--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:00:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -358.04 -362.91
2 -357.96 -360.98
--------------------------------------
TOTAL -358.00 -362.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894293 0.089871 0.344679 1.469878 0.850001 1483.32 1492.16 1.000
r(A<->C){all} 0.161735 0.019149 0.000009 0.435403 0.124345 205.02 279.66 1.000
r(A<->G){all} 0.178192 0.024099 0.000067 0.498251 0.137046 211.43 259.52 1.000
r(A<->T){all} 0.159791 0.019425 0.000036 0.439329 0.118023 152.82 216.65 1.000
r(C<->G){all} 0.158637 0.018846 0.000016 0.445549 0.122136 220.40 266.65 1.000
r(C<->T){all} 0.172427 0.021933 0.000144 0.478157 0.131582 132.20 175.98 1.001
r(G<->T){all} 0.169218 0.020173 0.000253 0.461382 0.131096 223.62 293.53 1.002
pi(A){all} 0.194991 0.000582 0.150514 0.243366 0.193972 1314.09 1407.54 1.000
pi(C){all} 0.298307 0.000799 0.243550 0.353424 0.297883 1122.03 1226.86 1.000
pi(G){all} 0.331283 0.000835 0.273732 0.386094 0.330701 1369.36 1405.65 1.000
pi(T){all} 0.175419 0.000551 0.129914 0.221356 0.174642 1201.67 1351.33 1.000
alpha{1,2} 0.416642 0.221459 0.000154 1.375027 0.247327 1248.96 1304.95 1.000
alpha{3} 0.462859 0.240775 0.000304 1.426065 0.301427 1248.74 1251.71 1.000
pinvar{all} 0.993520 0.000065 0.978283 0.999997 0.996114 1298.97 1399.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -340.976031
Model 2: PositiveSelection -340.976002
Model 0: one-ratio -340.976027
Model 7: beta -340.976063
Model 8: beta&w>1 -340.976009
Model 0 vs 1 7.999999979801942E-6
Model 2 vs 1 5.7999999967250915E-5
Model 8 vs 7 1.0800000006838673E-4
>C1
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C2
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C3
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C4
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C5
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C6
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=88
C1 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C2 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C3 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C4 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C5 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C6 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
**************************************************
C1 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C2 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C3 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C4 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C5 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C6 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2640]--->[2640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.610 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C2 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C3 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C4 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C5 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C6 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
**************************************************
C1 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C2 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C3 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C4 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C5 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C6 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C2 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C3 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C4 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C5 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C6 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
