.212) -- 0:00:51

      Average standard deviation of split frequencies: 0.021696

      215500 -- (-417.228) [-418.661] (-415.765) (-417.479) * (-416.408) (-415.904) [-419.003] (-414.596) -- 0:00:50
      216000 -- (-416.246) (-419.063) (-418.113) [-415.462] * (-417.215) (-416.730) (-417.821) [-416.962] -- 0:00:50
      216500 -- (-417.253) (-416.431) (-415.069) [-415.650] * [-422.871] (-415.867) (-417.447) (-415.893) -- 0:00:50
      217000 -- (-415.717) (-415.283) (-416.015) [-416.329] * (-415.624) (-414.849) (-416.590) [-417.273] -- 0:00:50
      217500 -- (-415.849) [-418.069] (-417.959) (-415.864) * (-417.633) (-422.081) (-422.080) [-418.031] -- 0:00:50
      218000 -- (-416.009) [-416.696] (-418.452) (-418.812) * (-415.229) [-418.444] (-418.753) (-416.289) -- 0:00:50
      218500 -- [-415.938] (-416.812) (-417.179) (-420.640) * (-416.781) (-416.748) (-415.102) [-415.275] -- 0:00:50
      219000 -- (-416.110) (-415.242) (-421.020) [-416.121] * [-417.472] (-418.069) (-420.417) (-416.547) -- 0:00:49
      219500 -- (-416.855) [-418.386] (-418.504) (-415.107) * (-417.808) [-417.916] (-417.331) (-417.130) -- 0:00:49
      220000 -- (-417.069) (-415.806) (-418.180) [-415.470] * (-416.071) (-419.212) (-416.237) [-415.359] -- 0:00:49

      Average standard deviation of split frequencies: 0.021111

      220500 -- (-416.713) [-415.214] (-418.835) (-417.748) * [-416.242] (-416.386) (-416.619) (-416.148) -- 0:00:49
      221000 -- (-421.881) (-414.825) [-415.979] (-416.383) * (-415.028) (-419.474) [-418.874] (-415.418) -- 0:00:49
      221500 -- (-422.993) (-420.278) (-416.968) [-416.393] * (-419.690) (-416.734) [-416.938] (-416.484) -- 0:00:49
      222000 -- (-418.984) [-419.534] (-415.537) (-417.827) * (-418.205) [-416.111] (-417.493) (-417.318) -- 0:00:49
      222500 -- (-417.121) (-418.466) [-415.423] (-416.819) * (-417.807) (-416.702) [-416.641] (-415.493) -- 0:00:48
      223000 -- (-418.687) (-417.494) [-416.389] (-417.298) * [-418.548] (-416.289) (-415.492) (-417.129) -- 0:00:48
      223500 -- (-421.557) (-417.586) [-417.485] (-417.431) * (-418.094) (-414.828) (-416.440) [-417.646] -- 0:00:48
      224000 -- [-415.264] (-418.685) (-416.645) (-416.160) * (-419.341) (-416.858) [-418.400] (-415.939) -- 0:00:48
      224500 -- [-415.438] (-416.772) (-418.633) (-418.446) * [-416.492] (-416.625) (-416.934) (-418.240) -- 0:00:48
      225000 -- (-417.261) [-416.947] (-421.695) (-415.389) * [-417.109] (-418.416) (-416.353) (-418.949) -- 0:00:48

      Average standard deviation of split frequencies: 0.021717

      225500 -- (-416.663) (-418.966) (-419.998) [-416.733] * [-417.599] (-419.803) (-417.147) (-419.606) -- 0:00:48
      226000 -- (-417.277) (-415.762) [-418.381] (-417.185) * (-416.585) (-416.844) (-420.496) [-416.160] -- 0:00:47
      226500 -- (-418.845) (-417.088) (-416.996) [-416.300] * [-416.246] (-416.049) (-416.356) (-416.661) -- 0:00:47
      227000 -- (-417.931) (-419.310) [-418.325] (-415.235) * (-420.585) (-420.096) [-416.176] (-416.691) -- 0:00:47
      227500 -- [-418.505] (-416.096) (-417.140) (-417.908) * (-417.513) [-415.120] (-414.986) (-417.560) -- 0:00:47
      228000 -- [-416.335] (-416.104) (-415.017) (-415.194) * (-418.546) (-417.169) (-417.632) [-416.630] -- 0:00:47
      228500 -- (-416.323) (-415.748) (-415.620) [-418.381] * [-415.384] (-417.491) (-420.454) (-415.654) -- 0:00:47
      229000 -- (-417.949) (-414.938) (-417.622) [-416.860] * [-416.314] (-416.095) (-419.127) (-417.597) -- 0:00:47
      229500 -- (-423.815) (-418.230) (-415.443) [-419.298] * (-417.003) [-415.950] (-423.359) (-418.632) -- 0:00:47
      230000 -- (-415.356) [-419.788] (-418.529) (-418.792) * (-419.135) (-421.270) [-416.592] (-416.075) -- 0:00:46

      Average standard deviation of split frequencies: 0.020076

      230500 -- [-417.297] (-416.324) (-418.399) (-417.099) * (-418.175) [-425.334] (-418.041) (-415.996) -- 0:00:50
      231000 -- (-416.483) (-420.129) [-416.324] (-418.626) * (-416.334) (-422.019) (-416.961) [-416.552] -- 0:00:49
      231500 -- [-414.799] (-417.540) (-415.750) (-416.032) * [-419.775] (-418.741) (-419.670) (-418.631) -- 0:00:49
      232000 -- [-414.788] (-416.928) (-419.098) (-415.395) * [-416.732] (-427.418) (-418.682) (-417.160) -- 0:00:49
      232500 -- (-416.297) [-415.540] (-417.435) (-415.553) * (-415.933) (-415.569) (-419.838) [-415.217] -- 0:00:49
      233000 -- (-419.720) [-415.574] (-418.051) (-417.175) * (-424.304) [-416.672] (-418.217) (-416.075) -- 0:00:49
      233500 -- (-417.616) (-417.763) (-417.910) [-417.174] * (-416.209) [-419.540] (-417.576) (-415.009) -- 0:00:49
      234000 -- (-419.662) (-417.788) (-418.621) [-415.773] * [-417.582] (-416.082) (-418.363) (-415.054) -- 0:00:49
      234500 -- (-416.973) (-418.065) (-418.957) [-415.963] * (-415.935) (-419.774) (-417.482) [-415.141] -- 0:00:48
      235000 -- [-417.681] (-417.772) (-416.875) (-415.915) * [-417.472] (-417.590) (-423.238) (-414.898) -- 0:00:48

      Average standard deviation of split frequencies: 0.020224

      235500 -- (-415.812) (-419.099) (-416.434) [-415.258] * (-417.754) (-418.082) [-419.208] (-416.231) -- 0:00:48
      236000 -- (-420.598) (-416.832) (-415.725) [-417.705] * (-415.921) (-417.709) [-415.452] (-416.165) -- 0:00:48
      236500 -- (-419.260) (-415.545) (-417.515) [-417.236] * (-428.235) (-419.570) (-419.113) [-414.907] -- 0:00:48
      237000 -- (-415.862) [-417.118] (-415.306) (-418.998) * (-416.742) [-416.092] (-416.077) (-416.434) -- 0:00:48
      237500 -- (-416.498) (-415.210) (-417.069) [-415.462] * [-415.313] (-417.559) (-415.401) (-419.531) -- 0:00:48
      238000 -- [-415.633] (-415.011) (-417.687) (-419.471) * (-416.191) [-417.265] (-414.816) (-415.980) -- 0:00:48
      238500 -- (-414.772) (-417.058) (-415.968) [-418.336] * (-417.123) [-420.257] (-417.212) (-418.330) -- 0:00:47
      239000 -- (-415.916) [-415.524] (-417.372) (-417.914) * (-418.573) (-424.332) [-416.716] (-415.288) -- 0:00:47
      239500 -- (-416.354) (-415.526) (-416.645) [-416.863] * [-416.447] (-421.084) (-416.048) (-419.989) -- 0:00:47
      240000 -- [-416.606] (-416.004) (-417.508) (-419.469) * (-417.263) (-417.899) (-418.112) [-423.757] -- 0:00:47

      Average standard deviation of split frequencies: 0.018717

      240500 -- (-416.975) [-417.973] (-416.903) (-416.508) * (-414.830) (-420.345) (-415.856) [-416.557] -- 0:00:47
      241000 -- (-416.579) [-417.869] (-416.248) (-417.574) * [-416.107] (-421.312) (-415.632) (-416.958) -- 0:00:47
      241500 -- (-416.223) (-415.452) (-415.764) [-415.342] * (-416.543) (-420.107) [-415.919] (-415.425) -- 0:00:47
      242000 -- [-415.306] (-415.436) (-416.045) (-422.242) * (-418.747) [-420.431] (-415.331) (-417.552) -- 0:00:46
      242500 -- (-420.391) [-416.564] (-420.532) (-420.559) * [-417.077] (-422.753) (-415.309) (-419.045) -- 0:00:46
      243000 -- [-419.408] (-417.329) (-418.891) (-418.738) * (-415.569) (-420.298) [-416.630] (-418.283) -- 0:00:46
      243500 -- (-418.270) (-416.626) (-416.362) [-416.438] * [-417.991] (-415.895) (-418.599) (-417.593) -- 0:00:46
      244000 -- (-416.757) [-416.986] (-415.514) (-417.111) * (-417.441) (-420.424) [-415.738] (-420.717) -- 0:00:46
      244500 -- (-416.882) [-417.009] (-419.445) (-418.149) * (-416.034) (-416.146) (-418.043) [-417.468] -- 0:00:46
      245000 -- [-418.210] (-415.329) (-415.600) (-416.828) * [-417.356] (-416.552) (-417.566) (-422.298) -- 0:00:46

      Average standard deviation of split frequencies: 0.016908

      245500 -- (-422.914) (-417.833) [-423.826] (-416.836) * (-416.092) (-416.449) (-415.676) [-420.412] -- 0:00:46
      246000 -- [-417.253] (-416.569) (-418.216) (-416.228) * (-416.975) [-418.143] (-418.300) (-420.511) -- 0:00:45
      246500 -- (-415.590) [-415.824] (-416.605) (-420.488) * (-416.239) [-416.657] (-416.478) (-416.286) -- 0:00:45
      247000 -- (-418.222) [-420.033] (-414.839) (-420.012) * (-415.303) (-417.547) [-415.895] (-416.325) -- 0:00:45
      247500 -- (-416.496) [-416.912] (-416.403) (-422.287) * [-415.605] (-418.982) (-416.683) (-418.004) -- 0:00:45
      248000 -- (-417.723) [-416.810] (-422.540) (-420.082) * (-415.865) [-416.223] (-415.943) (-415.424) -- 0:00:48
      248500 -- (-418.212) (-418.304) [-415.515] (-416.034) * (-417.034) (-418.841) (-415.567) [-418.582] -- 0:00:48
      249000 -- (-416.641) [-417.309] (-417.687) (-419.200) * [-415.843] (-417.014) (-415.246) (-417.816) -- 0:00:48
      249500 -- (-415.558) (-417.864) (-419.799) [-417.136] * (-418.002) (-416.115) [-416.533] (-415.524) -- 0:00:48
      250000 -- (-420.835) (-416.368) (-416.831) [-416.534] * (-416.445) (-416.223) [-415.995] (-414.914) -- 0:00:48

      Average standard deviation of split frequencies: 0.015358

      250500 -- (-424.816) (-418.109) (-417.166) [-417.247] * (-417.249) (-415.079) [-416.567] (-415.244) -- 0:00:47
      251000 -- (-417.483) (-415.082) [-415.530] (-416.886) * (-415.234) (-416.189) [-416.243] (-415.869) -- 0:00:47
      251500 -- [-416.382] (-418.222) (-420.978) (-419.463) * (-417.729) [-416.632] (-417.721) (-417.721) -- 0:00:47
      252000 -- (-415.541) [-416.612] (-428.157) (-416.240) * (-415.829) [-420.974] (-417.710) (-418.388) -- 0:00:47
      252500 -- (-416.061) (-416.289) (-426.226) [-417.624] * [-415.637] (-417.540) (-420.863) (-416.235) -- 0:00:47
      253000 -- (-415.134) (-418.149) (-422.937) [-416.787] * [-417.513] (-417.979) (-417.502) (-415.864) -- 0:00:47
      253500 -- (-416.586) (-418.101) [-420.085] (-416.469) * (-415.373) (-418.022) [-415.879] (-416.503) -- 0:00:47
      254000 -- [-416.984] (-418.846) (-418.023) (-416.160) * (-415.574) (-418.577) (-418.001) [-418.921] -- 0:00:46
      254500 -- [-421.369] (-416.529) (-418.563) (-416.448) * (-417.421) (-418.403) [-416.691] (-418.021) -- 0:00:46
      255000 -- (-414.852) (-416.529) [-416.887] (-418.182) * (-421.909) (-416.451) (-417.472) [-416.955] -- 0:00:46

      Average standard deviation of split frequencies: 0.014190

      255500 -- [-418.099] (-415.531) (-417.217) (-416.145) * (-418.044) (-418.394) [-415.849] (-417.200) -- 0:00:46
      256000 -- [-415.458] (-417.668) (-420.752) (-415.971) * [-416.958] (-418.065) (-418.179) (-416.056) -- 0:00:46
      256500 -- [-418.082] (-419.076) (-417.486) (-414.785) * [-416.594] (-417.339) (-420.312) (-416.202) -- 0:00:46
      257000 -- (-417.538) (-418.724) (-419.050) [-415.913] * (-418.095) (-417.379) [-420.157] (-415.458) -- 0:00:46
      257500 -- (-415.431) [-418.707] (-417.804) (-416.312) * (-416.504) (-425.518) [-417.806] (-417.093) -- 0:00:46
      258000 -- (-416.767) (-417.866) (-417.684) [-414.814] * [-418.184] (-425.340) (-416.281) (-417.038) -- 0:00:46
      258500 -- [-416.544] (-417.261) (-415.164) (-416.891) * (-421.050) [-416.512] (-418.301) (-415.594) -- 0:00:45
      259000 -- (-415.102) (-417.433) [-416.342] (-415.589) * (-416.724) (-420.907) (-418.978) [-418.142] -- 0:00:45
      259500 -- (-415.936) (-416.797) [-415.874] (-421.618) * (-418.132) (-415.815) [-415.734] (-415.676) -- 0:00:45
      260000 -- (-416.057) [-416.603] (-415.664) (-419.000) * (-416.363) (-414.727) (-417.394) [-415.681] -- 0:00:45

      Average standard deviation of split frequencies: 0.013162

      260500 -- (-415.126) (-415.475) [-416.979] (-421.450) * (-416.357) (-416.491) (-421.592) [-415.794] -- 0:00:45
      261000 -- (-415.564) (-418.449) (-417.299) [-418.438] * (-418.873) (-417.302) [-414.595] (-417.725) -- 0:00:45
      261500 -- (-415.873) (-416.152) (-420.173) [-418.608] * (-417.722) (-416.710) [-415.480] (-418.028) -- 0:00:45
      262000 -- [-417.578] (-416.404) (-417.089) (-416.271) * (-418.137) (-415.939) [-417.899] (-420.753) -- 0:00:45
      262500 -- [-415.187] (-417.101) (-420.313) (-415.498) * (-416.342) (-416.592) [-415.798] (-415.956) -- 0:00:44
      263000 -- (-417.880) [-418.630] (-415.128) (-419.052) * (-416.408) (-414.965) [-417.041] (-416.444) -- 0:00:44
      263500 -- (-420.082) [-414.829] (-417.769) (-416.123) * (-415.370) [-416.926] (-418.920) (-416.502) -- 0:00:44
      264000 -- (-416.669) (-416.166) (-415.897) [-417.621] * [-415.070] (-416.824) (-415.857) (-428.827) -- 0:00:44
      264500 -- [-416.587] (-418.000) (-415.201) (-416.866) * (-424.144) [-417.733] (-417.625) (-419.974) -- 0:00:44
      265000 -- (-417.980) (-417.947) (-418.735) [-414.938] * (-422.155) (-417.871) [-416.024] (-415.356) -- 0:00:47

      Average standard deviation of split frequencies: 0.013488

      265500 -- (-416.384) (-415.534) (-417.173) [-416.800] * (-421.340) (-419.641) (-415.833) [-415.994] -- 0:00:47
      266000 -- [-418.392] (-415.324) (-417.058) (-417.017) * (-416.028) [-416.653] (-421.795) (-418.541) -- 0:00:46
      266500 -- (-417.094) (-415.366) (-420.423) [-417.398] * [-416.793] (-415.192) (-415.427) (-417.792) -- 0:00:46
      267000 -- (-415.693) [-418.758] (-417.840) (-419.420) * (-415.179) (-416.934) [-415.569] (-416.205) -- 0:00:46
      267500 -- (-421.875) [-416.919] (-417.582) (-418.078) * (-416.950) (-414.979) (-420.499) [-415.888] -- 0:00:46
      268000 -- (-414.934) (-415.788) (-418.020) [-418.310] * [-416.344] (-415.992) (-416.340) (-414.954) -- 0:00:46
      268500 -- (-416.951) (-418.215) [-415.709] (-420.415) * [-417.073] (-416.353) (-418.895) (-416.228) -- 0:00:46
      269000 -- [-415.574] (-417.907) (-419.578) (-420.543) * (-416.940) [-415.823] (-416.564) (-418.097) -- 0:00:46
      269500 -- [-416.562] (-419.602) (-415.288) (-418.119) * (-416.762) (-416.198) [-416.191] (-416.272) -- 0:00:46
      270000 -- (-417.482) [-419.060] (-417.592) (-415.761) * (-415.649) [-414.712] (-416.982) (-415.382) -- 0:00:45

      Average standard deviation of split frequencies: 0.012191

      270500 -- (-415.705) [-418.120] (-418.406) (-415.713) * (-418.712) (-417.289) (-418.457) [-416.408] -- 0:00:45
      271000 -- (-415.291) [-416.436] (-415.812) (-417.965) * (-416.835) (-416.924) (-420.432) [-418.236] -- 0:00:45
      271500 -- (-416.758) (-420.591) (-415.080) [-416.479] * (-415.106) (-418.714) (-418.866) [-416.767] -- 0:00:45
      272000 -- [-417.043] (-416.191) (-416.148) (-417.026) * [-416.602] (-415.887) (-421.887) (-417.969) -- 0:00:45
      272500 -- (-415.602) [-415.556] (-417.417) (-418.595) * [-416.388] (-417.382) (-415.594) (-420.748) -- 0:00:45
      273000 -- (-420.302) (-417.570) [-416.913] (-416.998) * (-415.725) (-419.370) (-420.171) [-415.179] -- 0:00:45
      273500 -- (-415.053) [-416.019] (-416.278) (-418.300) * (-416.741) (-416.836) (-418.286) [-417.798] -- 0:00:45
      274000 -- (-416.814) [-418.695] (-416.560) (-426.516) * [-416.243] (-416.595) (-417.919) (-417.822) -- 0:00:45
      274500 -- (-415.897) (-415.489) [-419.888] (-419.631) * (-415.486) [-415.224] (-416.458) (-418.359) -- 0:00:44
      275000 -- (-415.198) (-415.843) [-418.397] (-418.751) * (-414.968) [-417.660] (-416.584) (-417.260) -- 0:00:44

      Average standard deviation of split frequencies: 0.011956

      275500 -- [-417.185] (-415.833) (-417.465) (-416.762) * (-414.736) (-419.330) (-416.638) [-415.318] -- 0:00:44
      276000 -- (-417.712) (-418.794) (-418.097) [-416.797] * (-415.550) (-416.813) [-416.774] (-416.941) -- 0:00:44
      276500 -- [-417.224] (-415.616) (-420.890) (-418.017) * (-416.255) (-417.349) [-418.618] (-416.279) -- 0:00:44
      277000 -- (-415.123) (-420.856) (-421.628) [-415.118] * (-416.401) (-416.856) (-415.848) [-415.140] -- 0:00:44
      277500 -- [-415.404] (-416.734) (-415.984) (-420.323) * (-416.951) [-415.945] (-415.832) (-415.011) -- 0:00:44
      278000 -- (-415.367) [-420.867] (-415.385) (-420.805) * (-419.974) [-418.246] (-418.227) (-418.217) -- 0:00:44
      278500 -- (-418.128) (-416.966) [-418.518] (-415.099) * (-419.027) (-415.620) [-417.490] (-419.742) -- 0:00:44
      279000 -- (-417.771) (-416.078) [-415.093] (-415.352) * (-419.702) [-417.637] (-417.629) (-414.828) -- 0:00:43
      279500 -- (-415.130) [-416.042] (-415.814) (-418.127) * (-419.700) (-418.404) (-416.803) [-415.057] -- 0:00:43
      280000 -- (-417.174) (-416.096) [-416.517] (-421.266) * (-416.285) (-417.182) [-418.464] (-415.560) -- 0:00:43

      Average standard deviation of split frequencies: 0.012745

      280500 -- (-417.626) (-418.075) [-414.899] (-418.711) * (-415.515) (-417.267) (-419.080) [-416.498] -- 0:00:43
      281000 -- [-416.054] (-422.829) (-416.236) (-422.280) * [-421.788] (-415.714) (-417.810) (-415.632) -- 0:00:43
      281500 -- [-415.257] (-416.283) (-420.118) (-419.605) * (-416.510) [-416.400] (-415.353) (-416.286) -- 0:00:43
      282000 -- [-417.346] (-416.800) (-417.992) (-416.560) * (-416.823) (-416.530) [-419.781] (-415.604) -- 0:00:45
      282500 -- (-421.588) (-417.854) (-415.708) [-416.425] * [-419.707] (-417.071) (-417.745) (-417.621) -- 0:00:45
      283000 -- (-417.304) (-415.687) (-416.324) [-415.383] * (-416.334) [-416.753] (-420.035) (-419.124) -- 0:00:45
      283500 -- (-416.958) (-416.187) [-415.577] (-415.063) * (-417.421) (-416.663) [-415.915] (-417.179) -- 0:00:45
      284000 -- (-417.338) (-418.546) (-419.325) [-419.354] * [-415.567] (-416.042) (-415.745) (-416.871) -- 0:00:45
      284500 -- (-424.785) (-416.723) (-418.363) [-415.976] * (-415.571) [-417.328] (-421.957) (-416.401) -- 0:00:45
      285000 -- [-419.254] (-416.462) (-416.047) (-416.524) * (-416.911) (-415.492) (-416.191) [-415.726] -- 0:00:45

      Average standard deviation of split frequencies: 0.011172

      285500 -- (-416.441) (-416.140) [-416.329] (-416.690) * (-416.141) [-416.826] (-429.533) (-415.941) -- 0:00:45
      286000 -- (-416.780) [-414.725] (-414.637) (-418.870) * (-419.923) [-415.086] (-421.743) (-416.152) -- 0:00:44
      286500 -- (-415.562) [-416.030] (-415.198) (-417.214) * (-416.995) (-415.445) (-416.785) [-418.187] -- 0:00:44
      287000 -- [-415.069] (-420.375) (-415.165) (-419.897) * (-418.312) (-417.806) (-416.064) [-416.788] -- 0:00:44
      287500 -- (-420.836) (-418.216) [-415.724] (-419.235) * [-421.240] (-417.078) (-416.231) (-416.036) -- 0:00:44
      288000 -- (-422.894) (-418.246) (-415.513) [-418.890] * (-418.251) (-416.996) (-417.632) [-415.367] -- 0:00:44
      288500 -- [-418.237] (-422.718) (-418.172) (-418.816) * (-418.036) (-416.279) [-421.352] (-420.716) -- 0:00:44
      289000 -- (-415.755) [-416.069] (-418.543) (-414.846) * (-416.122) (-416.474) (-419.823) [-416.368] -- 0:00:44
      289500 -- [-416.287] (-417.971) (-418.545) (-418.531) * [-417.163] (-417.442) (-415.996) (-415.979) -- 0:00:44
      290000 -- [-418.535] (-420.538) (-416.042) (-417.514) * (-415.738) (-418.748) [-416.922] (-415.480) -- 0:00:44

      Average standard deviation of split frequencies: 0.010971

      290500 -- (-416.035) (-416.350) (-417.497) [-415.285] * (-418.774) [-415.945] (-417.934) (-417.029) -- 0:00:43
      291000 -- (-415.961) (-415.824) [-418.416] (-417.077) * (-416.671) (-418.225) (-419.856) [-416.443] -- 0:00:43
      291500 -- (-414.760) (-417.850) [-416.874] (-417.039) * (-416.020) (-417.553) (-418.982) [-416.979] -- 0:00:43
      292000 -- (-419.288) (-422.035) [-415.418] (-418.660) * (-418.833) [-415.942] (-417.009) (-421.950) -- 0:00:43
      292500 -- (-420.447) [-416.523] (-418.837) (-421.155) * (-419.074) (-415.343) [-418.093] (-419.236) -- 0:00:43
      293000 -- (-418.435) (-416.077) (-416.471) [-414.964] * (-419.170) (-415.918) (-416.452) [-419.171] -- 0:00:43
      293500 -- (-416.833) (-419.881) [-415.442] (-417.593) * (-416.732) [-417.661] (-418.530) (-416.834) -- 0:00:43
      294000 -- (-415.857) (-417.756) (-415.169) [-415.140] * (-417.231) (-416.449) (-417.636) [-418.484] -- 0:00:43
      294500 -- (-414.846) (-423.040) (-417.106) [-416.529] * (-419.200) (-419.450) [-416.355] (-416.028) -- 0:00:43
      295000 -- (-417.947) (-416.138) [-416.321] (-416.143) * (-416.327) (-415.668) (-419.483) [-416.793] -- 0:00:43

      Average standard deviation of split frequencies: 0.009274

      295500 -- (-417.285) [-418.642] (-419.414) (-420.143) * [-415.219] (-415.659) (-415.421) (-419.798) -- 0:00:42
      296000 -- (-415.806) [-416.213] (-417.088) (-414.851) * [-417.292] (-418.321) (-417.506) (-416.314) -- 0:00:42
      296500 -- (-418.780) [-414.623] (-415.407) (-417.204) * (-419.594) [-416.345] (-418.591) (-417.136) -- 0:00:42
      297000 -- [-418.025] (-421.993) (-417.526) (-417.687) * (-417.599) [-416.736] (-416.422) (-418.805) -- 0:00:42
      297500 -- (-419.817) (-424.955) (-415.209) [-417.188] * (-415.888) (-416.765) [-417.300] (-417.999) -- 0:00:42
      298000 -- (-415.547) (-424.193) (-420.725) [-415.347] * [-417.432] (-416.043) (-415.741) (-418.941) -- 0:00:42
      298500 -- [-417.657] (-416.696) (-414.892) (-415.361) * (-416.064) [-419.272] (-416.170) (-415.518) -- 0:00:42
      299000 -- (-419.462) (-416.644) [-416.858] (-415.635) * (-415.981) [-415.416] (-415.902) (-417.718) -- 0:00:44
      299500 -- (-417.873) (-416.907) (-415.608) [-416.576] * (-416.078) (-416.671) (-416.084) [-416.729] -- 0:00:44
      300000 -- [-415.400] (-416.084) (-415.018) (-416.234) * (-422.215) [-418.387] (-415.273) (-416.300) -- 0:00:44

      Average standard deviation of split frequencies: 0.008669

      300500 -- [-414.981] (-417.110) (-415.240) (-417.802) * (-421.342) (-415.564) [-416.611] (-416.141) -- 0:00:44
      301000 -- (-418.171) [-415.507] (-419.172) (-416.819) * (-417.365) [-415.329] (-420.112) (-422.018) -- 0:00:44
      301500 -- (-417.763) [-422.130] (-417.093) (-417.214) * (-418.526) (-415.414) [-417.776] (-418.961) -- 0:00:44
      302000 -- [-417.738] (-419.527) (-417.679) (-417.353) * [-417.220] (-418.482) (-415.846) (-421.505) -- 0:00:43
      302500 -- (-421.798) (-415.768) [-416.474] (-415.873) * [-417.406] (-418.946) (-415.114) (-416.415) -- 0:00:43
      303000 -- (-417.717) [-415.029] (-415.616) (-415.617) * [-415.281] (-417.049) (-419.752) (-422.965) -- 0:00:43
      303500 -- (-422.742) (-422.213) [-414.858] (-418.234) * (-417.935) (-416.457) [-416.455] (-416.741) -- 0:00:43
      304000 -- (-418.536) (-419.675) [-415.418] (-415.561) * (-417.725) (-420.639) [-415.973] (-416.729) -- 0:00:43
      304500 -- (-416.584) (-420.627) [-416.222] (-419.747) * (-417.851) (-420.701) [-418.059] (-416.942) -- 0:00:43
      305000 -- (-415.715) (-420.384) [-417.352] (-418.307) * (-418.745) [-419.185] (-420.313) (-416.086) -- 0:00:43

      Average standard deviation of split frequencies: 0.009500

      305500 -- (-418.349) [-415.627] (-422.055) (-419.683) * [-416.985] (-416.205) (-417.131) (-416.162) -- 0:00:43
      306000 -- [-419.587] (-416.446) (-417.474) (-415.983) * (-414.868) (-417.696) [-419.711] (-416.210) -- 0:00:43
      306500 -- (-416.892) (-419.593) (-415.455) [-415.945] * (-416.103) [-414.979] (-423.449) (-415.789) -- 0:00:42
      307000 -- (-418.784) (-415.612) [-417.676] (-416.857) * (-418.482) [-415.556] (-422.920) (-418.416) -- 0:00:42
      307500 -- [-415.351] (-418.276) (-419.466) (-417.287) * [-417.524] (-416.603) (-416.678) (-417.116) -- 0:00:42
      308000 -- [-418.544] (-415.926) (-417.883) (-419.642) * (-420.386) (-416.504) [-416.437] (-422.099) -- 0:00:42
      308500 -- (-420.140) (-416.422) [-419.203] (-418.088) * (-417.695) (-415.493) (-418.280) [-416.578] -- 0:00:42
      309000 -- [-417.780] (-417.556) (-416.981) (-415.301) * [-416.157] (-416.031) (-417.348) (-415.572) -- 0:00:42
      309500 -- (-415.314) [-421.348] (-416.871) (-415.685) * (-415.654) [-416.579] (-415.440) (-416.085) -- 0:00:42
      310000 -- [-415.271] (-418.694) (-420.483) (-417.787) * [-419.409] (-418.654) (-417.219) (-417.255) -- 0:00:42

      Average standard deviation of split frequencies: 0.009640

      310500 -- [-421.384] (-416.939) (-425.118) (-414.961) * [-416.034] (-417.567) (-417.805) (-421.172) -- 0:00:42
      311000 -- (-418.577) (-419.901) (-418.576) [-415.188] * [-418.015] (-417.645) (-414.857) (-417.014) -- 0:00:42
      311500 -- [-416.735] (-422.567) (-419.443) (-415.255) * (-420.150) (-418.208) (-415.399) [-417.630] -- 0:00:41
      312000 -- (-419.045) (-414.594) (-420.954) [-415.632] * (-415.660) (-416.935) (-417.021) [-415.913] -- 0:00:41
      312500 -- (-418.066) (-418.573) (-415.754) [-417.917] * (-417.975) (-418.049) (-416.753) [-417.169] -- 0:00:41
      313000 -- (-417.648) [-419.332] (-418.588) (-419.337) * (-416.712) (-417.262) [-415.534] (-420.502) -- 0:00:41
      313500 -- (-417.482) [-417.617] (-420.246) (-418.050) * (-415.043) (-418.153) [-415.030] (-416.369) -- 0:00:41
      314000 -- (-419.980) (-420.657) (-418.388) [-417.533] * (-415.448) (-415.280) [-416.439] (-416.021) -- 0:00:41
      314500 -- (-417.035) (-415.625) [-416.760] (-415.516) * [-417.784] (-417.223) (-418.465) (-419.498) -- 0:00:41
      315000 -- (-420.416) [-416.814] (-417.056) (-416.453) * (-415.100) (-416.220) (-419.938) [-416.996] -- 0:00:41

      Average standard deviation of split frequencies: 0.009828

      315500 -- (-418.103) (-417.226) [-416.116] (-417.508) * (-418.446) (-415.248) [-419.389] (-415.815) -- 0:00:41
      316000 -- (-419.163) (-422.918) [-420.233] (-416.669) * (-417.410) (-414.983) (-415.376) [-418.491] -- 0:00:43
      316500 -- (-416.605) [-417.430] (-421.378) (-417.991) * (-418.495) (-418.349) (-415.579) [-418.469] -- 0:00:43
      317000 -- (-417.591) [-416.370] (-416.662) (-417.762) * (-420.042) (-415.648) (-416.266) [-419.738] -- 0:00:43
      317500 -- (-415.277) [-415.552] (-416.859) (-420.430) * [-418.211] (-420.743) (-416.578) (-417.623) -- 0:00:42
      318000 -- (-416.710) (-414.672) [-418.100] (-417.165) * [-417.644] (-419.379) (-417.734) (-415.694) -- 0:00:42
      318500 -- (-414.920) (-416.413) (-419.489) [-416.817] * (-420.990) [-419.481] (-419.089) (-417.593) -- 0:00:42
      319000 -- (-418.142) (-416.906) [-419.242] (-416.094) * (-418.227) (-419.427) (-416.572) [-418.496] -- 0:00:42
      319500 -- [-417.490] (-415.389) (-418.020) (-423.079) * [-415.759] (-415.125) (-415.847) (-417.009) -- 0:00:42
      320000 -- (-416.750) [-418.895] (-417.309) (-418.809) * [-414.982] (-416.273) (-416.491) (-419.014) -- 0:00:42

      Average standard deviation of split frequencies: 0.009280

      320500 -- (-417.338) (-417.801) (-419.789) [-415.806] * [-416.816] (-415.603) (-415.755) (-415.793) -- 0:00:42
      321000 -- (-417.750) [-416.417] (-417.564) (-416.061) * (-414.845) (-416.545) [-416.319] (-417.229) -- 0:00:42
      321500 -- (-416.977) (-420.388) (-418.013) [-416.473] * [-415.369] (-418.122) (-416.876) (-415.858) -- 0:00:42
      322000 -- (-415.578) [-415.513] (-418.502) (-416.889) * (-416.620) (-415.740) [-416.229] (-416.421) -- 0:00:42
      322500 -- [-417.165] (-419.657) (-414.951) (-418.063) * (-419.446) [-416.497] (-416.525) (-419.889) -- 0:00:42
      323000 -- (-418.644) (-417.627) [-415.711] (-417.474) * (-419.154) (-416.462) (-417.218) [-417.109] -- 0:00:41
      323500 -- [-418.536] (-416.920) (-415.733) (-417.692) * (-419.173) (-416.361) [-417.450] (-420.535) -- 0:00:41
      324000 -- (-418.795) [-415.417] (-420.774) (-418.761) * [-415.708] (-417.192) (-417.451) (-415.626) -- 0:00:41
      324500 -- (-418.534) (-417.729) [-416.001] (-416.223) * (-415.998) (-420.080) (-417.954) [-416.405] -- 0:00:41
      325000 -- [-416.622] (-415.416) (-418.589) (-420.000) * (-418.662) (-417.931) (-419.415) [-416.161] -- 0:00:41

      Average standard deviation of split frequencies: 0.009761

      325500 -- (-416.952) [-417.277] (-416.386) (-416.720) * (-414.978) (-416.538) (-419.705) [-416.475] -- 0:00:41
      326000 -- (-416.384) (-416.739) [-418.469] (-417.697) * (-418.347) (-419.063) (-415.531) [-418.230] -- 0:00:41
      326500 -- (-417.584) (-418.797) (-415.763) [-417.238] * [-416.662] (-415.573) (-418.006) (-417.575) -- 0:00:41
      327000 -- [-419.297] (-419.986) (-415.637) (-419.359) * (-414.775) (-418.927) [-417.736] (-417.200) -- 0:00:41
      327500 -- [-415.331] (-416.847) (-421.739) (-419.303) * (-419.056) (-421.711) (-417.855) [-416.229] -- 0:00:41
      328000 -- (-416.810) [-416.005] (-416.620) (-416.720) * [-418.444] (-417.361) (-417.609) (-423.443) -- 0:00:40
      328500 -- (-417.751) [-420.075] (-415.985) (-420.241) * (-419.036) (-419.837) (-415.776) [-418.591] -- 0:00:40
      329000 -- (-417.665) (-419.178) (-416.066) [-417.870] * (-422.969) [-418.797] (-415.559) (-416.080) -- 0:00:40
      329500 -- [-418.733] (-419.374) (-416.290) (-414.940) * (-416.591) (-415.295) (-418.723) [-417.899] -- 0:00:40
      330000 -- (-416.004) [-415.040] (-419.091) (-414.799) * [-417.090] (-417.290) (-417.845) (-418.744) -- 0:00:40

      Average standard deviation of split frequencies: 0.009534

      330500 -- (-417.038) (-415.774) [-419.332] (-418.845) * (-415.489) [-417.565] (-418.354) (-418.766) -- 0:00:40
      331000 -- (-417.258) (-416.907) (-415.636) [-419.649] * [-416.016] (-415.183) (-420.836) (-415.246) -- 0:00:40
      331500 -- (-415.938) (-416.965) (-417.095) [-415.027] * (-418.649) [-415.125] (-418.594) (-416.425) -- 0:00:40
      332000 -- (-417.747) (-417.898) [-421.650] (-417.260) * (-416.272) [-417.765] (-415.649) (-417.816) -- 0:00:40
      332500 -- [-418.269] (-414.987) (-419.024) (-417.939) * (-417.592) (-418.202) [-415.188] (-416.459) -- 0:00:42
      333000 -- (-415.970) [-417.754] (-419.791) (-418.164) * (-416.706) [-418.060] (-416.839) (-416.388) -- 0:00:42
      333500 -- [-414.866] (-416.348) (-417.651) (-417.967) * [-417.139] (-416.462) (-420.369) (-415.102) -- 0:00:41
      334000 -- [-417.605] (-416.434) (-417.480) (-415.010) * [-415.623] (-417.119) (-415.856) (-418.724) -- 0:00:41
      334500 -- [-416.328] (-417.501) (-421.257) (-415.178) * (-416.304) (-417.369) (-414.870) [-420.042] -- 0:00:41
      335000 -- (-417.614) (-416.854) (-417.116) [-418.504] * [-418.498] (-418.623) (-419.603) (-419.058) -- 0:00:41

      Average standard deviation of split frequencies: 0.009382

      335500 -- (-416.155) [-415.434] (-415.631) (-418.034) * (-417.777) [-419.990] (-416.129) (-417.920) -- 0:00:41
      336000 -- (-417.816) (-416.004) [-417.494] (-418.642) * (-417.824) [-417.084] (-417.787) (-417.586) -- 0:00:41
      336500 -- [-415.755] (-422.642) (-418.196) (-419.281) * [-417.025] (-417.169) (-421.005) (-416.726) -- 0:00:41
      337000 -- (-418.543) (-416.837) (-419.455) [-419.625] * [-420.044] (-418.415) (-416.908) (-415.670) -- 0:00:41
      337500 -- (-415.344) (-416.979) (-415.236) [-415.620] * (-417.915) (-416.414) [-416.477] (-415.071) -- 0:00:41
      338000 -- (-416.430) [-417.186] (-415.160) (-416.221) * (-416.966) (-415.663) (-419.146) [-415.380] -- 0:00:41
      338500 -- [-416.608] (-419.369) (-415.950) (-417.217) * (-419.748) (-416.632) (-416.560) [-416.378] -- 0:00:41
      339000 -- [-415.269] (-419.604) (-415.690) (-415.604) * [-414.915] (-415.986) (-414.839) (-415.011) -- 0:00:40
      339500 -- (-414.884) (-416.967) (-416.746) [-415.250] * (-416.336) (-416.800) [-417.064] (-415.950) -- 0:00:40
      340000 -- (-415.171) [-415.686] (-415.732) (-416.037) * (-419.668) (-418.475) (-416.195) [-418.484] -- 0:00:40

      Average standard deviation of split frequencies: 0.009946

      340500 -- (-415.072) [-418.670] (-420.258) (-418.570) * (-420.824) [-418.439] (-415.430) (-415.913) -- 0:00:40
      341000 -- (-417.296) (-414.950) (-424.286) [-417.467] * (-420.882) [-417.420] (-415.723) (-420.959) -- 0:00:40
      341500 -- (-416.528) (-418.930) (-416.788) [-418.735] * (-417.901) [-416.757] (-415.514) (-416.068) -- 0:00:40
      342000 -- [-417.462] (-416.911) (-416.565) (-415.993) * (-419.746) (-418.811) [-417.556] (-417.274) -- 0:00:40
      342500 -- [-419.137] (-417.844) (-415.201) (-415.769) * (-417.645) [-417.534] (-417.502) (-415.801) -- 0:00:40
      343000 -- [-416.092] (-417.210) (-415.311) (-417.687) * (-415.587) [-415.035] (-419.053) (-419.332) -- 0:00:40
      343500 -- (-416.541) (-417.447) [-415.289] (-414.922) * [-415.085] (-417.261) (-416.002) (-420.286) -- 0:00:40
      344000 -- [-417.642] (-418.710) (-414.934) (-418.091) * (-418.629) (-417.625) (-415.388) [-417.072] -- 0:00:40
      344500 -- [-416.162] (-417.942) (-416.827) (-419.123) * [-416.116] (-418.098) (-419.577) (-415.684) -- 0:00:39
      345000 -- (-417.634) [-416.484] (-416.150) (-420.846) * [-417.826] (-418.449) (-417.193) (-417.377) -- 0:00:39

      Average standard deviation of split frequencies: 0.010499

      345500 -- (-420.033) (-417.564) [-418.273] (-415.269) * (-418.321) (-416.384) (-417.284) [-416.825] -- 0:00:39
      346000 -- (-416.530) [-415.832] (-418.106) (-415.053) * (-416.914) (-415.753) [-419.313] (-417.910) -- 0:00:39
      346500 -- (-419.094) [-417.791] (-418.047) (-422.368) * [-416.864] (-419.465) (-415.884) (-417.103) -- 0:00:39
      347000 -- (-418.780) (-418.995) [-418.261] (-416.189) * (-416.633) [-416.560] (-418.242) (-416.301) -- 0:00:39
      347500 -- (-419.016) (-418.968) [-418.938] (-416.938) * [-415.259] (-418.278) (-420.161) (-415.435) -- 0:00:39
      348000 -- (-416.569) [-416.466] (-414.667) (-417.574) * [-415.604] (-417.021) (-416.716) (-416.566) -- 0:00:39
      348500 -- [-415.284] (-420.463) (-415.630) (-415.100) * (-415.799) [-416.226] (-421.016) (-421.973) -- 0:00:39
      349000 -- [-416.294] (-416.054) (-416.933) (-415.530) * (-416.213) (-416.018) (-420.325) [-415.979] -- 0:00:39
      349500 -- [-417.183] (-416.613) (-420.287) (-421.500) * [-416.871] (-415.566) (-418.625) (-419.355) -- 0:00:39
      350000 -- (-422.495) [-417.657] (-416.753) (-416.665) * (-416.848) [-416.567] (-416.419) (-416.700) -- 0:00:40

      Average standard deviation of split frequencies: 0.011308

      350500 -- (-414.850) [-417.608] (-421.551) (-419.040) * (-419.724) (-417.136) [-417.466] (-417.904) -- 0:00:40
      351000 -- (-416.363) [-415.897] (-416.894) (-416.188) * (-418.572) [-418.308] (-416.717) (-416.243) -- 0:00:40
      351500 -- (-418.089) [-419.811] (-415.937) (-418.703) * (-415.683) (-416.092) (-415.855) [-415.573] -- 0:00:40
      352000 -- [-416.552] (-417.013) (-417.027) (-417.097) * [-417.066] (-420.279) (-415.914) (-419.371) -- 0:00:40
      352500 -- (-417.504) (-418.213) (-416.861) [-417.451] * (-416.760) (-417.378) [-415.674] (-414.862) -- 0:00:40
      353000 -- (-416.224) (-415.608) [-415.633] (-418.765) * (-417.251) (-419.349) [-419.022] (-415.496) -- 0:00:40
      353500 -- [-418.229] (-417.792) (-417.241) (-418.988) * (-415.158) (-417.569) (-417.658) [-415.529] -- 0:00:40
      354000 -- [-416.877] (-415.240) (-415.984) (-416.518) * (-415.406) (-416.565) (-418.136) [-414.984] -- 0:00:40
      354500 -- (-415.874) (-414.778) [-415.740] (-416.502) * (-418.404) [-418.612] (-418.125) (-415.068) -- 0:00:40
      355000 -- [-416.124] (-415.881) (-416.780) (-416.743) * (-415.583) (-414.955) [-420.992] (-417.400) -- 0:00:39

      Average standard deviation of split frequencies: 0.010048

      355500 -- (-419.867) (-421.334) [-419.515] (-417.216) * (-416.014) [-418.146] (-416.828) (-415.980) -- 0:00:39
      356000 -- [-415.032] (-416.484) (-416.983) (-416.320) * (-416.637) (-415.361) (-415.825) [-415.851] -- 0:00:39
      356500 -- [-417.183] (-415.508) (-416.903) (-415.723) * (-415.178) [-420.254] (-416.720) (-419.460) -- 0:00:39
      357000 -- (-416.455) [-417.729] (-416.691) (-416.294) * [-416.652] (-417.525) (-417.502) (-415.994) -- 0:00:39
      357500 -- (-415.869) (-417.665) (-417.225) [-416.213] * (-418.864) [-415.871] (-418.073) (-415.823) -- 0:00:39
      358000 -- [-416.941] (-416.572) (-418.809) (-416.452) * [-417.224] (-416.589) (-416.938) (-417.905) -- 0:00:39
      358500 -- (-416.035) (-417.496) (-418.598) [-417.131] * (-418.706) (-421.348) [-415.426] (-420.204) -- 0:00:39
      359000 -- [-417.927] (-419.439) (-414.922) (-416.308) * [-417.437] (-423.843) (-420.234) (-415.571) -- 0:00:39
      359500 -- (-418.134) [-417.207] (-414.825) (-414.943) * (-415.592) [-419.437] (-415.315) (-415.527) -- 0:00:39
      360000 -- [-415.278] (-417.650) (-415.916) (-415.694) * (-414.902) (-416.032) (-415.105) [-415.073] -- 0:00:39