**************************************************
C1 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C2 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C3 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C4 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C5 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C6 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
**************************************************
C1 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C2 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C3 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C4 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C5 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C6 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
**************************************************
C1 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C2 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C3 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C4 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C5 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C6 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
**************************************************
C1 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C2 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C3 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C4 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C5 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C6 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
**************************************************
C1 GGCTAACCGCCGAC
C2 GGCTAACCGCCGAC
C3 GGCTAACCGCCGAC
C4 GGCTAACCGCCGAC
C5 GGCTAACCGCCGAC
C6 GGCTAACCGCCGAC
**************
>C1
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C2
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C3
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C4
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C5
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C6
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C1
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C2
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C3
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C4
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C5
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C6
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 264 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791528
Setting output file names to "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1531220819
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0357051392
Seed = 1086987701
Swapseed = 1579791528
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -590.844566 -- -24.965149
Chain 2 -- -590.844622 -- -24.965149
Chain 3 -- -590.844656 -- -24.965149
Chain 4 -- -590.844622 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -590.844622 -- -24.965149
Chain 2 -- -590.844656 -- -24.965149
Chain 3 -- -590.844656 -- -24.965149
Chain 4 -- -590.844622 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-590.845] (-590.845) (-590.845) (-590.845) * [-590.845] (-590.845) (-590.845) (-590.845)
500 -- (-370.399) (-379.456) [-372.718] (-362.647) * (-365.606) [-371.451] (-366.179) (-376.047) -- 0:00:00
1000 -- (-361.912) [-373.913] (-375.654) (-366.408) * (-373.354) [-367.868] (-368.527) (-369.022) -- 0:00:00
1500 -- (-367.464) (-365.987) (-367.878) [-366.323] * (-374.638) [-361.600] (-364.570) (-370.949) -- 0:00:00
2000 -- [-361.905] (-361.572) (-364.834) (-366.314) * (-366.954) [-366.173] (-367.362) (-365.065) -- 0:08:19
2500 -- (-367.251) (-371.295) (-372.776) [-369.125] * [-368.712] (-370.755) (-369.812) (-372.679) -- 0:06:39
3000 -- (-367.734) (-365.334) (-373.281) [-367.401] * (-372.051) (-367.827) [-362.905] (-371.332) -- 0:05:32
3500 -- [-367.931] (-364.316) (-366.988) (-366.519) * (-365.452) [-365.081] (-373.941) (-368.924) -- 0:04:44
4000 -- (-362.560) (-371.346) (-378.581) [-367.075] * (-373.841) [-363.652] (-361.853) (-364.172) -- 0:04:09
4500 -- (-371.078) [-362.372] (-367.243) (-372.080) * (-364.814) [-367.988] (-369.909) (-369.464) -- 0:03:41
5000 -- [-364.898] (-369.701) (-370.242) (-371.830) * (-375.206) (-365.621) (-364.954) [-365.926] -- 0:03:19
Average standard deviation of split frequencies: 0.049997
5500 -- (-369.386) (-369.464) (-371.702) [-366.889] * (-367.844) [-366.550] (-359.444) (-367.514) -- 0:03:00
6000 -- (-367.582) (-367.751) [-368.696] (-369.651) * (-367.840) (-369.944) (-367.422) [-367.481] -- 0:02:45
6500 -- (-373.383) [-365.556] (-370.203) (-365.669) * (-374.911) (-376.371) (-365.772) [-364.925] -- 0:02:32
7000 -- [-368.883] (-367.472) (-374.988) (-370.585) * (-369.539) (-378.018) [-368.111] (-371.352) -- 0:02:21
7500 -- (-364.280) (-370.260) [-377.943] (-373.677) * (-369.304) [-363.799] (-366.101) (-367.232) -- 0:02:12
8000 -- [-365.584] (-364.559) (-379.236) (-367.926) * (-364.738) [-371.002] (-373.774) (-375.091) -- 0:02:04
8500 -- (-362.438) (-368.659) (-359.585) [-365.406] * [-364.146] (-369.903) (-369.295) (-367.106) -- 0:01:56
9000 -- [-374.579] (-370.308) (-360.221) (-367.701) * (-374.169) (-371.030) [-371.952] (-371.605) -- 0:01:50
9500 -- (-374.097) (-367.408) [-358.782] (-367.226) * (-365.076) (-371.716) [-362.228] (-374.509) -- 0:01:44
10000 -- (-368.241) (-363.980) [-358.613] (-381.235) * (-367.046) (-383.052) [-365.053] (-373.163) -- 0:01:39
Average standard deviation of split frequencies: 0.064082
10500 -- (-375.188) [-368.428] (-358.741) (-372.367) * (-364.727) (-377.535) [-374.655] (-368.065) -- 0:01:34
11000 -- (-377.632) [-364.229] (-359.836) (-368.850) * (-372.182) [-357.059] (-364.897) (-371.074) -- 0:01:29
11500 -- [-358.032] (-368.008) (-357.496) (-378.378) * (-362.880) (-360.479) (-373.668) [-371.671] -- 0:01:25
12000 -- (-359.301) (-372.806) (-357.328) [-359.340] * (-363.154) (-359.183) (-367.662) [-365.111] -- 0:01:22
12500 -- (-358.389) [-367.711] (-357.369) (-358.209) * (-368.906) [-362.999] (-363.567) (-371.160) -- 0:01:19
13000 -- (-358.792) (-366.174) [-357.440] (-358.445) * (-368.125) [-357.699] (-369.388) (-369.252) -- 0:01:15
13500 -- (-358.796) (-365.632) (-359.659) [-359.314] * (-371.377) [-359.020] (-377.050) (-364.265) -- 0:01:13
14000 -- [-357.254] (-370.346) (-359.114) (-359.023) * (-367.615) [-358.018] (-369.726) (-368.531) -- 0:01:10
14500 -- (-361.500) [-370.344] (-359.293) (-357.272) * (-363.758) [-358.443] (-366.075) (-379.276) -- 0:01:07
15000 -- (-358.610) (-367.427) (-359.455) [-362.454] * (-374.800) [-357.095] (-370.636) (-372.615) -- 0:01:05
Average standard deviation of split frequencies: 0.050087
15500 -- (-358.702) [-365.419] (-359.743) (-357.521) * (-367.957) [-358.187] (-381.094) (-380.386) -- 0:01:03
16000 -- (-357.653) (-364.109) [-359.081] (-358.247) * (-369.099) (-357.644) [-368.936] (-372.310) -- 0:01:01
16500 -- (-356.744) [-367.762] (-358.515) (-360.014) * (-369.966) [-357.142] (-375.536) (-360.933) -- 0:00:59
17000 -- (-359.370) (-367.956) [-360.125] (-356.962) * (-365.770) (-358.499) (-364.411) [-360.917] -- 0:00:57
17500 -- (-359.304) (-364.863) [-360.500] (-356.800) * (-368.184) [-359.084] (-368.916) (-358.275) -- 0:00:56
18000 -- (-358.696) [-366.128] (-357.818) (-357.134) * (-369.312) (-358.008) [-366.369] (-357.957) -- 0:00:54
18500 -- (-360.994) (-366.356) [-357.886] (-357.347) * (-372.054) (-359.304) (-370.855) [-360.418] -- 0:01:46