      Average standard deviation of split frequencies: 0.009764

      360500 -- [-414.987] (-415.830) (-416.897) (-416.291) * (-416.335) (-417.987) [-415.659] (-417.641) -- 0:00:39
      361000 -- (-415.938) (-415.219) [-420.062] (-417.052) * (-416.398) (-416.866) (-418.462) [-416.980] -- 0:00:38
      361500 -- (-414.764) [-416.706] (-416.378) (-416.947) * (-416.224) (-417.958) (-417.904) [-416.413] -- 0:00:38
      362000 -- [-417.462] (-417.654) (-415.956) (-418.115) * (-417.159) (-416.334) [-416.972] (-419.114) -- 0:00:38
      362500 -- [-420.479] (-420.974) (-417.312) (-418.273) * (-416.849) [-418.286] (-415.236) (-417.319) -- 0:00:38
      363000 -- (-416.448) (-416.911) [-415.021] (-415.962) * [-415.858] (-415.875) (-415.834) (-416.565) -- 0:00:38
      363500 -- [-418.901] (-414.964) (-416.366) (-421.868) * [-417.659] (-416.070) (-417.002) (-415.190) -- 0:00:38
      364000 -- [-416.711] (-416.548) (-417.650) (-415.877) * (-417.436) (-419.109) [-415.348] (-415.080) -- 0:00:38
      364500 -- [-417.820] (-416.773) (-419.057) (-418.256) * (-417.394) (-420.021) [-415.419] (-415.663) -- 0:00:38
      365000 -- [-417.772] (-420.132) (-415.729) (-416.839) * (-416.898) [-418.743] (-419.849) (-415.502) -- 0:00:38

      Average standard deviation of split frequencies: 0.010447

      365500 -- [-416.503] (-416.082) (-415.354) (-416.897) * (-416.601) [-417.781] (-418.041) (-417.313) -- 0:00:38
      366000 -- (-418.018) (-417.211) [-419.968] (-416.482) * (-417.286) [-417.958] (-415.987) (-417.531) -- 0:00:38
      366500 -- (-416.362) [-419.310] (-416.441) (-418.338) * (-416.055) [-416.723] (-417.011) (-419.767) -- 0:00:39
      367000 -- (-422.548) (-415.926) [-417.870] (-416.663) * (-416.378) (-415.081) (-420.542) [-415.521] -- 0:00:39
      367500 -- (-416.774) (-416.404) [-415.006] (-416.720) * (-416.265) (-416.183) [-416.724] (-418.791) -- 0:00:39
      368000 -- (-419.070) (-417.768) (-415.076) [-416.965] * (-419.024) (-417.807) (-417.680) [-416.864] -- 0:00:39
      368500 -- (-415.909) [-417.633] (-415.605) (-417.583) * (-418.507) (-415.802) (-415.787) [-415.543] -- 0:00:39
      369000 -- (-416.745) [-416.831] (-417.757) (-418.879) * (-414.982) (-415.382) [-419.391] (-416.765) -- 0:00:39
      369500 -- (-415.701) (-415.969) (-419.694) [-418.594] * (-416.968) (-417.291) (-417.585) [-417.989] -- 0:00:39
      370000 -- (-415.510) [-414.763] (-416.722) (-418.342) * (-415.630) (-418.696) [-418.742] (-416.142) -- 0:00:39

      Average standard deviation of split frequencies: 0.009426

      370500 -- (-416.629) (-414.760) [-416.356] (-416.971) * (-416.411) (-416.131) (-418.865) [-418.873] -- 0:00:39
      371000 -- (-415.608) (-415.862) [-417.171] (-418.915) * [-416.357] (-416.339) (-415.658) (-419.380) -- 0:00:38
      371500 -- (-417.902) (-415.804) [-420.340] (-414.986) * (-417.649) (-416.879) (-417.685) [-417.395] -- 0:00:38
      372000 -- (-416.434) [-417.040] (-416.367) (-415.993) * (-417.752) [-417.168] (-417.483) (-415.517) -- 0:00:38
      372500 -- (-416.926) (-416.379) [-415.907] (-417.041) * (-417.118) (-416.407) [-415.158] (-417.546) -- 0:00:38
      373000 -- (-414.930) (-419.327) [-415.223] (-416.789) * (-420.789) (-419.652) (-415.250) [-414.930] -- 0:00:38
      373500 -- (-418.039) (-417.917) (-416.077) [-416.016] * (-418.455) [-419.983] (-419.562) (-417.280) -- 0:00:38
      374000 -- (-416.243) (-415.429) (-418.140) [-415.331] * [-419.637] (-417.221) (-418.764) (-415.513) -- 0:00:38
      374500 -- [-418.815] (-418.979) (-419.502) (-421.589) * (-417.399) (-416.152) (-417.797) [-417.987] -- 0:00:38
      375000 -- [-415.500] (-416.879) (-418.912) (-417.784) * (-415.026) (-416.269) [-417.192] (-418.946) -- 0:00:38

      Average standard deviation of split frequencies: 0.009735

      375500 -- [-417.204] (-417.464) (-415.339) (-418.891) * (-418.234) [-415.099] (-414.931) (-417.715) -- 0:00:38
      376000 -- (-416.253) [-418.540] (-416.043) (-418.845) * [-417.892] (-417.731) (-420.102) (-417.300) -- 0:00:38
      376500 -- [-415.069] (-421.021) (-415.428) (-417.350) * (-415.452) [-415.240] (-415.770) (-417.964) -- 0:00:38
      377000 -- (-415.041) (-417.034) [-415.580] (-417.063) * (-416.109) (-415.334) (-415.706) [-416.043] -- 0:00:38
      377500 -- (-415.543) [-419.431] (-415.240) (-416.905) * (-416.043) (-415.981) [-416.841] (-415.763) -- 0:00:37
      378000 -- (-416.636) [-416.526] (-415.138) (-418.624) * [-415.752] (-417.712) (-420.634) (-416.367) -- 0:00:37
      378500 -- (-418.254) (-415.869) [-415.596] (-415.733) * (-416.001) [-417.900] (-419.374) (-417.512) -- 0:00:37
      379000 -- [-415.293] (-417.112) (-415.596) (-419.824) * [-419.052] (-419.857) (-415.381) (-417.998) -- 0:00:37
      379500 -- (-416.851) (-419.467) (-418.509) [-422.650] * (-416.723) (-416.400) [-416.253] (-414.961) -- 0:00:37
      380000 -- [-417.204] (-416.508) (-417.663) (-418.425) * (-415.468) (-417.882) [-415.820] (-414.602) -- 0:00:37

      Average standard deviation of split frequencies: 0.008960

      380500 -- (-416.865) (-415.129) [-417.108] (-414.725) * (-415.906) [-419.118] (-415.658) (-415.132) -- 0:00:37
      381000 -- (-417.873) (-418.389) (-416.497) [-415.842] * (-419.092) [-418.063] (-417.556) (-417.443) -- 0:00:37
      381500 -- (-416.567) (-418.287) (-414.955) [-414.802] * (-419.852) (-415.506) (-417.206) [-416.036] -- 0:00:37
      382000 -- (-416.924) (-419.358) [-421.325] (-417.385) * (-416.572) [-415.687] (-415.229) (-418.587) -- 0:00:37
      382500 -- (-415.632) [-419.567] (-416.013) (-416.645) * (-418.523) (-418.472) [-417.859] (-418.651) -- 0:00:37
      383000 -- (-417.006) (-416.450) [-420.358] (-421.909) * [-417.364] (-419.036) (-417.119) (-417.186) -- 0:00:37
      383500 -- [-416.208] (-415.636) (-415.822) (-417.024) * [-417.563] (-420.638) (-416.904) (-416.835) -- 0:00:38
      384000 -- [-415.289] (-415.806) (-416.964) (-417.623) * (-416.555) (-416.104) (-416.330) [-415.428] -- 0:00:38
      384500 -- (-416.232) (-416.458) (-417.386) [-416.642] * (-415.050) (-418.580) (-417.102) [-415.491] -- 0:00:38
      385000 -- (-416.169) (-417.287) [-416.084] (-416.892) * [-415.238] (-418.296) (-415.498) (-418.442) -- 0:00:38

      Average standard deviation of split frequencies: 0.009411

      385500 -- (-416.783) (-416.730) (-415.613) [-415.557] * [-417.674] (-417.601) (-414.703) (-418.683) -- 0:00:38
      386000 -- [-419.316] (-415.925) (-416.925) (-416.673) * [-421.495] (-416.529) (-417.244) (-417.038) -- 0:00:38
      386500 -- (-416.803) (-417.034) [-417.894] (-415.378) * (-416.020) (-418.693) [-416.790] (-416.657) -- 0:00:38
      387000 -- (-420.836) [-415.902] (-416.923) (-415.336) * [-418.475] (-416.567) (-418.713) (-418.614) -- 0:00:38
      387500 -- (-421.676) (-418.411) [-415.513] (-415.187) * (-416.163) [-416.325] (-418.195) (-418.749) -- 0:00:37
      388000 -- (-418.003) [-416.287] (-417.648) (-420.516) * (-415.840) (-418.009) (-418.988) [-416.097] -- 0:00:37
      388500 -- (-417.209) (-417.398) (-418.218) [-415.895] * (-415.141) [-415.337] (-415.791) (-417.408) -- 0:00:37
      389000 -- (-417.620) [-416.155] (-417.689) (-415.794) * (-415.542) [-416.288] (-417.893) (-416.971) -- 0:00:37
      389500 -- [-419.015] (-416.317) (-420.630) (-415.271) * (-416.231) (-415.588) (-415.645) [-417.758] -- 0:00:37
      390000 -- [-415.866] (-417.396) (-417.502) (-415.234) * (-417.580) [-415.882] (-420.355) (-415.076) -- 0:00:37

      Average standard deviation of split frequencies: 0.008731

      390500 -- (-418.024) (-417.351) [-416.690] (-415.191) * (-420.495) [-416.337] (-422.725) (-417.453) -- 0:00:37
      391000 -- [-417.025] (-417.627) (-418.072) (-414.842) * (-417.626) (-416.500) [-417.580] (-418.832) -- 0:00:37
      391500 -- (-415.610) (-417.047) (-418.485) [-416.450] * (-420.059) [-419.811] (-417.825) (-416.526) -- 0:00:37
      392000 -- [-418.007] (-416.056) (-417.136) (-415.329) * (-416.025) (-419.321) [-417.451] (-417.824) -- 0:00:37
      392500 -- (-422.050) (-415.986) [-415.995] (-416.408) * (-417.594) (-414.676) [-414.914] (-418.391) -- 0:00:37
      393000 -- (-417.495) [-416.194] (-416.540) (-416.500) * (-416.528) [-415.159] (-418.545) (-417.157) -- 0:00:37
      393500 -- [-417.027] (-423.676) (-419.597) (-418.893) * (-419.222) (-419.702) [-416.774] (-416.895) -- 0:00:36
      394000 -- [-417.733] (-418.566) (-421.423) (-419.053) * (-418.291) [-417.002] (-415.137) (-415.872) -- 0:00:36
      394500 -- (-418.093) (-417.470) (-419.888) [-415.503] * (-415.773) (-414.939) (-425.186) [-417.645] -- 0:00:36
      395000 -- (-421.568) [-417.116] (-415.600) (-416.007) * (-416.495) (-415.975) (-417.928) [-415.673] -- 0:00:36

      Average standard deviation of split frequencies: 0.008263

      395500 -- (-415.753) [-416.281] (-417.397) (-415.155) * [-416.608] (-416.685) (-416.145) (-416.436) -- 0:00:36
      396000 -- (-417.579) [-420.855] (-418.988) (-416.443) * (-416.599) [-417.064] (-415.762) (-418.711) -- 0:00:36
      396500 -- (-417.447) (-417.349) [-418.151] (-415.112) * (-415.794) (-417.885) (-417.512) [-415.460] -- 0:00:36
      397000 -- (-418.221) (-418.175) (-416.375) [-416.552] * (-416.558) (-419.008) (-417.585) [-415.324] -- 0:00:36
      397500 -- (-418.029) (-423.113) [-416.568] (-416.612) * (-417.736) (-418.973) [-416.184] (-415.937) -- 0:00:36
      398000 -- (-419.365) (-417.902) [-416.612] (-416.402) * (-417.261) (-418.656) [-414.918] (-415.940) -- 0:00:36
      398500 -- [-417.015] (-419.708) (-417.579) (-415.878) * (-418.777) (-421.082) [-415.568] (-415.998) -- 0:00:36
      399000 -- (-417.058) (-421.831) (-414.972) [-418.746] * (-414.751) (-416.685) (-414.641) [-416.239] -- 0:00:36
      399500 -- (-417.250) [-415.937] (-415.113) (-416.403) * [-416.591] (-419.596) (-416.406) (-418.340) -- 0:00:36
      400000 -- (-419.263) (-416.498) (-415.425) [-417.350] * [-417.978] (-417.715) (-415.270) (-420.616) -- 0:00:36

      Average standard deviation of split frequencies: 0.007959

      400500 -- (-420.763) (-416.064) [-415.556] (-415.625) * (-419.477) (-414.805) [-417.421] (-418.438) -- 0:00:37
      401000 -- (-415.687) (-418.633) (-416.666) [-415.063] * [-415.189] (-414.728) (-421.710) (-418.116) -- 0:00:37
      401500 -- (-421.553) (-418.122) [-415.975] (-417.570) * (-415.634) [-417.190] (-416.862) (-420.622) -- 0:00:37
      402000 -- (-416.902) (-417.054) (-417.941) [-417.603] * (-418.799) [-415.875] (-417.874) (-416.295) -- 0:00:37
      402500 -- (-415.714) (-423.758) [-418.522] (-418.220) * (-417.613) (-416.434) (-419.596) [-416.003] -- 0:00:37
      403000 -- (-416.368) (-421.096) [-417.438] (-416.621) * (-418.746) (-418.094) (-416.038) [-416.585] -- 0:00:37
      403500 -- (-415.719) [-426.139] (-418.585) (-418.628) * (-419.621) (-417.579) (-415.225) [-415.005] -- 0:00:36
      404000 -- (-418.438) [-419.676] (-416.554) (-416.569) * (-417.256) (-417.736) [-416.887] (-417.441) -- 0:00:36
      404500 -- [-416.030] (-417.495) (-416.238) (-420.661) * (-419.206) (-416.150) [-416.186] (-414.986) -- 0:00:36
      405000 -- (-421.419) (-419.561) (-414.635) [-416.447] * (-426.046) (-415.891) [-416.918] (-416.471) -- 0:00:36

      Average standard deviation of split frequencies: 0.008811

      405500 -- (-419.055) (-417.353) [-415.804] (-419.067) * (-418.066) (-416.939) (-416.677) [-417.547] -- 0:00:36
      406000 -- (-417.130) [-416.775] (-415.430) (-421.589) * (-417.487) (-417.557) [-416.841] (-414.796) -- 0:00:36
      406500 -- [-417.164] (-416.498) (-415.097) (-415.502) * (-417.875) [-415.948] (-418.895) (-415.100) -- 0:00:36
      407000 -- (-419.452) [-416.642] (-415.397) (-416.707) * (-416.448) (-416.190) [-415.665] (-420.638) -- 0:00:36
      407500 -- (-417.489) [-416.959] (-417.861) (-417.811) * (-414.968) (-416.904) [-416.301] (-414.928) -- 0:00:36
      408000 -- [-417.137] (-417.650) (-418.394) (-418.321) * (-417.920) (-415.949) [-418.633] (-416.097) -- 0:00:36
      408500 -- (-417.817) (-418.818) [-416.126] (-417.405) * (-416.440) (-418.021) (-417.077) [-417.200] -- 0:00:36
      409000 -- (-417.697) [-418.018] (-416.069) (-419.324) * (-418.729) (-414.949) (-416.103) [-416.353] -- 0:00:36
      409500 -- [-415.142] (-419.727) (-417.929) (-419.866) * (-417.782) (-417.691) (-416.693) [-416.495] -- 0:00:36
      410000 -- (-415.377) (-415.502) [-418.693] (-419.004) * [-415.765] (-419.129) (-416.304) (-417.674) -- 0:00:35

      Average standard deviation of split frequencies: 0.009318

      410500 -- (-418.303) [-415.079] (-415.828) (-419.157) * (-417.325) (-418.325) (-418.035) [-417.446] -- 0:00:35
      411000 -- (-415.209) (-420.516) [-418.607] (-415.835) * (-416.912) (-415.942) (-420.712) [-416.064] -- 0:00:35
      411500 -- (-417.862) [-421.302] (-415.475) (-416.245) * (-416.075) (-416.688) [-419.244] (-415.616) -- 0:00:35
      412000 -- (-417.006) [-416.063] (-420.459) (-419.116) * [-415.286] (-420.120) (-415.734) (-418.306) -- 0:00:35
      412500 -- (-418.190) (-416.979) (-417.523) [-418.742] * [-416.548] (-417.009) (-415.960) (-420.388) -- 0:00:35
      413000 -- (-416.501) [-414.709] (-417.736) (-417.503) * (-416.192) [-417.347] (-417.749) (-419.684) -- 0:00:35
      413500 -- (-416.785) [-414.777] (-419.611) (-418.155) * (-416.517) (-416.867) [-415.226] (-419.753) -- 0:00:35
      414000 -- [-419.557] (-414.804) (-416.502) (-419.699) * [-418.402] (-418.632) (-418.043) (-419.238) -- 0:00:35
      414500 -- (-416.664) (-416.668) (-417.037) [-417.634] * (-417.235) (-419.296) (-416.005) [-415.605] -- 0:00:35
      415000 -- (-415.635) (-415.259) [-416.351] (-415.894) * (-416.656) [-420.223] (-415.204) (-416.797) -- 0:00:35

      Average standard deviation of split frequencies: 0.008999

      415500 -- [-414.797] (-417.774) (-418.889) (-417.674) * (-415.404) (-418.314) (-417.335) [-422.135] -- 0:00:35
      416000 -- (-417.827) (-418.767) (-416.549) [-418.123] * [-418.006] (-422.482) (-417.232) (-421.202) -- 0:00:35
      416500 -- (-422.460) (-415.457) (-415.453) [-415.869] * (-416.858) (-417.218) [-418.467] (-416.324) -- 0:00:35
      417000 -- (-417.493) [-416.361] (-416.223) (-417.915) * [-417.036] (-421.335) (-417.443) (-415.387) -- 0:00:34
      417500 -- (-417.610) (-415.733) (-415.395) [-420.639] * (-415.661) (-416.370) [-416.797] (-415.759) -- 0:00:36
      418000 -- (-421.159) (-417.693) (-419.295) [-418.718] * (-416.245) [-416.319] (-415.842) (-416.282) -- 0:00:36
      418500 -- [-417.948] (-416.697) (-417.373) (-418.389) * [-416.787] (-415.274) (-415.713) (-415.508) -- 0:00:36
      419000 -- (-417.941) [-415.752] (-416.680) (-418.091) * (-421.635) (-418.712) (-415.538) [-415.033] -- 0:00:36
      419500 -- [-415.262] (-420.131) (-414.899) (-416.596) * (-423.383) (-415.882) (-418.266) [-416.903] -- 0:00:35
      420000 -- [-416.072] (-417.854) (-415.775) (-417.929) * [-417.155] (-418.057) (-416.978) (-418.307) -- 0:00:35

      Average standard deviation of split frequencies: 0.010020

      420500 -- (-416.371) [-417.721] (-419.759) (-416.511) * (-416.141) (-416.151) [-418.114] (-417.142) -- 0:00:35
      421000 -- [-416.852] (-416.933) (-416.972) (-416.378) * (-416.438) [-416.733] (-417.555) (-415.838) -- 0:00:35
      421500 -- (-417.210) (-415.596) [-416.235] (-417.922) * (-415.502) (-418.413) (-416.284) [-417.616] -- 0:00:35
      422000 -- [-416.555] (-418.122) (-419.091) (-417.930) * [-415.845] (-419.162) (-416.712) (-415.118) -- 0:00:35
      422500 -- (-417.798) (-419.705) (-420.034) [-423.970] * (-417.039) (-415.617) (-415.041) [-415.994] -- 0:00:35
      423000 -- (-423.756) [-415.147] (-418.649) (-416.673) * (-421.177) [-418.671] (-415.992) (-418.306) -- 0:00:35
      423500 -- (-415.216) [-416.184] (-416.983) (-416.965) * (-414.970) (-415.678) [-416.966] (-417.655) -- 0:00:35
      424000 -- (-416.834) [-418.849] (-420.970) (-417.069) * (-416.175) [-416.572] (-418.223) (-418.267) -- 0:00:35
      424500 -- (-415.884) (-415.732) (-420.647) [-420.284] * (-417.547) [-415.056] (-417.660) (-418.879) -- 0:00:35
      425000 -- (-416.126) [-416.049] (-416.466) (-421.272) * [-415.411] (-415.717) (-417.509) (-415.408) -- 0:00:35

      Average standard deviation of split frequencies: 0.009764

      425500 -- (-419.278) (-416.507) [-415.408] (-415.508) * (-419.228) (-416.309) [-417.423] (-417.030) -- 0:00:35
      426000 -- (-419.317) [-415.086] (-414.904) (-421.187) * (-420.944) (-418.097) (-415.808) [-415.221] -- 0:00:35
      426500 -- (-418.990) [-415.916] (-416.903) (-418.875) * (-424.251) (-417.211) (-418.078) [-415.060] -- 0:00:34
      427000 -- (-417.722) [-417.154] (-414.968) (-415.705) * (-419.425) (-417.156) (-418.232) [-418.483] -- 0:00:34
      427500 -- (-418.250) [-416.174] (-416.085) (-416.911) * [-416.138] (-416.836) (-416.917) (-415.525) -- 0:00:34
      428000 -- (-419.251) [-418.531] (-416.708) (-417.054) * (-416.592) (-419.749) [-415.515] (-417.402) -- 0:00:34
      428500 -- (-416.833) [-417.096] (-419.390) (-415.443) * (-417.289) (-418.572) [-416.078] (-416.396) -- 0:00:34
      429000 -- (-415.072) (-422.201) (-418.583) [-416.026] * [-415.364] (-421.914) (-416.067) (-416.871) -- 0:00:34
      429500 -- [-416.815] (-423.398) (-417.506) (-416.680) * (-417.788) (-415.290) [-417.276] (-418.192) -- 0:00:34
      430000 -- (-418.122) [-416.271] (-420.276) (-419.305) * (-418.716) (-417.414) [-417.528] (-421.291) -- 0:00:34