19000 -- (-359.318) [-368.570] (-362.892) (-357.583) * (-365.839) (-359.608) (-368.486) [-357.535] -- 0:01:43
19500 -- (-358.361) (-367.344) (-356.596) [-362.371] * [-367.584] (-359.925) (-368.826) (-360.719) -- 0:01:40
20000 -- [-357.534] (-369.505) (-356.754) (-359.075) * (-387.454) (-357.724) (-366.803) [-359.340] -- 0:01:38
Average standard deviation of split frequencies: 0.029146
20500 -- (-361.726) [-362.366] (-358.090) (-360.820) * [-368.405] (-356.872) (-369.288) (-359.075) -- 0:01:35
21000 -- (-358.882) (-373.340) [-361.865] (-359.666) * (-378.690) (-357.063) [-365.064] (-359.529) -- 0:01:33
21500 -- [-356.502] (-372.223) (-360.520) (-356.693) * (-372.394) (-357.010) [-366.655] (-360.896) -- 0:01:31
22000 -- (-358.225) (-369.483) (-360.428) [-357.024] * (-362.199) [-357.156] (-374.670) (-357.615) -- 0:01:28
22500 -- (-357.517) (-371.893) [-360.356] (-357.992) * (-362.568) (-357.920) [-371.452] (-358.592) -- 0:01:26
23000 -- (-361.118) [-363.994] (-358.201) (-357.199) * (-358.437) (-360.251) [-366.353] (-358.553) -- 0:01:24
23500 -- (-357.363) [-367.186] (-357.027) (-356.442) * (-361.138) (-358.572) [-369.849] (-360.369) -- 0:01:23
24000 -- (-357.938) (-371.391) [-357.127] (-358.985) * (-357.982) [-358.754] (-382.681) (-358.938) -- 0:01:21
24500 -- (-359.638) (-364.411) [-358.872] (-356.915) * (-357.791) (-357.470) [-364.365] (-359.121) -- 0:01:19
25000 -- [-358.032] (-373.358) (-358.858) (-358.794) * (-368.495) (-357.680) (-371.721) [-358.892] -- 0:01:18
Average standard deviation of split frequencies: 0.032808
25500 -- (-359.155) [-363.461] (-359.636) (-358.560) * (-361.288) (-358.143) [-371.604] (-361.350) -- 0:01:16
26000 -- (-361.074) [-366.285] (-362.135) (-357.853) * (-357.583) (-357.993) [-363.223] (-359.012) -- 0:01:14
26500 -- (-357.925) (-369.279) [-358.041] (-362.789) * (-357.966) (-361.571) (-362.891) [-364.242] -- 0:01:13
27000 -- (-364.200) (-366.522) [-358.029] (-357.773) * (-358.254) [-358.562] (-365.937) (-357.216) -- 0:01:12
27500 -- (-362.447) (-365.458) [-360.028] (-357.623) * (-357.261) (-362.670) (-371.074) [-357.887] -- 0:01:10
28000 -- (-360.379) (-367.504) [-358.478] (-359.996) * (-359.648) (-357.662) [-367.177] (-357.650) -- 0:01:09
28500 -- [-360.994] (-365.178) (-358.416) (-356.877) * (-358.521) (-358.236) [-363.528] (-358.186) -- 0:01:08
29000 -- (-361.596) (-371.535) (-357.922) [-363.677] * (-358.433) [-359.585] (-373.013) (-359.626) -- 0:01:06
29500 -- [-358.380] (-369.557) (-357.462) (-362.346) * [-357.467] (-359.127) (-369.565) (-357.432) -- 0:01:05
30000 -- [-358.169] (-361.385) (-357.047) (-360.139) * [-358.986] (-356.641) (-372.040) (-356.617) -- 0:01:04
Average standard deviation of split frequencies: 0.033818
30500 -- (-357.907) (-357.328) (-357.691) [-358.568] * (-356.594) [-358.942] (-366.363) (-361.883) -- 0:01:03
31000 -- (-358.615) [-359.168] (-358.391) (-362.677) * (-357.768) [-359.612] (-370.668) (-358.266) -- 0:01:02
31500 -- [-358.134] (-359.609) (-357.069) (-358.005) * [-362.612] (-357.828) (-372.891) (-357.464) -- 0:01:01
32000 -- (-357.606) (-359.718) (-360.372) [-357.725] * (-356.809) (-358.684) [-368.292] (-358.630) -- 0:01:00
32500 -- (-359.128) [-360.390] (-358.805) (-358.531) * (-357.612) (-361.825) (-368.002) [-359.993] -- 0:00:59
33000 -- (-361.966) (-357.536) [-359.057] (-359.680) * [-357.401] (-358.791) (-370.324) (-359.182) -- 0:00:58
33500 -- (-360.637) (-359.098) (-358.183) [-359.091] * [-357.406] (-357.778) (-377.000) (-361.013) -- 0:00:57
34000 -- (-358.697) [-357.001] (-357.956) (-358.311) * (-358.685) [-357.694] (-376.615) (-358.923) -- 0:00:56
34500 -- [-359.172] (-358.453) (-357.144) (-358.004) * (-363.743) (-360.165) [-368.115] (-357.551) -- 0:00:55
35000 -- (-357.337) (-361.947) (-358.354) [-358.247] * (-361.261) (-357.591) (-368.613) [-358.613] -- 0:01:22
Average standard deviation of split frequencies: 0.036527
35500 -- [-358.405] (-360.986) (-359.722) (-362.163) * (-359.064) (-362.494) (-383.357) [-360.550] -- 0:01:21
36000 -- (-359.015) [-359.076] (-357.065) (-358.885) * (-356.563) (-358.927) (-374.796) [-357.820] -- 0:01:20
36500 -- [-357.467] (-358.749) (-357.395) (-360.364) * (-361.689) [-358.105] (-378.454) (-359.441) -- 0:01:19
37000 -- (-358.656) [-357.517] (-357.383) (-359.163) * (-363.814) (-358.246) (-369.396) [-357.494] -- 0:01:18
37500 -- (-361.418) (-357.594) [-358.770] (-356.849) * (-358.562) [-357.474] (-366.889) (-361.173) -- 0:01:17
38000 -- (-358.122) (-358.478) [-361.936] (-361.198) * (-359.280) (-359.021) (-359.214) [-360.082] -- 0:01:15
38500 -- (-358.613) (-357.451) [-357.896] (-357.966) * (-365.459) (-357.097) [-357.357] (-357.891) -- 0:01:14
39000 -- (-357.231) [-358.614] (-358.896) (-361.688) * (-360.692) (-357.862) [-357.568] (-356.641) -- 0:01:13
39500 -- (-357.920) (-356.844) (-359.302) [-357.784] * (-358.455) (-359.187) [-358.016] (-360.516) -- 0:01:12
40000 -- (-358.380) (-356.407) (-357.395) [-358.855] * (-357.033) (-360.994) [-359.137] (-365.113) -- 0:01:12
Average standard deviation of split frequencies: 0.040267
40500 -- (-357.310) (-356.311) (-359.708) [-358.136] * (-359.094) (-359.678) (-358.134) [-358.121] -- 0:01:11
41000 -- (-359.077) [-357.137] (-360.621) (-359.806) * [-359.582] (-360.307) (-357.553) (-358.468) -- 0:01:10
41500 -- (-359.164) [-361.995] (-362.574) (-358.856) * (-359.147) (-359.246) (-358.614) [-356.647] -- 0:01:09
42000 -- (-362.039) [-358.461] (-362.757) (-358.737) * (-358.277) (-363.115) [-358.268] (-361.936) -- 0:01:08
42500 -- (-361.481) (-358.106) (-357.329) [-358.017] * (-357.894) (-358.650) [-358.232] (-358.044) -- 0:01:07
43000 -- (-358.939) [-357.040] (-357.847) (-356.843) * [-356.769] (-357.458) (-360.813) (-359.305) -- 0:01:06
43500 -- (-362.402) (-358.395) [-359.824] (-357.776) * (-358.205) (-359.735) [-360.509] (-357.711) -- 0:01:05
44000 -- [-357.955] (-359.430) (-360.503) (-357.306) * [-357.287] (-358.207) (-360.458) (-357.622) -- 0:01:05
44500 -- (-363.938) [-357.334] (-361.503) (-363.384) * (-356.973) (-357.286) (-357.778) [-358.987] -- 0:01:04
45000 -- [-358.726] (-359.031) (-360.189) (-365.669) * (-362.009) [-357.444] (-359.020) (-358.200) -- 0:01:03
Average standard deviation of split frequencies: 0.029853
45500 -- (-359.388) [-358.613] (-359.729) (-369.201) * (-358.910) (-358.553) [-357.358] (-359.915) -- 0:01:02
46000 -- (-358.305) [-358.645] (-356.701) (-362.468) * (-359.655) (-358.950) (-357.258) [-358.187] -- 0:01:02
46500 -- (-358.439) (-357.432) (-359.910) [-357.805] * (-361.042) [-358.882] (-359.947) (-356.658) -- 0:01:01
47000 -- (-360.955) [-357.139] (-360.892) (-357.652) * [-360.204] (-359.652) (-361.953) (-359.061) -- 0:01:00
47500 -- (-358.769) (-358.713) (-362.080) [-360.516] * [-358.713] (-358.348) (-362.644) (-361.843) -- 0:01:00
48000 -- (-357.766) (-357.820) [-358.470] (-360.387) * [-356.800] (-359.229) (-361.137) (-359.449) -- 0:00:59
48500 -- (-359.776) [-360.402] (-357.819) (-359.828) * [-358.859] (-363.779) (-360.100) (-358.038) -- 0:00:58
49000 -- (-358.829) (-358.116) [-358.962] (-363.454) * (-360.997) (-358.323) (-361.580) [-360.450] -- 0:00:58
49500 -- (-359.533) (-359.500) [-358.769] (-359.474) * [-358.790] (-359.023) (-359.738) (-357.844) -- 0:01:16
50000 -- [-358.782] (-356.422) (-359.749) (-359.461) * (-358.583) (-358.886) [-359.831] (-361.145) -- 0:01:16
Average standard deviation of split frequencies: 0.035947
50500 -- (-359.811) [-359.562] (-357.826) (-359.026) * (-360.563) (-359.264) [-359.717] (-361.184) -- 0:01:15