      Average standard deviation of split frequencies: 0.009061

      430500 -- (-417.081) (-415.245) [-417.971] (-421.176) * (-416.155) (-415.529) (-417.138) [-417.404] -- 0:00:34
      431000 -- (-415.545) (-416.886) (-421.393) [-418.397] * (-419.334) [-415.255] (-415.816) (-418.026) -- 0:00:34
      431500 -- (-416.857) (-416.569) (-415.867) [-418.985] * (-419.757) (-417.296) [-416.014] (-418.763) -- 0:00:34
      432000 -- [-418.866] (-416.842) (-415.654) (-418.324) * [-416.077] (-417.498) (-416.631) (-421.861) -- 0:00:34
      432500 -- [-416.739] (-416.923) (-415.153) (-416.513) * (-415.008) (-417.461) [-418.083] (-418.910) -- 0:00:34
      433000 -- (-417.484) [-415.398] (-417.583) (-420.542) * (-414.803) (-419.174) [-417.326] (-418.279) -- 0:00:34
      433500 -- (-418.705) (-416.817) [-415.523] (-415.171) * [-415.086] (-417.169) (-415.622) (-417.902) -- 0:00:33
      434000 -- (-415.798) [-416.200] (-416.082) (-416.068) * (-416.624) (-415.255) (-419.089) [-420.312] -- 0:00:33
      434500 -- (-415.944) (-416.524) [-416.211] (-415.638) * (-418.182) [-414.767] (-417.135) (-420.067) -- 0:00:35
      435000 -- (-416.273) (-421.651) [-415.693] (-416.167) * (-418.183) (-415.495) [-415.924] (-419.514) -- 0:00:35

      Average standard deviation of split frequencies: 0.008770

      435500 -- (-417.054) (-417.755) (-417.713) [-418.162] * (-416.774) (-415.612) [-419.915] (-420.777) -- 0:00:34
      436000 -- (-416.944) (-415.724) [-416.034] (-422.883) * (-415.544) [-416.296] (-416.189) (-417.309) -- 0:00:34
      436500 -- (-418.447) (-416.974) [-415.650] (-416.052) * (-417.431) (-415.324) [-414.982] (-416.481) -- 0:00:34
      437000 -- (-415.852) [-415.795] (-416.664) (-415.450) * (-415.698) [-416.704] (-415.156) (-416.399) -- 0:00:34
      437500 -- (-416.319) (-416.235) (-417.549) [-415.283] * (-417.040) (-421.587) (-416.654) [-416.418] -- 0:00:34
      438000 -- [-418.413] (-420.717) (-420.433) (-417.278) * (-419.601) (-419.928) [-420.064] (-415.638) -- 0:00:34
      438500 -- [-418.566] (-415.302) (-415.541) (-422.206) * (-414.576) (-416.625) [-415.387] (-415.491) -- 0:00:34
      439000 -- (-415.814) (-416.655) [-417.073] (-423.223) * (-415.807) (-416.760) [-415.338] (-417.840) -- 0:00:34
      439500 -- (-416.083) [-420.090] (-416.872) (-416.908) * (-417.321) (-417.185) (-418.940) [-416.304] -- 0:00:34
      440000 -- (-418.514) (-417.451) [-419.732] (-415.695) * (-418.267) (-416.330) (-416.226) [-415.508] -- 0:00:34

      Average standard deviation of split frequencies: 0.009628

      440500 -- (-418.496) [-418.686] (-418.436) (-419.476) * [-417.671] (-417.038) (-418.088) (-418.909) -- 0:00:34
      441000 -- [-416.091] (-416.959) (-418.909) (-423.393) * (-422.731) (-416.019) (-419.237) [-417.302] -- 0:00:34
      441500 -- [-416.431] (-415.645) (-415.977) (-418.384) * (-417.063) (-418.050) [-418.543] (-416.087) -- 0:00:34
      442000 -- [-420.211] (-421.438) (-417.577) (-418.285) * (-416.447) (-425.199) [-414.867] (-416.639) -- 0:00:34
      442500 -- [-416.389] (-417.366) (-417.110) (-415.936) * (-418.144) [-417.953] (-417.595) (-416.583) -- 0:00:34
      443000 -- (-417.427) (-414.859) [-416.290] (-416.421) * (-416.193) (-418.527) (-415.548) [-418.789] -- 0:00:33
      443500 -- (-416.949) [-417.058] (-417.600) (-416.255) * (-416.200) [-416.031] (-415.390) (-417.785) -- 0:00:33
      444000 -- (-417.443) (-416.480) [-418.361] (-419.411) * (-415.764) (-417.777) [-417.304] (-419.110) -- 0:00:33
      444500 -- (-417.715) (-419.599) [-416.063] (-420.317) * [-416.644] (-415.086) (-415.391) (-415.435) -- 0:00:33
      445000 -- (-417.626) [-416.546] (-418.280) (-421.759) * (-414.917) (-417.224) (-417.354) [-417.454] -- 0:00:33

      Average standard deviation of split frequencies: 0.009761

      445500 -- (-417.316) (-417.234) (-417.692) [-415.913] * (-416.203) (-417.377) [-418.161] (-417.156) -- 0:00:33
      446000 -- (-416.462) (-417.455) [-415.167] (-419.360) * (-416.474) (-417.444) [-416.072] (-418.292) -- 0:00:33
      446500 -- [-420.197] (-415.536) (-417.585) (-415.746) * [-418.079] (-417.040) (-417.016) (-417.156) -- 0:00:33
      447000 -- (-417.678) (-417.422) (-418.569) [-414.818] * (-417.148) [-418.476] (-417.195) (-418.670) -- 0:00:33
      447500 -- (-419.025) (-418.627) (-416.316) [-415.051] * (-418.063) (-418.033) (-416.912) [-417.106] -- 0:00:33
      448000 -- [-418.695] (-422.027) (-418.467) (-419.075) * (-416.620) (-421.837) [-415.762] (-418.437) -- 0:00:33
      448500 -- [-418.783] (-419.731) (-421.853) (-423.303) * (-415.773) (-418.086) (-418.825) [-415.817] -- 0:00:33
      449000 -- (-419.261) [-418.259] (-416.979) (-416.713) * (-418.691) (-417.322) (-418.697) [-415.265] -- 0:00:33
      449500 -- [-415.871] (-418.924) (-417.423) (-418.090) * (-416.438) [-415.546] (-418.787) (-419.253) -- 0:00:33
      450000 -- (-416.040) (-421.026) (-419.942) [-415.521] * (-416.801) (-419.953) [-418.810] (-415.819) -- 0:00:33

      Average standard deviation of split frequencies: 0.010337

      450500 -- [-420.071] (-417.110) (-416.636) (-416.905) * [-415.518] (-417.523) (-417.383) (-417.351) -- 0:00:32
      451000 -- (-415.456) [-415.100] (-418.059) (-418.818) * [-417.830] (-414.979) (-416.284) (-416.795) -- 0:00:34
      451500 -- [-415.864] (-417.853) (-416.310) (-418.175) * [-416.894] (-415.505) (-417.735) (-416.743) -- 0:00:34
      452000 -- (-416.781) (-418.403) (-415.345) [-415.316] * (-418.001) (-416.195) (-415.859) [-415.837] -- 0:00:33
      452500 -- (-418.113) (-416.268) [-416.708] (-416.329) * (-417.455) (-417.255) [-416.392] (-416.796) -- 0:00:33
      453000 -- (-415.790) (-415.775) [-414.950] (-418.765) * (-415.026) (-416.191) (-415.017) [-417.209] -- 0:00:33
      453500 -- [-418.792] (-416.097) (-415.995) (-416.545) * (-415.493) [-417.026] (-416.948) (-416.828) -- 0:00:33
      454000 -- (-416.974) (-418.976) [-416.800] (-419.144) * (-416.430) (-416.659) [-421.123] (-417.336) -- 0:00:33
      454500 -- (-422.407) (-417.704) [-417.887] (-417.108) * [-416.076] (-418.269) (-417.797) (-416.476) -- 0:00:33
      455000 -- [-417.237] (-416.415) (-416.983) (-419.372) * (-416.105) (-420.114) (-418.318) [-415.882] -- 0:00:33

      Average standard deviation of split frequencies: 0.010581

      455500 -- [-418.562] (-416.457) (-417.832) (-417.334) * (-415.433) (-415.393) [-416.203] (-415.252) -- 0:00:33
      456000 -- (-415.812) [-416.513] (-415.978) (-415.523) * [-417.815] (-417.085) (-415.475) (-416.108) -- 0:00:33
      456500 -- [-416.175] (-416.779) (-416.604) (-415.474) * [-419.083] (-416.413) (-417.100) (-415.734) -- 0:00:33
      457000 -- (-418.427) (-417.090) [-415.984] (-417.052) * [-415.810] (-415.783) (-419.311) (-418.365) -- 0:00:33
      457500 -- (-417.223) [-417.669] (-416.587) (-416.079) * (-416.923) (-417.867) (-421.695) [-416.516] -- 0:00:33
      458000 -- (-416.995) [-417.630] (-416.884) (-418.594) * (-423.355) [-417.619] (-418.628) (-414.829) -- 0:00:33
      458500 -- (-419.332) [-418.674] (-415.794) (-422.670) * (-419.666) (-422.311) [-424.995] (-415.795) -- 0:00:33
      459000 -- (-415.614) (-416.707) [-415.668] (-416.211) * (-426.454) [-420.262] (-417.224) (-418.246) -- 0:00:33
      459500 -- [-416.549] (-417.192) (-418.358) (-417.927) * (-415.421) (-415.589) [-416.869] (-417.703) -- 0:00:32
      460000 -- (-416.331) [-417.085] (-415.464) (-415.788) * (-415.113) (-416.045) [-416.432] (-419.565) -- 0:00:32

      Average standard deviation of split frequencies: 0.009992

      460500 -- (-417.251) [-415.147] (-423.801) (-415.562) * (-415.776) (-416.920) [-418.906] (-416.426) -- 0:00:32
      461000 -- [-420.093] (-415.646) (-417.797) (-416.419) * (-416.073) (-415.662) [-417.597] (-418.977) -- 0:00:32
      461500 -- (-416.271) (-415.803) [-417.708] (-415.299) * (-418.654) (-416.292) [-416.874] (-416.104) -- 0:00:32
      462000 -- [-415.671] (-416.619) (-415.399) (-415.248) * (-417.030) (-417.462) [-415.792] (-415.591) -- 0:00:32
      462500 -- (-417.003) (-415.779) [-414.879] (-418.162) * [-416.753] (-416.270) (-418.833) (-416.656) -- 0:00:32
      463000 -- [-419.896] (-418.718) (-416.155) (-417.243) * (-416.670) (-416.814) (-420.222) [-415.939] -- 0:00:32
      463500 -- (-418.524) (-415.083) [-416.427] (-417.818) * [-415.491] (-418.616) (-422.043) (-419.711) -- 0:00:32
      464000 -- (-415.202) [-416.159] (-420.793) (-420.443) * [-417.200] (-415.656) (-419.511) (-417.841) -- 0:00:32
      464500 -- (-417.613) (-416.474) (-419.339) [-418.851] * (-416.360) (-415.245) [-417.275] (-415.798) -- 0:00:32
      465000 -- (-417.308) (-417.521) [-415.905] (-416.867) * (-417.448) [-417.775] (-417.265) (-415.900) -- 0:00:32

      Average standard deviation of split frequencies: 0.009818

      465500 -- (-416.655) (-421.824) [-416.895] (-418.805) * [-419.018] (-417.166) (-415.363) (-420.110) -- 0:00:32
      466000 -- (-415.920) (-419.061) (-416.198) [-420.695] * (-415.902) (-415.859) (-417.064) [-415.825] -- 0:00:32
      466500 -- (-418.808) [-415.536] (-416.589) (-417.926) * (-417.373) [-415.637] (-414.663) (-415.700) -- 0:00:32
      467000 -- (-419.153) [-418.508] (-417.106) (-415.263) * (-421.412) [-417.432] (-415.833) (-415.359) -- 0:00:31
      467500 -- [-415.294] (-419.221) (-417.674) (-418.845) * (-417.939) (-418.421) (-417.569) [-416.178] -- 0:00:33
      468000 -- [-416.879] (-416.981) (-415.802) (-415.567) * [-415.542] (-417.118) (-423.185) (-415.133) -- 0:00:32
      468500 -- (-418.298) (-424.234) [-419.730] (-415.547) * (-417.186) [-416.902] (-416.098) (-415.143) -- 0:00:32
      469000 -- [-416.466] (-420.549) (-416.075) (-417.795) * [-416.410] (-420.240) (-419.368) (-419.555) -- 0:00:32
      469500 -- (-419.895) [-419.261] (-415.601) (-419.544) * (-416.525) (-418.700) [-416.314] (-417.715) -- 0:00:32
      470000 -- [-416.571] (-417.078) (-417.277) (-421.206) * (-419.911) [-416.392] (-415.313) (-426.053) -- 0:00:32

      Average standard deviation of split frequencies: 0.009662

      470500 -- (-415.977) (-415.161) [-420.636] (-417.728) * (-418.320) (-415.216) [-417.485] (-419.633) -- 0:00:32
      471000 -- (-416.238) (-417.884) (-415.721) [-415.197] * [-415.735] (-416.158) (-416.882) (-421.732) -- 0:00:32
      471500 -- (-421.900) (-418.034) (-418.473) [-415.145] * (-418.007) (-415.611) [-416.506] (-417.984) -- 0:00:32
      472000 -- (-416.123) [-417.487] (-420.928) (-414.958) * (-416.950) (-416.463) (-416.844) [-416.401] -- 0:00:32
      472500 -- (-415.232) (-416.037) [-416.470] (-417.059) * (-415.769) [-417.980] (-416.868) (-418.186) -- 0:00:32
      473000 -- (-417.173) [-420.621] (-417.174) (-415.809) * (-415.692) (-416.505) (-421.898) [-417.883] -- 0:00:32
      473500 -- (-415.040) (-422.090) [-417.968] (-417.177) * [-417.123] (-421.062) (-422.212) (-418.106) -- 0:00:32
      474000 -- (-415.726) [-415.409] (-417.235) (-416.990) * (-420.239) (-418.055) (-420.099) [-417.528] -- 0:00:32
      474500 -- (-417.745) (-416.134) (-417.396) [-414.831] * (-419.997) (-417.043) (-415.799) [-416.949] -- 0:00:32
      475000 -- (-416.862) [-416.160] (-418.127) (-417.405) * (-417.871) (-417.760) (-417.018) [-417.946] -- 0:00:32

      Average standard deviation of split frequencies: 0.009496

      475500 -- (-418.353) [-415.678] (-415.673) (-419.691) * [-417.725] (-415.659) (-416.673) (-420.816) -- 0:00:31
      476000 -- (-417.469) (-416.956) (-414.783) [-417.133] * (-420.004) (-419.150) (-415.831) [-418.466] -- 0:00:31
      476500 -- (-415.947) (-423.756) [-418.665] (-415.649) * (-420.240) [-416.314] (-418.047) (-421.019) -- 0:00:31
      477000 -- (-417.492) [-417.134] (-420.162) (-418.040) * [-421.612] (-418.641) (-421.070) (-415.083) -- 0:00:31
      477500 -- (-417.458) [-417.679] (-418.081) (-416.979) * (-420.643) (-418.821) (-419.478) [-420.313] -- 0:00:31
      478000 -- (-415.912) (-419.592) [-416.310] (-418.014) * [-418.749] (-418.107) (-418.154) (-416.475) -- 0:00:31
      478500 -- (-420.524) (-417.751) [-418.227] (-417.362) * (-417.859) (-416.407) [-415.444] (-421.255) -- 0:00:31
      479000 -- (-414.781) (-418.219) [-418.251] (-414.865) * [-416.105] (-416.407) (-417.077) (-417.032) -- 0:00:31
      479500 -- (-415.865) (-415.725) (-415.207) [-415.685] * (-415.340) [-416.469] (-420.591) (-415.065) -- 0:00:31
      480000 -- (-417.973) [-419.443] (-418.468) (-422.501) * (-415.841) [-417.153] (-417.196) (-415.536) -- 0:00:31

      Average standard deviation of split frequencies: 0.009577

      480500 -- (-416.685) (-416.244) (-415.661) [-421.819] * [-416.626] (-420.399) (-418.678) (-415.154) -- 0:00:31
      481000 -- (-417.227) (-417.886) [-418.858] (-419.602) * (-415.824) (-418.836) [-419.184] (-415.565) -- 0:00:31
      481500 -- (-417.472) [-419.355] (-416.364) (-419.819) * (-416.120) (-414.729) [-419.627] (-417.842) -- 0:00:31
      482000 -- [-416.987] (-421.948) (-415.842) (-416.021) * (-414.782) (-414.653) [-422.050] (-416.156) -- 0:00:31
      482500 -- (-415.783) [-417.368] (-418.299) (-416.255) * [-415.906] (-414.931) (-423.016) (-419.358) -- 0:00:31
      483000 -- [-416.297] (-419.933) (-416.949) (-419.688) * [-416.361] (-417.055) (-415.379) (-418.898) -- 0:00:31
      483500 -- (-419.452) (-416.805) (-415.952) [-418.185] * (-419.784) (-416.643) (-417.423) [-415.442] -- 0:00:30
      484000 -- (-418.591) (-416.759) [-417.392] (-415.257) * (-419.317) (-415.205) [-421.052] (-416.933) -- 0:00:30
      484500 -- (-419.551) (-415.648) (-420.202) [-417.965] * [-416.512] (-415.395) (-417.198) (-416.404) -- 0:00:31
      485000 -- (-416.921) [-416.649] (-421.950) (-418.466) * [-415.730] (-415.632) (-416.696) (-414.621) -- 0:00:31

      Average standard deviation of split frequencies: 0.009243

      485500 -- (-417.403) [-417.828] (-416.955) (-417.920) * (-421.237) (-416.602) (-417.396) [-415.379] -- 0:00:31
      486000 -- (-414.779) (-416.869) (-416.779) [-415.696] * (-421.600) (-415.685) [-416.179] (-417.791) -- 0:00:31
      486500 -- (-420.375) [-420.579] (-417.813) (-416.831) * (-416.175) (-417.528) [-417.710] (-416.568) -- 0:00:31
      487000 -- (-417.362) [-416.509] (-420.693) (-417.724) * (-415.113) (-418.427) [-415.951] (-417.128) -- 0:00:31
      487500 -- [-415.895] (-416.462) (-421.089) (-415.521) * (-417.057) [-415.919] (-415.067) (-417.933) -- 0:00:31
      488000 -- (-417.885) (-420.098) [-415.746] (-416.332) * (-419.998) (-418.347) [-416.534] (-415.847) -- 0:00:31
      488500 -- (-417.471) [-421.249] (-420.094) (-417.214) * (-415.030) [-416.426] (-416.950) (-419.001) -- 0:00:31
      489000 -- (-417.388) (-417.423) (-418.058) [-415.635] * [-415.060] (-416.654) (-419.297) (-416.379) -- 0:00:31
      489500 -- (-414.935) (-420.733) [-414.606] (-416.424) * (-417.533) (-415.415) [-416.132] (-415.913) -- 0:00:31
      490000 -- (-417.597) (-417.224) (-415.733) [-417.731] * (-417.404) (-417.416) (-416.954) [-414.859] -- 0:00:31

      Average standard deviation of split frequencies: 0.009833

      490500 -- [-417.962] (-417.075) (-417.219) (-416.039) * (-418.983) (-419.999) [-417.039] (-417.732) -- 0:00:31
      491000 -- (-414.954) (-417.968) [-416.653] (-417.069) * (-418.517) [-416.658] (-418.498) (-419.006) -- 0:00:31
      491500 -- (-416.941) (-418.320) [-416.443] (-417.659) * (-420.509) (-419.411) [-416.772] (-416.319) -- 0:00:31
      492000 -- [-416.736] (-416.587) (-416.873) (-416.796) * [-421.924] (-416.394) (-417.853) (-417.183) -- 0:00:30
      492500 -- (-420.978) (-415.749) (-424.163) [-417.007] * (-422.898) (-417.628) (-418.711) [-415.837] -- 0:00:30
      493000 -- (-416.525) [-415.438] (-421.427) (-416.665) * (-419.161) (-416.708) (-420.675) [-415.461] -- 0:00:30
      493500 -- (-417.844) (-421.429) (-416.768) [-415.700] * (-420.150) [-415.625] (-416.104) (-418.415) -- 0:00:30
      494000 -- (-415.889) [-422.971] (-415.880) (-416.383) * (-422.547) (-415.806) [-415.753] (-417.966) -- 0:00:30
      494500 -- (-416.135) [-416.912] (-416.403) (-415.720) * (-417.660) (-417.044) [-416.704] (-423.960) -- 0:00:30
      495000 -- (-416.661) (-416.488) [-417.044] (-417.954) * (-417.596) (-414.693) [-416.325] (-416.185) -- 0:00:30

      Average standard deviation of split frequencies: 0.010063

      495500 -- (-422.334) (-415.927) [-417.124] (-417.184) * (-416.701) (-415.715) (-416.605) [-416.886] -- 0:00:30
      496000 -- (-421.928) (-418.410) [-415.597] (-416.227) * (-418.164) (-417.353) [-416.001] (-416.145) -- 0:00:30
      496500 -- (-417.130) [-415.536] (-416.105) (-418.484) * (-416.789) [-415.898] (-417.315) (-415.471) -- 0:00:30
      497000 -- (-415.794) (-415.785) [-416.496] (-420.021) * (-419.525) [-422.468] (-415.984) (-415.509) -- 0:00:30
      497500 -- (-414.685) (-416.871) [-415.272] (-421.456) * [-422.058] (-417.106) (-415.582) (-415.469) -- 0:00:30
      498000 -- (-417.527) (-417.045) [-422.522] (-417.030) * [-417.930] (-418.856) (-415.356) (-417.697) -- 0:00:30
      498500 -- (-417.360) (-416.948) (-418.138) [-418.050] * [-415.775] (-417.485) (-415.699) (-417.368) -- 0:00:30
      499000 -- [-417.720] (-416.572) (-416.487) (-418.556) * (-416.158) (-416.366) (-417.238) [-417.759] -- 0:00:30
      499500 -- [-416.361] (-415.928) (-420.091) (-419.040) * [-415.413] (-417.693) (-415.030) (-418.841) -- 0:00:30
      500000 -- [-417.352] (-416.407) (-416.246) (-417.560) * (-416.820) (-416.587) [-415.754] (-417.354) -- 0:00:30

      Average standard deviation of split frequencies: 0.010357

      500500 -- (-417.452) (-416.221) [-417.418] (-420.293) * [-419.845] (-415.130) (-416.285) (-418.937) -- 0:00:30
      501000 -- (-420.622) (-414.929) [-418.524] (-416.500) * [-414.966] (-422.504) (-418.437) (-417.122) -- 0:00:30
      501500 -- [-416.795] (-415.234) (-418.052) (-416.692) * (-415.619) (-418.939) [-418.425] (-415.724) -- 0:00:30
      502000 -- (-418.927) (-417.196) [-415.658] (-417.575) * (-417.013) (-417.530) [-421.705] (-417.161) -- 0:00:30
      502500 -- [-419.029] (-420.260) (-418.441) (-417.069) * (-419.196) (-418.974) (-416.713) [-416.286] -- 0:00:30
      503000 -- [-416.464] (-416.954) (-416.183) (-418.538) * (-417.656) (-418.330) [-415.724] (-417.254) -- 0:00:30
      503500 -- (-417.683) (-416.549) [-415.477] (-416.267) * (-416.240) (-416.122) (-416.975) [-415.474] -- 0:00:30
      504000 -- (-417.101) (-416.118) [-420.488] (-418.244) * (-422.083) (-416.766) (-420.152) [-417.207] -- 0:00:30
      504500 -- [-417.668] (-416.631) (-417.081) (-417.956) * [-416.619] (-417.826) (-417.458) (-416.155) -- 0:00:30
      505000 -- (-417.804) [-418.452] (-418.175) (-415.742) * (-415.765) (-415.905) [-415.757] (-419.446) -- 0:00:30

      Average standard deviation of split frequencies: 0.010029

      505500 -- (-415.540) (-418.224) (-415.987) [-416.180] * [-417.805] (-415.873) (-417.233) (-422.235) -- 0:00:30
      506000 -- [-415.502] (-416.230) (-419.200) (-415.223) * [-421.134] (-416.762) (-415.511) (-418.743) -- 0:00:30
      506500 -- [-415.565] (-415.399) (-416.993) (-418.624) * [-419.778] (-418.918) (-416.402) (-418.058) -- 0:00:30
      507000 -- (-416.499) (-418.158) [-416.251] (-416.938) * (-417.895) (-415.155) [-416.115] (-416.033) -- 0:00:30
      507500 -- (-417.004) (-416.582) (-420.774) [-415.430] * (-417.196) [-417.053] (-419.407) (-417.340) -- 0:00:30
      508000 -- (-420.363) [-414.960] (-415.717) (-418.566) * (-417.431) (-416.155) [-417.777] (-418.564) -- 0:00:30
      508500 -- (-417.031) (-416.034) (-418.421) [-416.313] * (-417.505) (-418.644) [-415.445] (-421.814) -- 0:00:29
      509000 -- (-420.649) (-415.996) [-416.774] (-418.039) * (-416.336) [-415.162] (-415.847) (-418.046) -- 0:00:29
      509500 -- (-415.493) (-417.271) (-417.452) [-416.024] * (-416.501) (-414.832) [-416.393] (-418.920) -- 0:00:29
      510000 -- (-415.538) (-416.713) [-415.981] (-416.469) * (-415.920) (-415.291) (-416.676) [-415.591] -- 0:00:29

      Average standard deviation of split frequencies: 0.010046

      510500 -- (-419.743) [-415.719] (-415.259) (-416.157) * (-416.028) (-418.853) [-416.599] (-415.919) -- 0:00:29
      511000 -- (-419.772) [-416.811] (-419.990) (-416.242) * (-415.403) (-416.546) (-430.925) [-415.282] -- 0:00:29
      511500 -- [-415.376] (-416.493) (-419.590) (-415.812) * (-415.175) (-417.931) (-417.792) [-415.928] -- 0:00:29
      512000 -- [-415.093] (-417.533) (-415.437) (-416.985) * (-416.005) (-417.928) (-419.872) [-416.543] -- 0:00:29
      512500 -- (-416.691) (-415.415) (-417.842) [-417.610] * [-416.300] (-417.070) (-417.436) (-416.934) -- 0:00:29
      513000 -- (-417.988) (-419.558) [-416.598] (-416.785) * (-417.580) (-416.299) (-423.593) [-421.167] -- 0:00:29
      513500 -- (-416.791) (-418.208) [-415.502] (-415.142) * (-415.245) (-415.302) [-415.759] (-415.166) -- 0:00:29
      514000 -- (-418.002) (-418.672) (-418.215) [-414.973] * (-422.653) (-416.476) (-419.128) [-415.803] -- 0:00:29
      514500 -- (-416.257) [-420.212] (-416.587) (-417.112) * (-418.917) [-419.424] (-423.463) (-417.880) -- 0:00:29
      515000 -- (-416.275) (-415.785) (-417.102) [-416.243] * (-420.984) (-416.996) [-415.495] (-416.075) -- 0:00:29

      Average standard deviation of split frequencies: 0.009942

      515500 -- (-416.559) (-417.332) (-421.900) [-417.662] * (-415.851) [-416.239] (-418.545) (-417.655) -- 0:00:30
      516000 -- (-415.296) [-416.640] (-415.918) (-416.403) * (-415.224) (-418.051) (-418.257) [-419.135] -- 0:00:30
      516500 -- (-415.667) [-418.930] (-417.106) (-415.694) * (-415.920) (-416.440) [-416.811] (-416.093) -- 0:00:29
      517000 -- (-416.082) (-420.004) [-415.819] (-415.803) * (-419.017) (-415.674) [-416.306] (-416.327) -- 0:00:29
      517500 -- [-415.522] (-418.085) (-417.196) (-414.880) * (-416.578) (-414.894) [-418.086] (-417.612) -- 0:00:29
      518000 -- [-416.802] (-417.401) (-415.968) (-419.311) * (-417.414) [-415.616] (-418.089) (-421.273) -- 0:00:29
      518500 -- (-415.834) (-416.171) [-416.887] (-419.799) * (-417.319) (-415.719) [-415.799] (-419.839) -- 0:00:29
      519000 -- [-417.388] (-417.126) (-419.671) (-419.769) * [-416.429] (-419.405) (-420.097) (-416.183) -- 0:00:29
      519500 -- [-418.934] (-414.793) (-417.310) (-415.929) * [-416.096] (-417.027) (-418.223) (-416.995) -- 0:00:29
      520000 -- [-416.593] (-415.729) (-418.767) (-418.472) * (-417.613) [-416.366] (-417.962) (-419.240) -- 0:00:29

      Average standard deviation of split frequencies: 0.008658

      520500 -- (-418.874) (-416.764) [-419.150] (-416.488) * [-422.399] (-419.607) (-416.379) (-421.771) -- 0:00:29
      521000 -- (-415.283) [-418.690] (-421.265) (-416.597) * (-420.443) (-415.221) (-417.582) [-415.184] -- 0:00:29
      521500 -- (-415.955) (-416.214) [-415.207] (-417.319) * (-416.362) [-416.329] (-416.195) (-415.962) -- 0:00:29
      522000 -- (-418.216) (-416.133) [-417.047] (-418.799) * (-418.709) (-416.916) [-418.963] (-416.722) -- 0:00:29
      522500 -- (-417.883) (-415.409) [-420.142] (-419.773) * [-416.114] (-417.622) (-417.890) (-417.196) -- 0:00:29
      523000 -- [-417.119] (-417.845) (-419.990) (-416.558) * [-416.578] (-416.888) (-419.092) (-416.068) -- 0:00:29
      523500 -- [-415.100] (-417.566) (-420.050) (-415.099) * (-419.868) (-416.398) [-416.532] (-416.124) -- 0:00:29
      524000 -- [-416.874] (-417.678) (-416.022) (-418.014) * (-421.632) [-416.550] (-415.511) (-415.777) -- 0:00:29
      524500 -- [-417.154] (-416.910) (-415.223) (-416.292) * [-416.867] (-421.961) (-416.822) (-416.303) -- 0:00:29
      525000 -- (-419.365) (-415.455) [-415.097] (-420.192) * (-421.268) (-416.122) (-416.579) [-416.131] -- 0:00:28

      Average standard deviation of split frequencies: 0.009278

      525500 -- [-415.906] (-416.353) (-414.821) (-417.796) * (-418.068) [-415.738] (-415.239) (-419.030) -- 0:00:28
      526000 -- [-419.518] (-416.485) (-414.837) (-416.837) * [-417.717] (-416.183) (-418.599) (-415.609) -- 0:00:28
      526500 -- (-418.213) (-416.978) (-415.353) [-416.011] * (-416.878) [-415.419] (-417.569) (-418.577) -- 0:00:28
      527000 -- (-418.995) [-418.199] (-416.436) (-415.957) * (-415.475) [-418.320] (-416.734) (-417.683) -- 0:00:28
      527500 -- (-415.738) (-418.350) [-417.151] (-417.069) * (-422.225) (-417.447) (-416.655) [-419.780] -- 0:00:28
      528000 -- (-416.025) (-416.169) [-416.703] (-415.951) * (-419.101) (-419.924) (-416.498) [-417.773] -- 0:00:28
      528500 -- (-417.996) [-415.536] (-419.172) (-416.191) * (-416.048) (-418.387) (-420.319) [-415.953] -- 0:00:28
      529000 -- (-424.389) (-418.463) [-417.046] (-417.360) * (-415.918) (-419.522) (-419.435) [-417.047] -- 0:00:28
      529500 -- [-417.095] (-416.320) (-415.457) (-418.677) * (-417.031) [-415.840] (-421.135) (-420.637) -- 0:00:28
      530000 -- [-416.649] (-416.248) (-417.467) (-416.021) * (-420.048) [-417.687] (-415.455) (-418.521) -- 0:00:28

      Average standard deviation of split frequencies: 0.008883

      530500 -- (-422.227) (-417.810) [-417.183] (-416.141) * (-416.311) (-417.453) (-416.412) [-414.900] -- 0:00:29
      531000 -- (-421.562) [-415.550] (-415.417) (-415.796) * (-417.530) (-416.350) [-417.601] (-415.762) -- 0:00:29
      531500 -- (-415.911) (-419.603) [-416.844] (-418.000) * (-417.299) (-417.039) (-417.819) [-416.196] -- 0:00:29
      532000 -- (-417.237) [-417.813] (-416.078) (-416.070) * (-415.341) (-419.120) (-419.045) [-415.301] -- 0:00:29
      532500 -- (-416.568) [-417.000] (-417.113) (-417.357) * (-420.581) [-417.180] (-418.997) (-421.770) -- 0:00:28
      533000 -- (-416.466) [-417.052] (-414.916) (-420.156) * (-418.099) (-416.680) [-416.941] (-417.392) -- 0:00:28
      533500 -- (-417.890) (-415.976) [-415.678] (-416.672) * (-416.105) [-415.180] (-424.405) (-417.679) -- 0:00:28
      534000 -- [-417.141] (-415.842) (-417.510) (-418.417) * (-418.346) [-418.084] (-420.551) (-415.552) -- 0:00:28
      534500 -- (-417.331) [-416.179] (-416.149) (-419.601) * [-419.311] (-416.976) (-416.155) (-415.515) -- 0:00:28
      535000 -- [-420.220] (-419.624) (-416.363) (-416.758) * (-421.466) [-417.128] (-415.718) (-416.053) -- 0:00:28

      Average standard deviation of split frequencies: 0.008300

      535500 -- (-417.400) (-420.596) [-415.609] (-417.827) * (-416.257) (-415.612) [-414.834] (-417.638) -- 0:00:28
      536000 -- (-417.528) [-415.091] (-417.745) (-416.109) * (-415.989) [-415.846] (-415.985) (-419.627) -- 0:00:28
      536500 -- (-417.732) [-416.956] (-417.443) (-415.494) * (-416.830) [-416.500] (-414.733) (-415.531) -- 0:00:28
      537000 -- [-415.748] (-417.584) (-416.758) (-417.660) * (-416.763) [-418.824] (-416.748) (-416.716) -- 0:00:28
      537500 -- (-416.307) (-418.465) (-416.491) [-416.553] * (-416.281) [-416.260] (-416.538) (-415.341) -- 0:00:28
      538000 -- (-420.393) (-420.541) (-415.765) [-416.448] * (-417.785) [-417.762] (-415.952) (-417.497) -- 0:00:28
      538500 -- (-419.947) (-421.132) [-415.265] (-415.083) * (-422.112) (-417.755) [-418.930] (-416.509) -- 0:00:28
      539000 -- (-421.405) [-416.876] (-417.319) (-415.452) * (-415.974) [-417.002] (-422.558) (-421.634) -- 0:00:28
      539500 -- (-415.357) (-419.223) (-415.838) [-417.530] * (-416.589) [-415.198] (-418.903) (-425.700) -- 0:00:28
      540000 -- (-417.879) (-417.083) [-421.483] (-415.616) * (-420.180) [-417.737] (-420.034) (-420.231) -- 0:00:28

      Average standard deviation of split frequencies: 0.008229

      540500 -- (-418.838) [-415.434] (-417.921) (-415.501) * (-419.112) [-416.059] (-417.970) (-420.547) -- 0:00:28
      541000 -- (-415.134) (-418.414) [-418.598] (-415.353) * (-417.162) (-417.743) [-415.906] (-414.966) -- 0:00:27
      541500 -- (-416.061) (-414.818) [-418.824] (-417.780) * (-416.085) [-415.693] (-417.665) (-415.548) -- 0:00:27
      542000 -- (-417.640) (-416.480) (-416.263) [-416.282] * (-415.666) (-418.436) [-416.336] (-416.720) -- 0:00:27
      542500 -- [-415.184] (-416.685) (-415.746) (-416.816) * [-416.122] (-416.435) (-414.991) (-419.825) -- 0:00:27
      543000 -- (-415.515) (-417.982) (-415.262) [-415.548] * (-419.062) [-416.200] (-422.133) (-417.275) -- 0:00:27
      543500 -- [-414.985] (-419.545) (-420.374) (-415.547) * (-421.431) (-416.270) (-417.738) [-416.222] -- 0:00:27
      544000 -- [-415.742] (-415.282) (-417.329) (-421.124) * [-417.113] (-416.641) (-419.004) (-421.683) -- 0:00:27
      544500 -- (-416.201) [-416.504] (-418.883) (-419.860) * [-416.631] (-417.953) (-417.592) (-418.335) -- 0:00:27
      545000 -- (-416.891) (-417.167) [-416.606] (-416.031) * (-420.822) [-416.999] (-415.883) (-416.509) -- 0:00:27

      Average standard deviation of split frequencies: 0.008688

      545500 -- [-416.582] (-416.940) (-414.948) (-419.795) * (-415.787) [-416.492] (-415.210) (-416.423) -- 0:00:27
      546000 -- (-421.493) [-416.269] (-418.922) (-417.635) * (-415.469) (-417.607) [-418.888] (-415.444) -- 0:00:27
      546500 -- (-415.546) (-418.256) [-418.223] (-420.544) * (-416.557) (-415.625) [-415.639] (-414.769) -- 0:00:28
      547000 -- (-415.531) (-418.183) [-419.322] (-422.153) * (-416.754) (-416.482) (-414.793) [-416.283] -- 0:00:28
      547500 -- [-414.633] (-418.321) (-420.139) (-415.324) * (-416.718) (-419.223) [-418.658] (-417.443) -- 0:00:28
      548000 -- [-414.788] (-420.447) (-416.442) (-415.832) * [-418.284] (-417.458) (-416.611) (-416.911) -- 0:00:28
      548500 -- [-418.701] (-416.592) (-415.427) (-415.633) * (-416.029) (-416.040) (-416.448) [-425.000] -- 0:00:27
      549000 -- (-416.873) [-415.632] (-414.949) (-416.194) * (-418.456) [-416.939] (-417.460) (-416.514) -- 0:00:27
      549500 -- (-417.039) [-415.341] (-417.170) (-416.812) * (-419.322) [-417.458] (-416.369) (-418.805) -- 0:00:27
      550000 -- [-415.622] (-419.978) (-414.858) (-416.064) * (-416.423) (-416.409) (-416.715) [-416.217] -- 0:00:27

      Average standard deviation of split frequencies: 0.008347

      550500 -- (-418.662) (-419.751) [-415.031] (-417.616) * [-417.615] (-415.399) (-416.715) (-416.160) -- 0:00:27
      551000 -- (-415.856) [-419.582] (-414.987) (-416.328) * [-415.860] (-414.987) (-422.725) (-415.060) -- 0:00:27
      551500 -- (-414.966) (-417.355) (-417.797) [-418.736] * (-418.959) (-415.490) (-419.947) [-415.237] -- 0:00:27
      552000 -- (-415.803) (-417.377) [-416.193] (-418.301) * (-418.900) (-415.599) (-418.804) [-415.093] -- 0:00:27
      552500 -- (-417.312) (-416.671) (-416.124) [-416.863] * (-418.544) [-421.060] (-422.104) (-415.033) -- 0:00:27
      553000 -- (-416.813) (-416.813) (-418.169) [-415.995] * [-418.280] (-419.412) (-416.611) (-417.332) -- 0:00:27
      553500 -- [-416.590] (-417.104) (-417.513) (-416.227) * (-416.222) [-419.645] (-419.930) (-417.506) -- 0:00:27
      554000 -- [-417.535] (-417.903) (-414.980) (-421.951) * (-415.778) (-418.683) (-417.144) [-416.089] -- 0:00:27
      554500 -- (-416.689) (-416.187) [-418.707] (-425.861) * (-416.633) [-415.671] (-416.439) (-418.535) -- 0:00:27
      555000 -- (-416.864) [-418.277] (-416.806) (-419.399) * (-417.442) (-416.571) (-415.773) [-415.401] -- 0:00:27

      Average standard deviation of split frequencies: 0.008637

      555500 -- (-417.043) [-418.644] (-417.892) (-417.383) * (-419.420) (-415.112) (-418.991) [-415.778] -- 0:00:27
      556000 -- (-416.762) (-415.973) (-418.583) [-415.649] * (-416.104) (-420.174) (-419.193) [-415.605] -- 0:00:27
      556500 -- (-417.055) (-418.427) [-417.623] (-417.544) * (-416.692) (-417.218) [-416.366] (-416.252) -- 0:00:27
      557000 -- (-418.670) [-416.679] (-419.142) (-417.675) * [-415.987] (-418.677) (-416.462) (-414.846) -- 0:00:27
      557500 -- [-420.310] (-420.953) (-416.891) (-418.304) * [-416.635] (-415.981) (-418.154) (-418.049) -- 0:00:26
      558000 -- [-421.455] (-418.427) (-419.781) (-416.669) * (-418.212) (-415.347) [-416.271] (-419.127) -- 0:00:26
      558500 -- (-416.725) [-415.788] (-417.402) (-417.325) * (-418.063) [-415.822] (-419.461) (-416.221) -- 0:00:26
      559000 -- [-419.674] (-416.205) (-417.526) (-420.568) * (-417.555) (-415.879) [-417.862] (-416.798) -- 0:00:26
      559500 -- (-416.988) (-419.621) [-420.453] (-416.775) * (-415.888) [-416.014] (-417.784) (-421.115) -- 0:00:26
      560000 -- (-415.429) (-419.902) (-419.003) [-416.341] * (-417.947) (-416.323) (-420.560) [-416.226] -- 0:00:26

      Average standard deviation of split frequencies: 0.009144

      560500 -- [-415.816] (-415.621) (-417.393) (-418.962) * (-416.571) (-419.923) (-418.941) [-417.967] -- 0:00:26
      561000 -- (-417.818) (-417.106) (-417.392) [-415.569] * (-416.646) (-416.835) (-417.348) [-418.146] -- 0:00:26
      561500 -- (-415.138) [-414.971] (-418.827) (-414.615) * [-416.062] (-421.065) (-417.092) (-417.577) -- 0:00:26
      562000 -- (-415.157) (-415.417) (-415.381) [-415.549] * (-416.454) [-418.300] (-419.675) (-416.018) -- 0:00:26
      562500 -- (-415.053) (-415.112) [-416.492] (-415.323) * [-417.001] (-417.083) (-416.052) (-415.631) -- 0:00:26
      563000 -- [-418.256] (-416.018) (-415.253) (-420.795) * [-415.924] (-415.484) (-416.846) (-417.396) -- 0:00:26
      563500 -- [-416.464] (-417.516) (-418.125) (-416.601) * [-416.744] (-418.206) (-418.919) (-415.760) -- 0:00:27
      564000 -- (-416.413) (-416.065) (-417.536) [-417.363] * [-415.508] (-416.996) (-415.631) (-416.428) -- 0:00:27
      564500 -- (-416.565) (-416.413) (-415.351) [-416.418] * (-416.832) (-414.956) [-417.627] (-416.275) -- 0:00:27
      565000 -- (-416.156) (-417.731) (-415.492) [-417.437] * [-415.070] (-416.404) (-418.268) (-415.427) -- 0:00:26

      Average standard deviation of split frequencies: 0.009474

      565500 -- (-421.560) [-415.164] (-417.404) (-416.994) * (-416.777) (-416.199) (-419.965) [-417.928] -- 0:00:26
      566000 -- [-422.515] (-417.482) (-416.388) (-414.858) * (-419.430) (-415.238) [-415.036] (-414.836) -- 0:00:26
      566500 -- (-416.763) (-418.061) [-416.815] (-415.567) * (-415.874) [-416.329] (-416.791) (-417.076) -- 0:00:26
      567000 -- (-417.140) [-415.312] (-421.395) (-416.599) * (-415.124) [-417.567] (-415.604) (-417.315) -- 0:00:26
      567500 -- (-416.075) (-415.060) [-419.186] (-416.374) * (-419.804) (-415.468) (-419.545) [-418.528] -- 0:00:26
      568000 -- [-416.623] (-418.800) (-416.259) (-416.917) * (-419.427) [-416.415] (-417.404) (-416.769) -- 0:00:26
      568500 -- [-418.017] (-417.167) (-416.316) (-416.696) * (-416.141) (-416.915) [-415.664] (-417.703) -- 0:00:26
      569000 -- [-416.596] (-416.408) (-418.914) (-415.118) * (-417.376) (-415.262) [-416.139] (-416.443) -- 0:00:26
      569500 -- (-417.932) (-416.932) (-422.271) [-418.449] * (-416.243) [-415.855] (-416.536) (-416.329) -- 0:00:26
      570000 -- (-418.922) [-415.924] (-416.116) (-416.765) * (-415.477) (-419.294) [-415.604] (-415.510) -- 0:00:26

      Average standard deviation of split frequencies: 0.009603

      570500 -- (-418.769) [-418.778] (-420.037) (-417.341) * (-418.223) (-415.711) [-416.555] (-416.908) -- 0:00:26
      571000 -- [-416.053] (-418.137) (-419.552) (-416.980) * (-416.352) (-416.370) [-416.080] (-418.098) -- 0:00:26
      571500 -- (-417.813) [-417.922] (-418.959) (-417.611) * (-415.325) (-416.454) [-414.905] (-416.148) -- 0:00:26
      572000 -- [-417.361] (-416.271) (-415.567) (-420.487) * (-415.631) [-416.862] (-415.021) (-416.125) -- 0:00:26
      572500 -- [-418.558] (-415.966) (-417.926) (-416.323) * (-416.033) (-420.360) [-416.817] (-416.847) -- 0:00:26
      573000 -- (-418.557) [-419.724] (-419.105) (-417.245) * [-417.143] (-416.961) (-414.687) (-415.505) -- 0:00:26
      573500 -- (-417.501) (-421.135) [-416.046] (-415.229) * [-415.652] (-416.092) (-414.985) (-416.022) -- 0:00:26
      574000 -- (-422.101) (-421.516) [-416.288] (-418.782) * [-417.316] (-417.302) (-416.635) (-417.717) -- 0:00:25
      574500 -- [-417.527] (-418.933) (-416.087) (-415.713) * (-418.334) (-415.372) [-421.202] (-415.525) -- 0:00:25
      575000 -- [-415.472] (-415.798) (-416.170) (-418.142) * (-417.729) [-415.512] (-416.398) (-414.825) -- 0:00:25