51000 -- [-358.584] (-357.408) (-357.453) (-359.762) * [-359.265] (-360.233) (-360.044) (-358.267) -- 0:01:14
51500 -- [-358.851] (-358.683) (-357.123) (-357.882) * (-358.442) (-358.100) [-359.596] (-358.064) -- 0:01:13
52000 -- [-357.730] (-360.517) (-360.126) (-359.324) * (-356.900) [-361.718] (-359.387) (-357.645) -- 0:01:12
52500 -- (-359.628) [-360.744] (-359.563) (-357.959) * [-362.323] (-362.106) (-360.585) (-359.137) -- 0:01:12
53000 -- (-359.594) (-359.319) [-357.030] (-359.857) * (-359.295) (-365.017) (-357.831) [-356.783] -- 0:01:11
53500 -- [-356.663] (-357.065) (-358.433) (-367.562) * [-357.927] (-356.914) (-356.585) (-360.638) -- 0:01:10
54000 -- (-358.082) [-358.194] (-357.394) (-357.830) * [-357.015] (-359.192) (-357.954) (-357.682) -- 0:01:10
54500 -- (-359.581) (-360.801) [-363.128] (-357.176) * [-357.294] (-357.522) (-359.779) (-358.455) -- 0:01:09
55000 -- (-360.702) (-358.094) (-361.678) [-356.989] * (-358.647) [-359.857] (-359.998) (-363.198) -- 0:01:08
Average standard deviation of split frequencies: 0.033271
55500 -- [-358.343] (-357.976) (-359.218) (-357.580) * (-356.452) [-358.973] (-357.092) (-357.109) -- 0:01:08
56000 -- (-358.489) [-357.827] (-357.319) (-356.908) * (-357.810) [-358.323] (-356.800) (-357.164) -- 0:01:07
56500 -- (-357.957) (-359.134) (-357.762) [-356.774] * (-357.065) (-361.509) (-359.607) [-358.386] -- 0:01:06
57000 -- [-357.301] (-357.333) (-357.816) (-358.011) * (-358.422) (-359.551) (-360.716) [-358.730] -- 0:01:06
57500 -- [-360.863] (-359.608) (-358.880) (-360.458) * (-360.952) (-362.083) [-358.373] (-356.782) -- 0:01:05
58000 -- (-358.155) [-360.429] (-363.513) (-359.890) * (-361.233) (-357.128) [-357.770] (-358.143) -- 0:01:04
58500 -- (-361.868) (-359.346) [-359.677] (-357.601) * (-363.113) (-359.458) (-358.753) [-357.779] -- 0:01:04
59000 -- (-358.670) (-358.920) [-360.160] (-358.675) * (-361.725) (-358.231) [-358.175] (-357.287) -- 0:01:03
59500 -- (-361.551) (-357.528) [-357.791] (-357.668) * [-357.443] (-359.826) (-363.226) (-361.004) -- 0:01:03
60000 -- (-360.680) [-357.265] (-363.319) (-356.633) * (-358.093) (-361.753) [-358.667] (-358.951) -- 0:01:02
Average standard deviation of split frequencies: 0.031452
60500 -- (-360.375) (-357.249) (-359.860) [-356.541] * (-362.511) (-360.238) (-356.970) [-357.887] -- 0:01:02
61000 -- (-359.112) (-357.543) (-361.898) [-358.094] * (-363.337) [-357.364] (-359.141) (-358.534) -- 0:01:01
61500 -- [-358.126] (-361.762) (-361.560) (-357.908) * (-360.602) (-367.768) (-359.288) [-358.155] -- 0:01:01
62000 -- [-363.261] (-360.551) (-359.241) (-361.483) * (-363.883) (-358.927) (-358.614) [-357.928] -- 0:01:00
62500 -- (-358.664) [-357.248] (-356.931) (-361.141) * (-359.616) (-358.780) [-360.792] (-358.435) -- 0:01:15
63000 -- (-357.662) [-359.230] (-360.161) (-359.448) * [-358.642] (-359.277) (-356.791) (-360.739) -- 0:01:14
63500 -- (-357.281) (-358.929) [-360.113] (-357.638) * [-358.590] (-358.731) (-358.121) (-362.694) -- 0:01:13
64000 -- (-358.762) (-358.513) (-357.114) [-357.517] * (-356.973) (-360.345) [-360.623] (-358.236) -- 0:01:13
64500 -- (-359.598) [-357.813] (-357.794) (-360.582) * [-357.790] (-358.949) (-358.461) (-357.329) -- 0:01:12
65000 -- (-358.471) (-359.836) (-357.081) [-356.989] * (-358.548) (-357.491) (-359.302) [-356.893] -- 0:01:11
Average standard deviation of split frequencies: 0.027890
65500 -- (-358.838) (-356.799) (-358.850) [-357.086] * (-357.428) [-360.188] (-362.817) (-358.430) -- 0:01:11
66000 -- (-361.012) (-361.239) [-361.870] (-360.368) * (-358.746) (-361.222) (-359.894) [-360.535] -- 0:01:10
66500 -- (-358.384) (-358.647) (-359.004) [-358.219] * (-358.460) [-361.390] (-361.603) (-357.795) -- 0:01:10