      Average standard deviation of split frequencies: 0.009565

      575500 -- [-415.254] (-418.478) (-418.356) (-417.519) * [-417.282] (-416.522) (-419.372) (-416.368) -- 0:00:25
      576000 -- (-416.899) (-416.736) [-419.604] (-415.825) * [-415.965] (-417.586) (-416.033) (-416.934) -- 0:00:25
      576500 -- (-415.916) [-417.745] (-415.828) (-416.772) * (-415.946) (-416.553) (-417.017) [-416.215] -- 0:00:25
      577000 -- (-421.934) [-416.670] (-416.955) (-418.037) * (-420.577) (-418.816) (-417.895) [-416.833] -- 0:00:25
      577500 -- [-419.429] (-416.552) (-417.910) (-417.602) * (-417.218) (-418.333) (-416.667) [-416.061] -- 0:00:25
      578000 -- (-415.567) (-415.812) [-415.768] (-415.234) * (-416.900) (-419.223) [-415.874] (-415.892) -- 0:00:25
      578500 -- (-415.677) (-420.631) (-417.449) [-416.031] * (-419.031) (-417.450) [-415.594] (-417.630) -- 0:00:25
      579000 -- (-415.321) [-417.079] (-414.950) (-425.422) * [-419.300] (-416.393) (-421.960) (-416.790) -- 0:00:25
      579500 -- [-415.901] (-416.014) (-417.663) (-417.080) * (-417.441) (-421.501) (-417.821) [-416.217] -- 0:00:25
      580000 -- (-415.405) (-418.174) [-418.100] (-418.689) * (-417.438) [-415.610] (-420.247) (-417.292) -- 0:00:25

      Average standard deviation of split frequencies: 0.009945

      580500 -- (-418.153) (-421.577) [-417.441] (-415.605) * [-423.039] (-415.588) (-417.496) (-418.557) -- 0:00:26
      581000 -- (-418.023) (-417.367) [-416.274] (-415.652) * (-418.650) (-416.587) (-417.350) [-414.751] -- 0:00:25
      581500 -- [-415.464] (-416.454) (-415.870) (-416.330) * (-416.989) (-416.930) (-417.237) [-417.322] -- 0:00:25
      582000 -- (-419.768) [-417.168] (-417.978) (-416.306) * [-415.229] (-417.583) (-415.452) (-417.346) -- 0:00:25
      582500 -- (-417.546) [-417.711] (-417.579) (-417.274) * (-418.982) (-416.142) [-415.573] (-420.831) -- 0:00:25
      583000 -- [-416.528] (-415.004) (-417.023) (-417.154) * [-418.245] (-417.975) (-416.154) (-415.725) -- 0:00:25
      583500 -- [-415.307] (-415.969) (-419.302) (-416.238) * [-419.045] (-419.142) (-416.964) (-418.311) -- 0:00:25
      584000 -- (-416.196) (-416.349) (-419.286) [-415.789] * (-420.171) (-416.672) (-417.208) [-414.933] -- 0:00:25
      584500 -- (-416.580) (-417.849) (-416.446) [-416.902] * (-417.992) (-417.631) [-416.439] (-415.516) -- 0:00:25
      585000 -- (-416.610) [-415.211] (-416.616) (-417.753) * (-419.107) [-416.970] (-417.662) (-416.314) -- 0:00:25

      Average standard deviation of split frequencies: 0.009402

      585500 -- (-416.968) (-419.192) [-416.395] (-417.890) * (-418.053) (-415.827) (-418.136) [-416.181] -- 0:00:25
      586000 -- (-417.907) (-415.390) (-419.787) [-418.933] * [-414.873] (-416.760) (-416.415) (-419.812) -- 0:00:25
      586500 -- (-415.768) [-415.380] (-421.337) (-418.957) * (-420.499) (-417.175) [-416.547] (-420.970) -- 0:00:25
      587000 -- (-418.619) (-416.422) (-419.654) [-416.750] * (-415.614) (-416.839) (-418.743) [-418.672] -- 0:00:25
      587500 -- [-415.402] (-415.377) (-417.116) (-415.724) * (-426.549) [-418.108] (-417.054) (-417.141) -- 0:00:25
      588000 -- [-420.189] (-419.237) (-417.333) (-414.832) * (-416.531) (-421.794) (-416.272) [-416.776] -- 0:00:25
      588500 -- (-416.250) [-415.504] (-416.173) (-417.314) * (-417.778) (-416.197) (-418.405) [-417.969] -- 0:00:25
      589000 -- (-417.117) (-416.510) (-416.907) [-415.172] * (-416.431) (-417.371) (-418.624) [-416.841] -- 0:00:25
      589500 -- [-418.461] (-419.587) (-416.479) (-416.365) * (-417.280) (-416.555) (-415.261) [-415.856] -- 0:00:25
      590000 -- [-417.116] (-416.154) (-416.522) (-416.426) * [-420.094] (-415.071) (-415.214) (-416.357) -- 0:00:25

      Average standard deviation of split frequencies: 0.009028

      590500 -- (-416.165) (-418.896) [-416.474] (-415.725) * (-415.165) (-414.807) (-415.307) [-416.975] -- 0:00:24
      591000 -- [-414.789] (-417.850) (-416.387) (-416.039) * (-416.588) (-417.372) (-416.637) [-416.136] -- 0:00:24
      591500 -- [-416.158] (-414.911) (-416.866) (-417.457) * (-417.861) (-415.527) [-417.656] (-415.895) -- 0:00:24
      592000 -- [-415.233] (-415.814) (-418.219) (-416.432) * (-421.526) (-416.805) (-418.677) [-417.405] -- 0:00:24
      592500 -- (-416.382) [-415.224] (-418.073) (-419.257) * (-418.913) (-415.099) (-416.519) [-417.108] -- 0:00:24
      593000 -- (-417.905) [-415.493] (-419.099) (-415.929) * (-418.701) (-418.240) [-415.521] (-416.498) -- 0:00:24
      593500 -- (-418.908) (-415.229) (-417.625) [-414.932] * [-417.113] (-416.932) (-417.792) (-421.555) -- 0:00:24
      594000 -- [-415.618] (-423.562) (-417.404) (-415.632) * (-416.627) (-419.964) (-415.616) [-416.544] -- 0:00:24
      594500 -- (-419.584) (-415.974) [-415.759] (-417.332) * [-416.360] (-415.358) (-414.619) (-416.030) -- 0:00:24
      595000 -- (-420.205) (-415.342) (-415.914) [-420.839] * (-416.392) (-415.161) [-414.739] (-419.135) -- 0:00:24

      Average standard deviation of split frequencies: 0.008849

      595500 -- (-421.998) [-415.470] (-415.832) (-415.546) * [-418.580] (-416.722) (-417.308) (-415.246) -- 0:00:24
      596000 -- (-422.921) [-416.516] (-416.140) (-415.341) * (-422.318) [-417.308] (-417.608) (-416.286) -- 0:00:24
      596500 -- (-417.895) [-418.670] (-416.880) (-416.125) * (-416.776) (-416.319) (-416.518) [-417.171] -- 0:00:24
      597000 -- (-416.912) (-416.587) [-416.016] (-418.901) * (-416.238) (-414.955) (-416.323) [-415.411] -- 0:00:24
      597500 -- (-416.859) [-417.689] (-417.338) (-417.740) * (-415.646) [-415.359] (-418.422) (-414.954) -- 0:00:24
      598000 -- (-415.282) (-415.703) (-415.492) [-419.886] * [-417.439] (-416.306) (-423.041) (-415.271) -- 0:00:24
      598500 -- [-415.350] (-415.220) (-416.693) (-416.546) * (-416.782) [-415.472] (-420.733) (-423.608) -- 0:00:24
      599000 -- [-416.500] (-417.806) (-416.683) (-415.861) * [-418.595] (-417.411) (-419.487) (-419.204) -- 0:00:24
      599500 -- (-418.442) (-417.911) (-416.958) [-430.174] * [-417.741] (-419.046) (-417.156) (-418.033) -- 0:00:24
      600000 -- (-416.060) [-417.854] (-417.590) (-417.210) * (-418.045) (-414.992) [-419.792] (-420.253) -- 0:00:24

      Average standard deviation of split frequencies: 0.008976

      600500 -- (-414.962) (-416.172) (-415.973) [-415.790] * (-417.620) [-418.924] (-416.648) (-415.394) -- 0:00:24
      601000 -- (-415.481) (-417.995) [-416.335] (-416.292) * (-418.204) [-416.055] (-418.235) (-415.729) -- 0:00:24
      601500 -- (-417.836) (-416.402) (-419.648) [-416.871] * [-417.264] (-420.604) (-415.464) (-420.139) -- 0:00:24
      602000 -- [-417.643] (-418.408) (-420.637) (-417.705) * (-415.175) (-423.191) [-415.505] (-417.994) -- 0:00:24
      602500 -- (-417.793) (-419.297) (-420.397) [-417.395] * (-415.086) (-419.881) [-417.370] (-417.882) -- 0:00:24
      603000 -- (-415.338) (-417.799) [-417.236] (-418.007) * (-422.200) (-418.058) [-416.620] (-419.055) -- 0:00:24
      603500 -- (-417.211) [-417.669] (-416.669) (-418.071) * (-419.930) (-419.725) (-415.680) [-416.068] -- 0:00:24
      604000 -- (-416.525) (-415.989) [-417.235] (-420.764) * [-417.468] (-417.620) (-415.801) (-419.334) -- 0:00:24
      604500 -- [-417.726] (-415.936) (-416.055) (-418.602) * (-418.893) [-417.659] (-416.893) (-416.167) -- 0:00:24
      605000 -- (-418.054) [-416.871] (-424.539) (-417.205) * [-415.598] (-415.430) (-416.849) (-417.318) -- 0:00:24

      Average standard deviation of split frequencies: 0.008800

      605500 -- (-415.906) (-417.589) [-416.901] (-417.034) * [-415.499] (-415.348) (-416.031) (-415.750) -- 0:00:24
      606000 -- [-418.882] (-415.975) (-422.957) (-418.195) * (-416.208) (-416.574) [-416.011] (-417.565) -- 0:00:24
      606500 -- (-418.998) [-415.262] (-417.690) (-416.902) * (-418.794) (-418.797) (-418.620) [-417.440] -- 0:00:24
      607000 -- (-416.824) (-415.206) (-415.745) [-418.293] * (-418.837) (-418.868) (-420.843) [-416.466] -- 0:00:23
      607500 -- (-416.870) [-415.201] (-416.349) (-420.802) * [-419.900] (-416.512) (-417.306) (-416.261) -- 0:00:23
      608000 -- [-415.447] (-415.484) (-416.633) (-417.806) * (-420.971) [-415.854] (-415.725) (-415.033) -- 0:00:23
      608500 -- (-415.961) (-419.266) [-416.199] (-415.768) * [-420.404] (-420.319) (-415.368) (-416.199) -- 0:00:23
      609000 -- (-417.155) (-420.003) (-416.767) [-416.078] * (-417.555) [-417.017] (-415.995) (-416.639) -- 0:00:23
      609500 -- [-415.523] (-420.874) (-416.043) (-418.477) * (-417.016) (-425.114) [-424.071] (-417.210) -- 0:00:23
      610000 -- (-415.310) (-417.515) [-415.980] (-415.380) * (-419.669) (-416.289) [-417.105] (-415.303) -- 0:00:23

      Average standard deviation of split frequencies: 0.008347

      610500 -- [-417.959] (-418.500) (-415.570) (-417.561) * (-418.019) (-416.470) [-416.115] (-416.901) -- 0:00:23
      611000 -- (-424.744) [-415.753] (-417.886) (-418.451) * (-415.695) [-414.883] (-416.591) (-419.457) -- 0:00:23
      611500 -- (-418.396) [-415.266] (-416.946) (-417.176) * [-415.815] (-416.357) (-416.970) (-415.270) -- 0:00:23
      612000 -- (-420.987) [-415.123] (-418.179) (-415.249) * (-419.518) [-418.172] (-417.718) (-415.407) -- 0:00:23
      612500 -- (-416.562) [-415.105] (-415.919) (-418.423) * (-415.127) (-414.838) (-417.137) [-416.806] -- 0:00:23
      613000 -- (-416.662) (-416.654) (-415.791) [-417.147] * [-417.327] (-416.798) (-415.061) (-416.720) -- 0:00:23
      613500 -- [-415.922] (-418.365) (-419.392) (-419.762) * (-419.333) [-418.988] (-418.311) (-415.284) -- 0:00:23
      614000 -- [-415.359] (-416.143) (-419.222) (-416.883) * (-417.308) (-415.507) (-416.371) [-415.568] -- 0:00:23
      614500 -- (-419.364) [-416.977] (-416.664) (-417.600) * (-416.021) (-419.598) [-418.136] (-417.122) -- 0:00:23
      615000 -- (-417.100) [-415.776] (-415.738) (-418.304) * (-415.355) [-416.411] (-417.302) (-418.121) -- 0:00:23

      Average standard deviation of split frequencies: 0.008179

      615500 -- (-416.546) (-414.961) (-419.777) [-417.372] * (-417.685) [-416.240] (-420.227) (-418.444) -- 0:00:23
      616000 -- (-419.267) (-415.270) [-416.777] (-415.564) * (-418.276) (-415.830) (-419.244) [-416.154] -- 0:00:23
      616500 -- (-424.291) [-416.592] (-417.475) (-417.083) * (-418.442) (-418.740) [-417.392] (-415.743) -- 0:00:23
      617000 -- (-416.020) [-416.352] (-415.713) (-415.270) * (-418.815) (-418.849) (-417.653) [-415.765] -- 0:00:23
      617500 -- [-417.915] (-417.528) (-416.542) (-415.715) * (-416.973) [-418.146] (-417.661) (-420.064) -- 0:00:23
      618000 -- (-416.328) (-415.358) (-414.812) [-418.359] * (-417.320) [-418.347] (-416.347) (-421.440) -- 0:00:23
      618500 -- (-415.967) (-415.731) (-415.719) [-416.580] * [-416.260] (-417.462) (-416.116) (-417.730) -- 0:00:23
      619000 -- (-420.684) (-418.186) [-417.384] (-418.283) * (-420.591) (-416.931) (-417.718) [-416.221] -- 0:00:23
      619500 -- [-417.603] (-415.790) (-416.531) (-417.039) * [-416.655] (-418.665) (-418.190) (-416.373) -- 0:00:23
      620000 -- [-415.760] (-419.166) (-418.845) (-417.344) * (-419.735) (-416.665) (-420.209) [-419.199] -- 0:00:23

      Average standard deviation of split frequencies: 0.007975

      620500 -- (-415.268) (-417.887) [-418.554] (-418.257) * (-419.837) (-415.911) [-417.859] (-417.598) -- 0:00:23
      621000 -- [-416.924] (-420.103) (-418.498) (-418.959) * (-418.832) (-415.811) (-415.903) [-416.877] -- 0:00:23
      621500 -- [-415.694] (-419.154) (-416.821) (-419.346) * (-420.780) (-419.794) (-419.174) [-420.241] -- 0:00:23
      622000 -- (-415.585) [-415.233] (-421.040) (-418.711) * (-418.185) [-418.374] (-417.451) (-415.836) -- 0:00:23
      622500 -- (-415.594) (-417.084) [-419.453] (-418.388) * [-416.234] (-416.163) (-415.448) (-418.130) -- 0:00:23
      623000 -- (-416.295) [-418.371] (-418.681) (-421.176) * (-416.060) (-416.568) [-415.543] (-419.523) -- 0:00:22
      623500 -- [-416.570] (-417.390) (-417.469) (-415.589) * (-415.228) (-424.248) (-418.687) [-415.880] -- 0:00:22
      624000 -- (-418.664) (-418.199) (-418.279) [-415.427] * (-418.278) [-417.611] (-421.308) (-416.380) -- 0:00:22
      624500 -- (-417.638) (-416.802) [-415.937] (-418.454) * (-421.172) [-417.393] (-416.779) (-418.457) -- 0:00:22
      625000 -- (-420.742) (-417.664) [-418.270] (-417.916) * (-420.282) (-418.619) (-418.656) [-418.032] -- 0:00:22

      Average standard deviation of split frequencies: 0.007719

      625500 -- (-415.491) (-417.394) (-417.162) [-418.987] * (-415.519) (-419.210) (-416.916) [-418.159] -- 0:00:22
      626000 -- (-416.738) (-416.996) (-415.576) [-421.236] * (-417.177) [-414.995] (-418.126) (-415.262) -- 0:00:22
      626500 -- (-422.658) (-416.552) [-415.767] (-418.189) * (-417.662) [-415.713] (-418.177) (-416.090) -- 0:00:22
      627000 -- (-417.041) (-415.254) [-421.205] (-419.588) * (-417.854) (-416.841) [-416.967] (-421.145) -- 0:00:22
      627500 -- [-417.352] (-417.348) (-419.523) (-419.352) * (-415.465) (-416.423) [-416.178] (-417.582) -- 0:00:22
      628000 -- (-417.764) [-416.193] (-416.361) (-420.783) * (-416.841) (-418.205) (-416.504) [-415.921] -- 0:00:22
      628500 -- (-415.143) (-420.034) [-416.291] (-423.951) * (-416.228) [-415.835] (-417.222) (-416.040) -- 0:00:22
      629000 -- (-417.208) (-415.753) (-415.367) [-419.014] * (-417.113) (-416.271) (-424.725) [-414.792] -- 0:00:22
      629500 -- [-415.222] (-417.768) (-417.080) (-419.650) * (-415.290) (-416.831) (-416.972) [-415.766] -- 0:00:22
      630000 -- (-415.074) [-419.124] (-416.374) (-415.969) * [-415.625] (-417.848) (-414.957) (-414.906) -- 0:00:22

      Average standard deviation of split frequencies: 0.008750

      630500 -- (-418.682) (-418.569) [-416.779] (-418.337) * (-415.870) (-415.819) (-415.289) [-417.838] -- 0:00:22
      631000 -- [-416.898] (-419.476) (-416.418) (-418.791) * (-417.700) (-415.988) [-416.696] (-415.871) -- 0:00:22
      631500 -- (-420.175) (-419.122) [-418.963] (-416.627) * (-415.334) (-415.899) (-417.271) [-416.504] -- 0:00:22
      632000 -- (-418.608) [-418.064] (-418.604) (-417.978) * (-423.046) [-419.142] (-416.588) (-417.809) -- 0:00:22
      632500 -- [-416.701] (-421.395) (-418.525) (-418.470) * (-417.499) (-415.820) [-417.233] (-417.999) -- 0:00:22
      633000 -- [-418.857] (-416.323) (-415.698) (-415.395) * (-417.797) (-415.925) [-418.098] (-416.848) -- 0:00:22
      633500 -- (-419.020) [-414.745] (-422.227) (-417.727) * [-415.215] (-416.058) (-418.453) (-416.273) -- 0:00:22
      634000 -- (-417.943) (-415.207) (-419.232) [-418.441] * (-417.946) (-415.676) [-418.078] (-415.808) -- 0:00:22
      634500 -- (-417.253) (-416.562) (-420.018) [-420.415] * (-415.112) [-416.280] (-418.365) (-419.200) -- 0:00:22
      635000 -- (-416.181) (-417.292) (-416.747) [-416.957] * (-416.206) [-417.493] (-418.739) (-415.325) -- 0:00:22

      Average standard deviation of split frequencies: 0.008415

      635500 -- (-416.987) (-415.457) (-419.088) [-415.556] * [-415.526] (-420.387) (-418.837) (-417.075) -- 0:00:22
      636000 -- [-415.070] (-416.390) (-415.685) (-416.475) * (-422.832) (-421.390) [-419.562] (-418.232) -- 0:00:22
      636500 -- [-416.240] (-418.266) (-418.084) (-420.565) * (-416.658) (-417.199) (-416.911) [-416.476] -- 0:00:22
      637000 -- [-415.634] (-418.630) (-419.593) (-416.935) * [-415.896] (-423.063) (-416.406) (-418.323) -- 0:00:22
      637500 -- (-415.838) (-415.792) (-418.595) [-415.773] * (-415.030) (-420.290) [-422.002] (-417.092) -- 0:00:22
      638000 -- (-420.543) [-416.119] (-422.680) (-415.924) * [-416.931] (-418.892) (-415.835) (-415.302) -- 0:00:22
      638500 -- (-417.419) (-418.777) [-417.304] (-415.567) * (-416.781) (-416.151) [-419.666] (-417.453) -- 0:00:22
      639000 -- (-417.626) (-418.672) [-415.872] (-415.835) * (-416.424) (-418.308) [-416.220] (-415.341) -- 0:00:22
      639500 -- (-415.233) (-417.953) [-416.681] (-416.657) * [-416.340] (-416.936) (-415.951) (-417.434) -- 0:00:21
      640000 -- (-421.757) (-418.061) (-416.321) [-417.428] * [-417.533] (-417.270) (-416.598) (-415.791) -- 0:00:21

      Average standard deviation of split frequencies: 0.008916

      640500 -- [-420.290] (-417.136) (-418.212) (-419.905) * (-416.986) (-418.367) (-418.966) [-416.454] -- 0:00:21
      641000 -- (-418.190) (-415.432) [-417.714] (-418.245) * (-419.937) (-417.926) (-417.188) [-416.698] -- 0:00:21
      641500 -- [-419.351] (-418.153) (-416.397) (-420.148) * (-416.903) (-417.409) [-417.000] (-421.489) -- 0:00:21
      642000 -- [-416.991] (-417.484) (-416.077) (-415.919) * (-416.658) (-415.772) [-415.667] (-419.574) -- 0:00:21
      642500 -- [-416.277] (-416.930) (-415.790) (-417.619) * (-416.177) [-417.878] (-416.993) (-420.656) -- 0:00:21
      643000 -- (-415.850) [-419.685] (-415.322) (-416.956) * [-418.557] (-416.607) (-417.075) (-417.472) -- 0:00:21
      643500 -- (-417.132) [-419.635] (-419.063) (-415.987) * (-416.427) (-418.977) (-418.201) [-420.629] -- 0:00:21
      644000 -- (-416.295) (-418.646) [-421.851] (-416.881) * (-417.430) [-417.992] (-415.111) (-417.811) -- 0:00:21
      644500 -- (-416.593) (-416.849) (-421.561) [-415.219] * (-416.011) [-415.242] (-417.148) (-414.898) -- 0:00:21
      645000 -- (-420.505) (-415.351) [-417.286] (-418.777) * [-416.078] (-415.399) (-416.191) (-417.117) -- 0:00:21