67000 -- [-357.681] (-357.821) (-357.360) (-360.904) * (-358.204) [-360.391] (-361.878) (-359.366) -- 0:01:09
67500 -- [-356.442] (-359.852) (-358.945) (-358.600) * [-358.653] (-359.439) (-358.594) (-359.980) -- 0:01:09
68000 -- [-357.859] (-357.276) (-362.185) (-358.533) * (-358.885) (-360.565) (-357.737) [-356.403] -- 0:01:08
68500 -- [-358.905] (-358.554) (-362.388) (-358.824) * [-360.853] (-359.689) (-358.221) (-359.597) -- 0:01:07
69000 -- (-359.404) [-359.127] (-360.355) (-359.130) * (-360.955) (-359.923) (-358.205) [-359.638] -- 0:01:07
69500 -- (-357.323) [-358.470] (-359.663) (-359.310) * [-357.669] (-360.178) (-357.053) (-359.177) -- 0:01:06
70000 -- (-358.738) [-357.632] (-362.666) (-359.680) * (-357.086) (-357.214) (-356.529) [-357.813] -- 0:01:06
Average standard deviation of split frequencies: 0.028351
70500 -- [-358.257] (-360.445) (-356.866) (-363.443) * [-357.827] (-357.338) (-357.145) (-357.520) -- 0:01:05
71000 -- (-367.383) (-361.673) (-358.446) [-359.189] * (-361.585) (-356.834) [-357.609] (-357.985) -- 0:01:05
71500 -- (-360.259) [-362.477] (-357.729) (-366.261) * [-359.656] (-357.581) (-363.224) (-359.687) -- 0:01:04
72000 -- (-363.115) [-362.037] (-357.612) (-361.292) * (-361.408) [-360.587] (-363.294) (-357.583) -- 0:01:04
72500 -- (-361.013) [-356.760] (-357.400) (-358.770) * (-364.018) (-360.151) [-357.517] (-356.997) -- 0:01:03
73000 -- [-358.001] (-362.972) (-360.204) (-361.984) * (-357.667) [-359.022] (-356.842) (-360.622) -- 0:01:03
73500 -- [-357.173] (-360.391) (-356.856) (-357.417) * (-359.855) [-357.014] (-359.338) (-363.768) -- 0:01:03
74000 -- (-359.454) (-358.750) [-357.308] (-356.738) * (-365.185) (-359.638) [-357.769] (-357.890) -- 0:01:02
74500 -- (-360.726) [-358.526] (-366.692) (-357.097) * (-356.743) (-357.994) (-359.724) [-360.979] -- 0:01:02
75000 -- (-358.713) [-358.360] (-358.293) (-356.786) * (-356.968) [-358.281] (-359.011) (-360.713) -- 0:01:01
Average standard deviation of split frequencies: 0.025121
75500 -- (-364.541) [-359.892] (-357.219) (-358.080) * (-358.699) (-358.015) (-358.659) [-357.214] -- 0:01:13
76000 -- [-356.630] (-358.005) (-359.324) (-357.928) * (-358.342) (-360.005) (-358.956) [-357.042] -- 0:01:12
76500 -- (-356.537) (-362.555) [-358.041] (-357.062) * [-359.075] (-361.231) (-359.688) (-360.606) -- 0:01:12
77000 -- (-358.675) [-358.751] (-361.487) (-358.670) * [-358.686] (-356.304) (-357.210) (-357.596) -- 0:01:11
77500 -- [-356.895] (-358.040) (-358.669) (-362.345) * (-359.597) (-362.077) [-357.268] (-357.889) -- 0:01:11
78000 -- (-357.064) (-359.779) [-358.521] (-359.649) * (-358.012) (-361.659) [-357.090] (-360.877) -- 0:01:10
78500 -- (-358.824) (-357.730) (-356.965) [-357.014] * [-356.409] (-359.405) (-356.751) (-358.322) -- 0:01:10
79000 -- (-358.039) (-360.664) (-362.291) [-357.951] * [-357.866] (-357.909) (-356.702) (-358.519) -- 0:01:09
79500 -- (-358.005) (-360.901) [-356.504] (-357.634) * (-359.371) [-358.591] (-359.543) (-357.975) -- 0:01:09
80000 -- (-357.828) (-360.155) (-363.007) [-357.260] * [-359.206] (-357.942) (-357.068) (-357.237) -- 0:01:09
Average standard deviation of split frequencies: 0.027921
80500 -- (-358.966) (-358.704) [-357.318] (-361.739) * [-359.248] (-358.929) (-356.844) (-360.360) -- 0:01:08
81000 -- (-358.338) (-357.800) [-356.987] (-359.825) * (-357.217) (-357.863) (-357.214) [-359.994] -- 0:01:08
81500 -- (-361.241) (-358.544) (-357.350) [-358.261] * (-358.419) (-361.420) [-357.887] (-358.159) -- 0:01:07
82000 -- [-359.284] (-359.481) (-358.441) (-360.743) * (-363.515) (-359.224) [-358.990] (-357.619) -- 0:01:07
82500 -- [-358.985] (-356.910) (-359.310) (-357.963) * (-358.513) (-358.873) [-357.719] (-357.504) -- 0:01:06
83000 -- (-360.019) (-359.315) [-359.863] (-357.096) * (-359.001) [-358.423] (-364.881) (-358.887) -- 0:01:06