      Average standard deviation of split frequencies: 0.008886

      645500 -- (-416.265) (-418.448) (-415.886) [-417.415] * [-417.219] (-416.341) (-418.269) (-420.365) -- 0:00:21
      646000 -- [-417.237] (-417.060) (-416.074) (-415.681) * (-418.790) (-415.842) (-416.460) [-415.920] -- 0:00:21
      646500 -- (-417.997) (-416.988) (-421.171) [-416.361] * (-418.948) (-416.579) (-419.390) [-415.063] -- 0:00:21
      647000 -- (-416.105) (-415.490) (-416.286) [-417.166] * (-415.545) [-416.940] (-416.941) (-419.231) -- 0:00:21
      647500 -- (-416.134) (-417.372) [-417.579] (-421.161) * (-418.687) (-420.219) [-416.074] (-419.024) -- 0:00:21
      648000 -- [-421.430] (-416.882) (-415.670) (-415.345) * [-416.622] (-415.453) (-418.111) (-416.596) -- 0:00:21
      648500 -- [-416.586] (-418.686) (-417.733) (-415.530) * (-415.548) (-417.181) (-419.600) [-415.221] -- 0:00:21
      649000 -- (-416.066) (-416.157) (-421.144) [-417.586] * (-418.219) (-417.875) (-416.174) [-419.312] -- 0:00:21
      649500 -- [-416.464] (-417.154) (-418.938) (-416.246) * (-415.729) (-419.133) [-418.031] (-416.854) -- 0:00:21
      650000 -- (-415.282) (-417.989) [-418.127] (-416.269) * (-418.872) (-417.087) (-416.261) [-418.075] -- 0:00:21

      Average standard deviation of split frequencies: 0.009248

      650500 -- (-415.248) [-418.772] (-423.401) (-417.502) * (-417.351) [-417.905] (-416.228) (-418.642) -- 0:00:21
      651000 -- [-415.280] (-416.235) (-418.031) (-418.134) * (-415.209) [-416.151] (-421.312) (-418.504) -- 0:00:21
      651500 -- (-416.124) [-416.327] (-420.487) (-417.566) * (-415.485) [-418.359] (-419.493) (-416.238) -- 0:00:21
      652000 -- [-419.630] (-417.282) (-415.524) (-417.981) * (-417.829) [-417.518] (-416.693) (-417.597) -- 0:00:21
      652500 -- (-416.118) [-417.493] (-417.882) (-415.354) * (-417.106) [-417.526] (-417.866) (-417.900) -- 0:00:21
      653000 -- (-416.368) [-416.832] (-415.432) (-418.420) * [-416.307] (-415.892) (-418.797) (-418.401) -- 0:00:21
      653500 -- (-416.434) (-418.991) (-415.470) [-416.181] * (-416.047) (-416.704) (-417.795) [-420.127] -- 0:00:21
      654000 -- [-415.672] (-416.362) (-417.129) (-416.634) * [-415.472] (-417.691) (-415.108) (-417.206) -- 0:00:21
      654500 -- (-415.901) (-415.590) (-416.671) [-415.291] * (-415.377) (-419.733) (-417.086) [-418.320] -- 0:00:21
      655000 -- (-417.264) (-415.931) [-415.346] (-418.800) * (-418.298) [-417.255] (-420.494) (-419.266) -- 0:00:21

      Average standard deviation of split frequencies: 0.009426

      655500 -- (-415.468) (-417.198) [-420.348] (-420.438) * (-418.296) (-417.036) (-422.165) [-418.460] -- 0:00:21
      656000 -- [-415.615] (-416.517) (-420.482) (-418.199) * (-416.666) [-415.567] (-415.680) (-416.599) -- 0:00:20
      656500 -- (-415.469) (-419.064) (-417.318) [-415.168] * (-416.727) (-415.283) [-417.944] (-418.117) -- 0:00:20
      657000 -- (-417.897) (-420.396) (-416.645) [-416.310] * (-415.221) (-416.010) [-417.762] (-415.929) -- 0:00:20
      657500 -- (-416.020) (-426.679) [-417.091] (-416.971) * [-417.954] (-416.022) (-416.101) (-416.093) -- 0:00:20
      658000 -- (-417.589) (-418.653) [-415.686] (-416.439) * (-416.496) [-416.221] (-419.251) (-418.006) -- 0:00:20
      658500 -- (-416.705) (-416.912) (-416.573) [-416.026] * [-417.502] (-419.145) (-416.266) (-415.709) -- 0:00:20
      659000 -- (-420.304) (-417.653) (-417.639) [-414.887] * (-417.724) (-415.855) [-416.420] (-417.052) -- 0:00:20
      659500 -- [-417.717] (-414.831) (-418.810) (-415.139) * (-417.204) (-416.942) [-415.937] (-415.854) -- 0:00:20
      660000 -- (-418.181) [-415.965] (-416.807) (-417.835) * (-417.737) [-417.749] (-416.768) (-419.580) -- 0:00:20

      Average standard deviation of split frequencies: 0.009276

      660500 -- (-418.651) (-416.004) (-417.955) [-417.435] * (-417.430) (-417.161) [-417.663] (-416.157) -- 0:00:20
      661000 -- (-416.103) (-416.945) [-417.208] (-422.277) * (-421.410) [-417.171] (-415.768) (-418.203) -- 0:00:20
      661500 -- [-415.557] (-418.169) (-420.375) (-419.434) * (-418.267) (-417.971) [-415.816] (-421.430) -- 0:00:20
      662000 -- (-418.495) (-418.644) (-417.033) [-416.669] * (-416.226) (-419.396) (-415.908) [-415.525] -- 0:00:20
      662500 -- (-419.655) (-416.437) [-420.709] (-419.354) * (-416.160) (-417.398) (-417.246) [-414.945] -- 0:00:20
      663000 -- [-418.543] (-416.952) (-418.839) (-416.872) * (-420.512) (-417.501) (-419.659) [-417.901] -- 0:00:20
      663500 -- [-417.640] (-416.120) (-416.496) (-416.808) * (-421.491) (-420.309) [-420.400] (-415.944) -- 0:00:20
      664000 -- (-417.759) (-416.948) [-415.770] (-414.854) * (-417.426) [-418.637] (-418.870) (-415.362) -- 0:00:20
      664500 -- (-414.812) (-416.707) (-415.805) [-418.902] * (-417.601) [-420.500] (-417.658) (-417.236) -- 0:00:20
      665000 -- (-415.844) (-416.802) [-414.801] (-415.877) * (-417.795) (-418.522) (-417.869) [-417.503] -- 0:00:20

      Average standard deviation of split frequencies: 0.009368

      665500 -- (-421.199) [-414.825] (-415.838) (-415.638) * (-417.796) [-417.054] (-417.458) (-416.099) -- 0:00:20
      666000 -- (-415.604) (-416.365) (-415.297) [-416.438] * [-417.764] (-418.131) (-417.540) (-417.337) -- 0:00:20
      666500 -- (-415.329) (-416.180) (-417.968) [-417.341] * [-416.329] (-417.902) (-416.922) (-421.029) -- 0:00:20
      667000 -- (-415.493) (-419.490) (-417.816) [-415.831] * (-415.547) (-419.235) [-418.516] (-418.089) -- 0:00:20
      667500 -- (-416.271) (-416.703) [-414.705] (-416.870) * (-418.946) (-418.293) [-417.038] (-418.089) -- 0:00:20
      668000 -- (-415.992) (-417.274) (-415.598) [-416.476] * [-416.398] (-417.016) (-418.641) (-419.481) -- 0:00:20
      668500 -- (-416.279) (-415.599) [-417.568] (-416.737) * [-415.944] (-420.751) (-419.067) (-415.185) -- 0:00:20
      669000 -- (-416.490) (-417.606) (-419.459) [-418.418] * [-420.334] (-417.487) (-416.603) (-416.219) -- 0:00:20
      669500 -- (-418.417) (-416.077) (-414.747) [-418.737] * (-419.714) [-418.140] (-415.879) (-417.465) -- 0:00:20
      670000 -- (-422.260) [-417.765] (-421.379) (-415.218) * (-418.542) [-416.441] (-415.449) (-415.557) -- 0:00:20

      Average standard deviation of split frequencies: 0.008765

      670500 -- (-416.939) [-415.784] (-419.707) (-420.023) * (-419.896) (-416.994) [-417.696] (-417.930) -- 0:00:20
      671000 -- (-417.646) [-415.771] (-416.702) (-425.076) * (-415.976) [-418.951] (-418.582) (-424.439) -- 0:00:20
      671500 -- [-416.006] (-421.909) (-418.608) (-421.037) * (-415.697) (-415.646) [-415.266] (-415.974) -- 0:00:20
      672000 -- [-420.718] (-417.795) (-418.033) (-419.179) * (-416.296) (-415.275) [-415.280] (-417.703) -- 0:00:20
      672500 -- [-418.042] (-416.457) (-417.321) (-421.559) * (-419.833) (-416.193) [-418.364] (-418.675) -- 0:00:19
      673000 -- (-417.517) (-416.423) [-416.517] (-416.425) * (-417.985) (-414.886) (-417.287) [-417.454] -- 0:00:19
      673500 -- (-416.216) [-415.922] (-420.936) (-417.209) * [-417.179] (-415.969) (-417.971) (-422.787) -- 0:00:19
      674000 -- (-416.043) (-420.912) [-416.854] (-416.934) * (-417.719) [-417.062] (-421.449) (-418.109) -- 0:00:19
      674500 -- (-419.832) (-416.902) (-415.251) [-417.092] * [-416.074] (-416.228) (-419.118) (-418.535) -- 0:00:19
      675000 -- [-415.504] (-416.204) (-416.032) (-415.079) * (-418.562) [-420.704] (-418.066) (-415.856) -- 0:00:19

      Average standard deviation of split frequencies: 0.008368

      675500 -- (-419.653) (-419.522) (-417.113) [-417.042] * [-416.305] (-417.070) (-418.873) (-416.389) -- 0:00:19
      676000 -- (-415.125) [-416.330] (-415.350) (-418.075) * (-416.113) (-417.165) (-418.637) [-414.659] -- 0:00:19
      676500 -- (-415.186) (-415.307) [-416.950] (-418.687) * (-416.414) (-422.002) [-416.991] (-414.703) -- 0:00:19
      677000 -- (-419.115) (-416.372) (-416.096) [-417.150] * [-416.661] (-415.247) (-419.746) (-415.306) -- 0:00:19
      677500 -- (-421.163) [-417.895] (-415.619) (-418.747) * (-417.446) (-415.228) (-419.001) [-415.840] -- 0:00:19
      678000 -- (-417.112) (-416.760) (-419.130) [-418.119] * (-419.294) (-417.702) [-417.251] (-416.768) -- 0:00:19
      678500 -- [-415.973] (-416.289) (-416.537) (-418.117) * [-417.945] (-415.896) (-416.248) (-417.472) -- 0:00:19
      679000 -- (-415.445) (-416.085) (-418.377) [-415.755] * [-422.098] (-417.475) (-415.879) (-416.434) -- 0:00:19
      679500 -- [-415.834] (-415.077) (-417.910) (-421.316) * (-417.831) [-416.093] (-415.346) (-414.968) -- 0:00:19
      680000 -- [-416.538] (-414.679) (-416.699) (-417.599) * [-421.126] (-416.163) (-416.156) (-416.843) -- 0:00:19

      Average standard deviation of split frequencies: 0.008026

      680500 -- (-416.506) [-415.477] (-418.245) (-417.302) * (-415.359) (-416.006) [-419.622] (-416.707) -- 0:00:19
      681000 -- (-416.412) [-415.544] (-417.890) (-416.609) * (-416.222) [-417.453] (-419.626) (-418.352) -- 0:00:19
      681500 -- (-415.309) (-423.618) (-420.410) [-418.683] * (-415.429) (-416.375) [-416.986] (-420.293) -- 0:00:19
      682000 -- (-415.215) (-418.826) [-417.886] (-419.002) * (-416.463) (-414.773) (-419.937) [-422.608] -- 0:00:19
      682500 -- (-419.256) [-418.790] (-416.854) (-417.128) * (-415.315) (-416.447) (-419.284) [-414.783] -- 0:00:19
      683000 -- (-415.239) (-421.339) (-416.935) [-418.720] * (-416.670) [-415.508] (-419.419) (-420.282) -- 0:00:19
      683500 -- (-415.494) (-415.901) [-418.575] (-414.995) * (-415.742) [-416.814] (-417.639) (-417.650) -- 0:00:19
      684000 -- [-415.012] (-417.941) (-417.655) (-415.063) * (-420.455) (-415.617) (-420.448) [-417.030] -- 0:00:19
      684500 -- (-414.888) (-419.232) [-418.644] (-418.567) * [-417.239] (-415.373) (-416.955) (-417.208) -- 0:00:19
      685000 -- (-416.726) (-416.427) [-417.208] (-417.430) * (-416.420) [-416.467] (-416.913) (-416.598) -- 0:00:19

      Average standard deviation of split frequencies: 0.008044

      685500 -- (-417.047) [-418.364] (-416.266) (-421.050) * (-415.915) (-415.531) (-417.088) [-414.946] -- 0:00:19
      686000 -- (-417.035) (-420.464) (-420.281) [-415.567] * [-419.132] (-416.861) (-416.196) (-416.632) -- 0:00:19
      686500 -- (-421.260) [-418.739] (-417.568) (-416.428) * (-417.661) (-418.839) [-417.295] (-415.746) -- 0:00:19
      687000 -- (-415.516) [-417.832] (-417.641) (-417.722) * [-416.063] (-416.430) (-419.765) (-415.168) -- 0:00:19
      687500 -- (-418.247) (-416.056) [-415.545] (-415.842) * (-416.044) (-416.790) [-415.294] (-415.634) -- 0:00:19
      688000 -- (-417.945) [-418.066] (-415.125) (-419.348) * (-418.721) (-418.380) (-418.741) [-416.387] -- 0:00:19
      688500 -- [-418.292] (-418.540) (-415.250) (-417.484) * (-416.816) [-416.562] (-416.037) (-416.778) -- 0:00:19
      689000 -- (-418.381) (-416.634) (-418.366) [-415.233] * (-418.459) (-416.121) (-416.269) [-416.132] -- 0:00:18
      689500 -- [-416.666] (-418.594) (-418.062) (-416.894) * (-416.590) (-418.919) (-417.693) [-415.663] -- 0:00:18
      690000 -- (-416.591) (-416.714) [-419.349] (-415.494) * (-419.335) [-418.713] (-420.446) (-415.335) -- 0:00:18

      Average standard deviation of split frequencies: 0.008489

      690500 -- [-419.499] (-415.608) (-417.735) (-417.918) * (-415.917) [-416.474] (-418.215) (-416.182) -- 0:00:18
      691000 -- (-415.444) (-416.713) [-415.630] (-415.489) * (-418.000) [-415.474] (-419.403) (-417.185) -- 0:00:18
      691500 -- (-418.927) [-416.972] (-415.795) (-419.539) * [-415.522] (-421.910) (-419.164) (-418.219) -- 0:00:18
      692000 -- (-415.249) (-417.434) [-416.199] (-420.556) * (-415.917) (-416.487) [-420.688] (-415.841) -- 0:00:18
      692500 -- [-416.469] (-416.942) (-420.172) (-415.089) * [-415.663] (-415.681) (-419.829) (-417.744) -- 0:00:18
      693000 -- [-415.472] (-416.396) (-417.712) (-416.020) * (-420.319) (-416.149) (-421.245) [-421.392] -- 0:00:18
      693500 -- (-415.827) (-416.962) (-416.333) [-417.981] * [-415.385] (-415.813) (-420.205) (-416.039) -- 0:00:18
      694000 -- (-417.883) (-420.357) [-415.918] (-416.463) * [-418.122] (-416.565) (-418.350) (-416.297) -- 0:00:18
      694500 -- (-416.998) [-417.724] (-420.318) (-416.591) * (-417.439) (-417.682) (-416.887) [-417.542] -- 0:00:18
      695000 -- (-419.925) (-417.692) [-415.017] (-415.568) * (-415.343) (-419.180) (-417.968) [-418.162] -- 0:00:18

      Average standard deviation of split frequencies: 0.008212

      695500 -- (-416.130) (-415.428) (-416.035) [-415.150] * (-415.860) (-419.581) [-418.027] (-417.422) -- 0:00:18
      696000 -- (-416.717) (-417.570) (-415.536) [-415.434] * [-417.428] (-420.835) (-419.005) (-417.030) -- 0:00:18
      696500 -- (-416.104) (-416.376) (-418.131) [-415.286] * (-417.279) (-418.007) (-416.669) [-418.486] -- 0:00:18
      697000 -- (-415.334) [-415.146] (-418.188) (-419.050) * (-420.131) (-418.774) (-419.608) [-415.424] -- 0:00:18
      697500 -- (-418.906) [-415.211] (-417.467) (-415.028) * (-418.595) (-417.221) [-415.134] (-418.502) -- 0:00:18
      698000 -- (-415.719) [-416.626] (-415.831) (-415.974) * (-416.388) (-416.887) (-418.280) [-418.156] -- 0:00:18
      698500 -- (-415.108) (-425.462) [-416.798] (-417.111) * (-416.010) [-418.326] (-417.213) (-416.471) -- 0:00:18
      699000 -- (-415.541) [-416.857] (-416.137) (-417.517) * (-418.761) (-420.754) (-418.290) [-419.695] -- 0:00:18
      699500 -- (-415.091) (-417.782) (-418.238) [-419.215] * (-417.352) (-418.607) (-419.214) [-414.929] -- 0:00:18
      700000 -- (-415.713) (-416.980) [-416.031] (-418.674) * (-415.500) (-419.509) (-416.072) [-414.971] -- 0:00:18

      Average standard deviation of split frequencies: 0.007821

      700500 -- (-415.578) (-417.562) (-414.886) [-421.898] * [-415.898] (-418.123) (-417.610) (-416.666) -- 0:00:18
      701000 -- (-415.608) [-414.924] (-419.599) (-419.864) * (-415.320) [-416.474] (-417.754) (-415.786) -- 0:00:18
      701500 -- [-416.609] (-415.052) (-416.787) (-417.841) * (-415.182) (-415.018) (-416.126) [-415.486] -- 0:00:18
      702000 -- (-416.904) (-416.523) (-418.504) [-416.281] * (-415.396) (-415.338) (-417.708) [-415.678] -- 0:00:18
      702500 -- (-417.684) [-419.078] (-415.749) (-418.453) * [-416.854] (-418.909) (-419.876) (-417.056) -- 0:00:18
      703000 -- (-415.948) (-419.939) [-414.987] (-416.318) * (-416.146) (-416.395) (-421.864) [-417.116] -- 0:00:18
      703500 -- (-415.897) (-420.059) (-417.377) [-417.570] * [-414.849] (-415.693) (-415.988) (-418.000) -- 0:00:18
      704000 -- [-416.372] (-415.771) (-416.165) (-418.614) * (-415.199) [-416.699] (-415.485) (-416.310) -- 0:00:18
      704500 -- (-416.944) (-421.601) (-416.159) [-415.650] * [-418.235] (-418.436) (-416.834) (-415.175) -- 0:00:18
      705000 -- [-418.853] (-419.257) (-418.847) (-420.429) * [-416.087] (-416.529) (-416.382) (-417.773) -- 0:00:17

      Average standard deviation of split frequencies: 0.008054

      705500 -- (-416.125) (-419.620) (-417.012) [-419.694] * (-416.069) (-425.070) (-415.121) [-418.681] -- 0:00:17
      706000 -- (-416.127) [-417.618] (-416.960) (-419.834) * [-416.578] (-417.264) (-416.276) (-416.064) -- 0:00:17
      706500 -- (-416.017) (-420.966) (-415.553) [-418.932] * (-417.567) (-416.859) (-418.021) [-417.995] -- 0:00:17
      707000 -- (-418.260) (-417.392) (-416.672) [-417.324] * (-416.969) (-419.098) (-417.462) [-419.811] -- 0:00:17
      707500 -- (-417.946) (-415.665) [-416.951] (-415.976) * [-420.258] (-417.895) (-418.134) (-416.833) -- 0:00:17
      708000 -- [-419.508] (-418.085) (-417.353) (-419.117) * (-415.576) (-419.628) [-415.218] (-415.979) -- 0:00:17
      708500 -- [-417.448] (-420.017) (-417.971) (-416.294) * (-416.352) (-416.885) [-414.864] (-423.620) -- 0:00:17
      709000 -- (-417.752) (-417.992) (-420.759) [-416.795] * (-423.336) (-423.857) [-415.493] (-416.956) -- 0:00:17
      709500 -- (-415.491) (-417.161) [-419.307] (-418.498) * (-416.362) (-423.247) (-416.230) [-417.012] -- 0:00:17
      710000 -- (-417.284) (-418.328) (-418.344) [-420.616] * (-418.472) (-418.791) [-416.945] (-419.585) -- 0:00:17

      Average standard deviation of split frequencies: 0.007783

      710500 -- (-415.693) (-420.440) [-419.978] (-421.656) * (-418.478) (-416.635) [-416.490] (-415.906) -- 0:00:17
      711000 -- [-417.627] (-417.209) (-418.131) (-419.934) * (-420.416) (-418.543) (-418.407) [-417.088] -- 0:00:17
      711500 -- (-416.386) (-418.811) (-416.575) [-416.497] * (-420.797) [-417.072] (-417.014) (-417.011) -- 0:00:17
      712000 -- (-415.164) (-417.035) [-416.997] (-417.746) * (-417.789) (-420.941) (-419.919) [-417.251] -- 0:00:17
      712500 -- (-418.423) (-415.381) (-416.780) [-415.749] * (-418.787) (-419.483) (-419.507) [-415.132] -- 0:00:17
      713000 -- (-415.567) (-416.730) (-416.920) [-418.100] * (-419.263) (-416.544) (-415.079) [-415.770] -- 0:00:17
      713500 -- (-416.408) (-415.303) (-415.866) [-415.705] * [-419.386] (-416.730) (-417.008) (-417.272) -- 0:00:17
      714000 -- (-422.334) [-415.135] (-416.178) (-417.971) * (-423.202) (-418.175) [-415.035] (-416.509) -- 0:00:17
      714500 -- (-419.241) (-417.679) [-415.579] (-417.066) * (-419.919) [-416.246] (-417.101) (-417.033) -- 0:00:17
      715000 -- (-418.246) (-420.914) (-415.359) [-417.265] * (-418.638) (-419.801) (-417.008) [-416.420] -- 0:00:17

      Average standard deviation of split frequencies: 0.008189

      715500 -- (-415.207) [-415.905] (-422.061) (-419.012) * (-417.701) (-416.553) (-416.472) [-418.376] -- 0:00:17
      716000 -- (-416.672) (-417.546) [-415.944] (-416.070) * (-415.870) (-417.716) [-418.368] (-419.491) -- 0:00:17
      716500 -- (-417.358) (-416.897) (-416.411) [-420.854] * (-417.866) (-415.823) [-415.915] (-417.982) -- 0:00:17
      717000 -- [-415.960] (-417.074) (-416.166) (-416.365) * [-416.606] (-417.773) (-416.564) (-420.423) -- 0:00:17
      717500 -- (-418.155) (-417.655) [-418.792] (-415.441) * (-419.494) (-415.605) (-418.196) [-415.044] -- 0:00:17
      718000 -- (-416.742) (-415.786) [-415.676] (-415.859) * (-416.946) [-418.668] (-416.990) (-417.465) -- 0:00:17
      718500 -- (-417.199) (-418.411) [-415.067] (-414.985) * (-417.052) (-415.905) [-416.850] (-416.819) -- 0:00:17
      719000 -- [-414.898] (-417.358) (-417.428) (-417.091) * (-416.884) (-414.959) (-420.672) [-415.925] -- 0:00:17
      719500 -- (-417.102) (-415.586) [-415.948] (-417.461) * (-415.350) [-415.818] (-415.695) (-414.871) -- 0:00:17
      720000 -- [-415.484] (-415.195) (-416.756) (-416.939) * (-417.679) (-418.108) (-417.468) [-416.320] -- 0:00:17

      Average standard deviation of split frequencies: 0.008329

      720500 -- (-416.235) [-414.560] (-417.840) (-419.547) * [-415.448] (-417.336) (-423.377) (-418.216) -- 0:00:17
      721000 -- (-416.668) [-419.561] (-417.789) (-420.344) * [-418.681] (-415.563) (-416.828) (-418.652) -- 0:00:17
      721500 -- (-414.958) (-415.685) (-415.199) [-415.634] * (-416.895) (-415.847) [-417.311] (-417.314) -- 0:00:16
      722000 -- (-416.486) (-415.664) [-417.196] (-415.204) * (-416.795) [-416.084] (-417.748) (-417.687) -- 0:00:16
      722500 -- (-415.562) (-415.392) (-415.302) [-416.016] * [-417.948] (-421.020) (-418.995) (-416.016) -- 0:00:16
      723000 -- [-415.683] (-418.695) (-415.487) (-417.915) * (-422.143) [-422.190] (-416.098) (-417.455) -- 0:00:16
      723500 -- [-416.305] (-418.195) (-415.497) (-418.843) * (-420.147) (-417.715) (-415.032) [-417.018] -- 0:00:16
      724000 -- [-414.610] (-422.700) (-416.531) (-416.358) * [-417.219] (-416.783) (-417.107) (-417.748) -- 0:00:16
      724500 -- (-417.690) (-417.290) [-417.260] (-417.457) * (-416.971) (-418.067) [-418.324] (-415.371) -- 0:00:16
      725000 -- [-420.624] (-419.482) (-416.290) (-418.900) * (-415.680) (-416.340) [-417.681] (-418.146) -- 0:00:16

      Average standard deviation of split frequencies: 0.008365

      725500 -- [-415.438] (-417.131) (-417.101) (-417.622) * (-420.163) (-416.155) (-417.512) [-416.362] -- 0:00:16
      726000 -- (-419.644) [-417.104] (-420.581) (-416.473) * (-420.229) (-417.884) [-416.263] (-417.495) -- 0:00:16
      726500 -- (-420.851) (-424.254) (-415.611) [-416.637] * (-416.912) (-418.073) [-422.264] (-416.514) -- 0:00:16
      727000 -- (-416.063) (-417.704) (-427.002) [-415.994] * [-421.021] (-421.119) (-421.784) (-418.053) -- 0:00:16
      727500 -- (-415.627) (-418.988) (-415.522) [-415.703] * (-417.515) (-416.311) [-416.931] (-415.059) -- 0:00:16
      728000 -- [-415.850] (-419.285) (-419.892) (-418.380) * (-416.551) [-415.981] (-416.942) (-416.548) -- 0:00:16
      728500 -- (-417.550) (-419.232) [-416.717] (-420.630) * (-416.364) (-416.805) [-414.837] (-415.878) -- 0:00:16
      729000 -- (-417.666) [-417.015] (-418.368) (-416.363) * (-416.534) [-417.443] (-415.038) (-418.267) -- 0:00:16
      729500 -- (-418.057) [-416.423] (-415.751) (-416.619) * (-416.044) (-416.551) (-419.152) [-415.672] -- 0:00:16
      730000 -- (-416.305) [-415.359] (-416.338) (-418.202) * (-417.348) (-415.748) [-416.093] (-415.938) -- 0:00:16

      Average standard deviation of split frequencies: 0.008729

      730500 -- (-417.449) (-419.718) (-415.807) [-415.561] * (-417.850) [-415.217] (-415.242) (-415.286) -- 0:00:16
      731000 -- [-416.116] (-419.470) (-415.576) (-416.319) * (-416.751) (-415.934) (-417.836) [-415.607] -- 0:00:16
      731500 -- (-418.019) (-415.209) (-416.399) [-418.291] * (-416.475) (-416.071) (-416.152) [-416.848] -- 0:00:16
      732000 -- (-417.846) (-416.823) (-419.180) [-419.524] * (-417.909) (-415.185) [-416.255] (-415.446) -- 0:00:16
      732500 -- (-421.048) (-416.868) [-419.988] (-415.579) * (-416.938) (-419.585) (-416.781) [-415.852] -- 0:00:16
      733000 -- [-420.310] (-417.058) (-421.899) (-416.478) * (-415.039) (-416.071) [-417.213] (-418.664) -- 0:00:16
      733500 -- (-418.037) (-415.457) (-420.625) [-414.989] * [-415.992] (-417.906) (-418.918) (-415.890) -- 0:00:15
      734000 -- [-416.023] (-416.865) (-416.595) (-417.687) * (-416.922) (-416.960) [-416.204] (-418.148) -- 0:00:16
      734500 -- (-415.444) (-415.614) (-416.496) [-418.826] * (-416.756) (-415.610) [-415.012] (-418.809) -- 0:00:16
      735000 -- (-419.765) [-416.900] (-415.749) (-416.149) * (-416.551) [-418.162] (-416.059) (-417.277) -- 0:00:16

      Average standard deviation of split frequencies: 0.008687

      735500 -- (-418.376) (-416.342) [-416.172] (-417.097) * (-417.163) (-416.666) (-418.480) [-415.298] -- 0:00:16
      736000 -- (-416.993) (-416.069) [-419.568] (-416.353) * (-416.514) (-415.742) (-417.527) [-416.280] -- 0:00:16
      736500 -- [-416.033] (-418.063) (-418.169) (-416.346) * (-420.951) (-419.369) [-416.541] (-415.752) -- 0:00:16
      737000 -- (-415.648) (-419.093) (-417.744) [-415.862] * [-416.288] (-415.369) (-416.865) (-418.085) -- 0:00:16
      737500 -- (-419.290) (-416.672) [-415.931] (-416.639) * (-417.430) (-419.863) [-415.400] (-417.425) -- 0:00:16
      738000 -- (-416.194) [-416.006] (-416.234) (-417.172) * [-417.663] (-419.352) (-416.508) (-416.584) -- 0:00:15
      738500 -- (-417.584) (-416.092) [-418.339] (-415.407) * (-416.665) (-415.890) [-416.341] (-422.696) -- 0:00:15
      739000 -- (-414.800) (-417.456) (-416.284) [-415.734] * [-415.521] (-415.896) (-415.485) (-418.644) -- 0:00:15
      739500 -- (-416.995) [-416.412] (-416.259) (-420.830) * (-415.545) (-418.488) [-416.895] (-416.438) -- 0:00:15
      740000 -- (-416.168) (-417.854) [-415.406] (-416.163) * [-420.073] (-417.365) (-415.157) (-420.477) -- 0:00:15

      Average standard deviation of split frequencies: 0.008486

      740500 -- (-418.051) (-418.169) [-415.421] (-417.508) * (-417.642) (-415.675) (-416.303) [-415.934] -- 0:00:15
      741000 -- (-417.947) (-418.032) [-417.635] (-417.823) * (-418.320) [-416.653] (-417.252) (-421.015) -- 0:00:15
      741500 -- (-417.930) (-416.247) (-415.559) [-415.541] * [-416.489] (-415.102) (-419.914) (-418.710) -- 0:00:15
      742000 -- (-418.844) (-419.513) [-417.634] (-415.070) * (-418.334) (-417.208) [-418.292] (-416.804) -- 0:00:15
      742500 -- (-421.292) [-416.120] (-416.117) (-415.001) * (-418.751) [-415.449] (-417.317) (-416.974) -- 0:00:15
      743000 -- (-417.054) [-418.332] (-416.207) (-416.031) * [-417.270] (-417.772) (-417.519) (-416.938) -- 0:00:15
      743500 -- (-419.418) [-419.418] (-416.618) (-417.528) * [-416.451] (-415.577) (-417.770) (-417.221) -- 0:00:15
      744000 -- (-420.961) (-427.086) [-416.903] (-417.286) * [-416.491] (-415.784) (-416.577) (-416.621) -- 0:00:15
      744500 -- [-418.373] (-416.713) (-415.782) (-415.306) * (-420.487) [-423.425] (-418.292) (-422.682) -- 0:00:15
      745000 -- [-416.386] (-415.055) (-416.218) (-416.311) * (-420.918) (-420.381) (-416.934) [-417.270] -- 0:00:15

      Average standard deviation of split frequencies: 0.008257

      745500 -- (-415.766) (-418.314) [-415.622] (-414.619) * (-419.090) (-414.949) (-417.958) [-416.761] -- 0:00:15
      746000 -- (-419.156) (-418.423) [-415.114] (-416.707) * (-415.615) [-420.722] (-417.636) (-418.292) -- 0:00:15
      746500 -- (-420.297) (-418.378) (-415.632) [-416.552] * (-417.448) [-419.476] (-419.133) (-415.189) -- 0:00:15
      747000 -- (-417.155) (-424.984) (-415.092) [-420.891] * [-415.846] (-416.936) (-417.220) (-416.503) -- 0:00:15
      747500 -- (-415.311) (-420.826) [-416.465] (-420.011) * (-419.713) (-420.893) (-417.180) [-416.675] -- 0:00:15
      748000 -- (-417.075) [-418.591] (-417.587) (-420.668) * [-416.626] (-416.912) (-418.309) (-416.534) -- 0:00:15
      748500 -- (-416.286) (-417.535) [-420.178] (-418.124) * [-417.793] (-418.292) (-418.476) (-417.486) -- 0:00:15
      749000 -- (-417.051) (-420.816) [-418.447] (-414.829) * (-416.175) [-419.741] (-417.639) (-420.317) -- 0:00:15
      749500 -- [-417.070] (-415.864) (-415.736) (-416.781) * (-418.110) (-417.947) [-418.860] (-415.964) -- 0:00:15
      750000 -- (-416.660) [-415.387] (-417.122) (-419.615) * (-417.298) (-418.436) (-421.398) [-416.587] -- 0:00:15

      Average standard deviation of split frequencies: 0.007996

      750500 -- (-415.170) (-421.305) (-415.859) [-415.768] * (-417.717) (-417.388) [-417.944] (-415.640) -- 0:00:14
      751000 -- [-416.758] (-417.718) (-415.267) (-416.623) * [-416.746] (-419.596) (-419.722) (-415.150) -- 0:00:15
      751500 -- [-416.650] (-419.303) (-417.391) (-416.651) * (-423.809) (-419.669) [-415.589] (-415.615) -- 0:00:15
      752000 -- (-418.348) (-419.088) [-415.939] (-418.496) * (-417.636) (-417.268) [-416.647] (-419.335) -- 0:00:15
      752500 -- (-416.721) [-420.198] (-415.967) (-419.315) * (-416.509) (-417.909) [-419.168] (-421.963) -- 0:00:15
      753000 -- [-418.081] (-420.540) (-415.455) (-419.137) * (-416.671) (-419.599) (-415.311) [-416.132] -- 0:00:15
      753500 -- (-419.022) [-415.563] (-417.296) (-416.406) * (-414.840) (-417.079) (-419.149) [-421.823] -- 0:00:15
      754000 -- (-423.167) [-416.583] (-416.951) (-415.789) * [-414.971] (-417.225) (-417.352) (-417.124) -- 0:00:15
      754500 -- (-421.865) (-417.139) (-416.597) [-414.744] * (-420.254) (-416.629) (-416.836) [-417.016] -- 0:00:14
      755000 -- [-417.742] (-417.690) (-416.511) (-416.896) * (-417.357) (-419.357) (-419.342) [-416.059] -- 0:00:14

      Average standard deviation of split frequencies: 0.008189

      755500 -- [-417.276] (-415.910) (-416.962) (-416.070) * (-417.481) (-415.825) (-420.668) [-415.431] -- 0:00:14
      756000 -- (-421.022) [-417.689] (-419.567) (-415.186) * [-416.307] (-419.406) (-416.736) (-416.710) -- 0:00:14
      756500 -- [-418.244] (-421.612) (-416.974) (-416.196) * (-416.149) (-416.542) [-419.371] (-415.770) -- 0:00:14
      757000 -- (-420.113) [-418.844] (-420.203) (-415.594) * [-421.095] (-417.771) (-415.912) (-418.509) -- 0:00:14
      757500 -- (-416.666) [-420.073] (-419.250) (-419.856) * [-417.959] (-416.040) (-416.832) (-418.974) -- 0:00:14
      758000 -- [-417.080] (-422.183) (-421.646) (-417.029) * (-416.124) (-421.314) [-418.519] (-417.179) -- 0:00:14
      758500 -- [-416.711] (-417.133) (-420.258) (-420.000) * (-418.797) [-416.626] (-416.954) (-416.609) -- 0:00:14
      759000 -- (-417.638) (-420.164) (-417.025) [-422.296] * [-418.864] (-422.307) (-420.063) (-416.314) -- 0:00:14
      759500 -- [-418.989] (-417.933) (-422.804) (-416.106) * [-415.606] (-420.335) (-420.214) (-415.596) -- 0:00:14
      760000 -- (-418.514) [-417.736] (-416.554) (-416.206) * [-415.619] (-421.083) (-416.923) (-418.121) -- 0:00:14

      Average standard deviation of split frequencies: 0.008263

      760500 -- (-420.733) [-417.346] (-415.831) (-418.222) * (-415.442) [-416.533] (-420.722) (-418.763) -- 0:00:14
      761000 -- (-419.327) (-416.699) [-415.022] (-423.777) * [-415.690] (-415.012) (-421.990) (-417.450) -- 0:00:14
      761500 -- (-420.416) (-416.626) [-416.202] (-422.906) * [-415.741] (-415.772) (-420.165) (-419.847) -- 0:00:14
      762000 -- (-417.812) [-416.433] (-419.944) (-415.948) * (-416.562) (-417.988) [-418.015] (-422.854) -- 0:00:14
      762500 -- (-415.543) [-416.304] (-416.074) (-415.385) * (-418.662) (-416.513) (-416.930) [-420.062] -- 0:00:14
      763000 -- (-415.231) (-422.630) [-415.526] (-417.380) * [-416.873] (-418.401) (-415.313) (-419.357) -- 0:00:14
      763500 -- (-414.643) (-415.940) [-415.891] (-417.337) * [-416.249] (-417.365) (-418.104) (-417.988) -- 0:00:14
      764000 -- [-416.419] (-417.741) (-419.682) (-417.041) * (-415.462) (-420.295) (-415.518) [-417.751] -- 0:00:14
      764500 -- (-416.166) [-417.000] (-415.563) (-415.693) * (-416.085) (-420.848) [-416.674] (-418.800) -- 0:00:14
      765000 -- (-416.518) [-418.737] (-418.545) (-417.122) * (-415.403) [-416.676] (-416.453) (-416.872) -- 0:00:14

      Average standard deviation of split frequencies: 0.008288

      765500 -- (-415.459) (-415.248) [-416.523] (-420.145) * (-415.322) (-423.662) [-416.381] (-417.188) -- 0:00:14
      766000 -- (-415.408) [-423.256] (-414.745) (-416.170) * [-417.603] (-419.788) (-419.228) (-415.936) -- 0:00:14
      766500 -- (-417.370) (-418.617) (-415.635) [-415.618] * [-415.658] (-415.432) (-420.391) (-416.016) -- 0:00:14
      767000 -- (-416.906) (-414.792) [-422.923] (-415.518) * (-420.932) (-415.194) (-415.973) [-416.602] -- 0:00:13
      767500 -- (-416.313) (-422.709) [-415.976] (-416.783) * (-417.369) [-415.147] (-418.060) (-417.984) -- 0:00:14
      768000 -- (-417.260) (-418.369) [-416.111] (-418.485) * (-417.020) [-418.846] (-419.056) (-421.097) -- 0:00:14
      768500 -- (-417.201) (-422.251) (-419.063) [-420.313] * (-416.755) (-417.634) [-415.612] (-416.499) -- 0:00:14
      769000 -- (-415.897) (-415.931) (-419.651) [-415.692] * (-418.018) [-415.381] (-421.609) (-417.284) -- 0:00:14
      769500 -- (-417.359) (-416.507) [-417.415] (-417.702) * (-415.680) (-417.411) [-417.858] (-417.855) -- 0:00:14
      770000 -- (-418.131) [-418.111] (-419.102) (-427.790) * (-415.090) [-418.575] (-422.207) (-419.756) -- 0:00:14

      Average standard deviation of split frequencies: 0.008074

      770500 -- [-417.674] (-417.846) (-420.700) (-419.523) * (-416.867) [-415.369] (-417.144) (-417.353) -- 0:00:13
      771000 -- (-418.925) (-417.037) [-417.008] (-419.903) * (-417.906) (-416.216) [-417.885] (-418.025) -- 0:00:13
      771500 -- [-416.083] (-418.570) (-416.731) (-418.581) * (-416.799) (-424.999) [-417.779] (-416.230) -- 0:00:13
      772000 -- (-415.828) [-415.547] (-415.913) (-416.814) * (-419.372) (-417.929) (-417.038) [-416.203] -- 0:00:13
      772500 -- (-417.909) (-418.754) [-418.913] (-418.848) * [-416.429] (-416.979) (-421.008) (-417.215) -- 0:00:13
      773000 -- (-419.190) (-416.425) (-417.329) [-417.510] * (-417.373) [-418.925] (-416.374) (-416.083) -- 0:00:13
      773500 -- [-416.956] (-417.989) (-418.260) (-416.249) * (-420.630) (-414.602) [-417.135] (-417.675) -- 0:00:13
      774000 -- (-417.703) [-417.697] (-418.615) (-417.041) * [-417.187] (-414.766) (-417.238) (-415.055) -- 0:00:13
      774500 -- (-418.805) [-419.565] (-415.419) (-416.298) * (-416.337) (-419.824) (-418.934) [-417.538] -- 0:00:13
      775000 -- (-415.226) (-420.697) (-416.039) [-415.589] * (-416.628) (-419.336) [-415.629] (-417.792) -- 0:00:13

      Average standard deviation of split frequencies: 0.008059

      775500 -- [-416.953] (-418.283) (-414.994) (-416.990) * (-415.516) [-417.258] (-417.199) (-421.936) -- 0:00:13
      776000 -- (-417.469) (-416.700) [-416.620] (-419.431) * (-417.866) (-417.374) [-415.730] (-418.978) -- 0:00:13
      776500 -- [-420.035] (-415.917) (-416.757) (-420.878) * (-415.573) (-416.149) (-417.278) [-419.235] -- 0:00:13
      777000 -- [-420.272] (-416.311) (-416.036) (-417.017) * [-416.356] (-416.177) (-418.863) (-416.143) -- 0:00:13
      777500 -- [-417.416] (-419.145) (-418.655) (-418.814) * (-418.861) (-415.166) [-420.724] (-415.457) -- 0:00:13
      778000 -- (-415.173) [-418.670] (-419.206) (-418.095) * [-417.354] (-415.382) (-420.119) (-417.292) -- 0:00:13
      778500 -- (-419.183) (-418.880) (-417.135) [-415.294] * (-419.171) (-415.804) (-417.859) [-417.903] -- 0:00:13
      779000 -- [-417.779] (-418.610) (-415.205) (-416.340) * (-424.105) (-419.486) (-416.682) [-418.542] -- 0:00:13
      779500 -- (-421.039) [-415.593] (-415.566) (-418.404) * (-418.581) (-416.914) (-416.154) [-415.973] -- 0:00:13
      780000 -- (-415.893) (-419.218) [-416.888] (-414.727) * (-417.074) (-416.836) [-419.048] (-416.754) -- 0:00:13

      Average standard deviation of split frequencies: 0.008534

      780500 -- [-420.169] (-415.125) (-417.627) (-416.990) * [-415.076] (-425.122) (-417.450) (-416.129) -- 0:00:13
      781000 -- (-415.004) (-415.216) [-415.458] (-418.085) * (-420.145) (-417.586) [-415.942] (-415.819) -- 0:00:13
      781500 -- (-416.026) (-415.988) (-415.549) [-416.153] * [-419.019] (-417.584) (-418.873) (-420.035) -- 0:00:13
      782000 -- (-416.816) (-417.179) [-419.335] (-416.616) * (-416.549) (-415.325) [-424.921] (-419.597) -- 0:00:13
      782500 -- (-416.351) (-418.148) (-419.586) [-416.718] * (-417.294) [-418.579] (-415.948) (-421.502) -- 0:00:13
      783000 -- (-417.302) (-421.261) (-419.448) [-417.203] * [-416.950] (-417.421) (-416.331) (-416.565) -- 0:00:13
      783500 -- [-415.049] (-416.309) (-415.394) (-415.316) * (-415.694) [-416.416] (-417.201) (-419.269) -- 0:00:12
      784000 -- (-417.073) [-415.129] (-417.551) (-417.086) * (-417.018) (-415.918) [-416.979] (-418.467) -- 0:00:12
      784500 -- (-414.682) (-416.798) [-419.233] (-418.311) * (-417.459) (-414.792) (-415.397) [-420.043] -- 0:00:12
      785000 -- (-414.837) [-417.847] (-418.855) (-417.082) * (-418.183) (-418.063) (-416.379) [-416.985] -- 0:00:13

      Average standard deviation of split frequencies: 0.008996

      785500 -- (-417.285) [-415.483] (-420.049) (-421.639) * (-417.568) (-415.787) (-415.701) [-416.220] -- 0:00:13
      786000 -- [-416.149] (-416.011) (-419.986) (-417.609) * [-415.544] (-416.741) (-415.769) (-417.902) -- 0:00:13
      786500 -- [-417.793] (-417.270) (-416.626) (-422.984) * [-415.532] (-418.590) (-417.473) (-417.423) -- 0:00:13
      787000 -- (-418.581) (-417.178) (-418.701) [-415.299] * (-416.778) (-416.620) [-418.810] (-416.359) -- 0:00:12
      787500 -- (-419.176) [-418.575] (-417.971) (-416.187) * (-419.983) (-417.360) [-419.543] (-418.875) -- 0:00:12
      788000 -- [-416.000] (-417.554) (-417.455) (-417.803) * (-415.455) (-416.132) (-416.742) [-416.311] -- 0:00:12
      788500 -- (-415.481) [-417.461] (-416.400) (-417.655) * (-417.243) (-415.207) (-419.149) [-419.424] -- 0:00:12
      789000 -- [-416.085] (-416.634) (-418.828) (-419.727) * (-414.846) [-415.277] (-418.902) (-415.848) -- 0:00:12
      789500 -- (-416.717) (-416.498) [-416.435] (-421.293) * [-415.115] (-416.167) (-414.850) (-416.089) -- 0:00:12
      790000 -- (-415.852) (-417.484) (-418.913) [-419.134] * (-416.367) (-415.566) [-422.175] (-418.026) -- 0:00:12

      Average standard deviation of split frequencies: 0.009715

      790500 -- [-414.947] (-417.520) (-416.658) (-417.312) * [-416.208] (-416.621) (-420.429) (-422.569) -- 0:00:12
      791000 -- (-416.917) [-415.510] (-416.195) (-417.725) * (-415.178) (-416.679) [-416.068] (-418.079) -- 0:00:12
      791500 -- (-417.245)