83500 -- (-359.773) (-358.154) (-357.433) [-357.587] * (-358.449) (-358.270) [-358.673] (-359.394) -- 0:01:05
84000 -- [-361.315] (-361.597) (-357.065) (-356.448) * [-359.019] (-360.496) (-359.123) (-358.362) -- 0:01:05
84500 -- (-358.345) (-359.940) (-357.107) [-356.695] * (-363.422) (-359.203) [-362.183] (-358.711) -- 0:01:05
85000 -- (-357.708) [-358.260] (-357.760) (-357.064) * [-360.938] (-361.137) (-359.320) (-358.673) -- 0:01:04
Average standard deviation of split frequencies: 0.029138
85500 -- (-357.407) [-358.522] (-357.378) (-357.763) * (-358.932) [-358.278] (-360.074) (-358.949) -- 0:01:04
86000 -- [-362.998] (-360.460) (-360.208) (-360.758) * (-358.677) (-357.723) [-358.888] (-359.928) -- 0:01:03
86500 -- (-357.783) (-360.030) (-358.893) [-357.861] * (-358.765) [-359.095] (-359.187) (-357.204) -- 0:01:03
87000 -- (-357.414) (-361.257) [-361.038] (-360.665) * [-360.760] (-357.892) (-358.499) (-357.174) -- 0:01:02
87500 -- [-359.755] (-357.858) (-358.531) (-356.860) * (-358.834) (-358.281) [-357.071] (-360.922) -- 0:01:02
88000 -- (-359.095) (-360.302) [-360.213] (-358.903) * (-358.160) (-360.469) (-358.188) [-359.077] -- 0:01:12
88500 -- (-357.724) (-356.557) [-361.062] (-358.735) * [-358.939] (-359.334) (-356.924) (-363.907) -- 0:01:12
89000 -- (-356.544) (-360.956) (-358.513) [-359.355] * (-362.981) [-360.591] (-359.330) (-360.134) -- 0:01:11
89500 -- (-357.509) (-357.566) (-363.380) [-357.696] * [-358.744] (-361.923) (-357.535) (-364.336) -- 0:01:11
90000 -- (-356.590) (-360.598) (-362.104) [-358.304] * (-358.154) (-363.988) [-358.119] (-360.093) -- 0:01:10
Average standard deviation of split frequencies: 0.028307
90500 -- (-359.731) [-358.066] (-358.980) (-356.563) * (-357.058) (-362.680) [-360.023] (-358.797) -- 0:01:10
91000 -- (-356.828) (-357.076) (-358.242) [-356.786] * (-359.026) (-361.200) (-357.597) [-357.852] -- 0:01:09
91500 -- (-356.878) (-356.941) [-356.880] (-360.272) * (-357.904) (-359.769) (-359.067) [-357.925] -- 0:01:09
92000 -- [-358.517] (-358.046) (-358.496) (-359.688) * (-357.883) [-359.009] (-356.969) (-358.396) -- 0:01:09
92500 -- (-358.413) (-363.825) (-365.876) [-358.354] * (-357.500) (-358.962) (-359.851) [-358.065] -- 0:01:08
93000 -- (-359.393) (-357.347) (-362.482) [-357.697] * (-358.456) (-361.326) [-360.978] (-357.949) -- 0:01:08
93500 -- [-357.344] (-356.984) (-357.497) (-359.081) * (-359.554) (-357.671) (-359.047) [-357.092] -- 0:01:07
94000 -- (-356.586) [-359.411] (-358.554) (-358.497) * (-358.929) (-358.705) [-357.473] (-367.871) -- 0:01:07
94500 -- (-356.983) (-358.421) [-359.467] (-360.372) * (-361.959) (-360.353) [-359.091] (-358.112) -- 0:01:07
95000 -- (-362.077) (-358.666) (-357.445) [-361.171] * (-356.855) (-357.972) [-358.774] (-357.614) -- 0:01:06
Average standard deviation of split frequencies: 0.025098
95500 -- (-360.268) (-356.831) (-357.422) [-361.436] * (-356.317) (-360.126) (-360.917) [-358.299] -- 0:01:06
96000 -- (-358.088) (-357.357) (-358.095) [-358.516] * [-356.765] (-358.441) (-358.032) (-360.142) -- 0:01:05
96500 -- (-358.174) [-358.786] (-359.186) (-357.282) * (-358.535) [-357.003] (-360.468) (-359.596) -- 0:01:05
97000 -- (-356.308) (-357.650) (-357.543) [-361.441] * (-356.569) [-357.063] (-360.155) (-358.444) -- 0:01:05
97500 -- (-358.927) (-359.245) (-358.295) [-358.147] * [-356.914] (-356.956) (-357.951) (-357.439) -- 0:01:04
98000 -- [-358.167] (-358.894) (-357.464) (-357.374) * (-356.477) (-357.220) [-358.992] (-358.005) -- 0:01:04
98500 -- (-359.570) [-357.638] (-358.660) (-356.817) * (-358.944) [-357.054] (-357.434) (-356.724) -- 0:01:04
99000 -- [-358.980] (-359.772) (-358.565) (-361.488) * (-357.064) (-359.229) (-357.828) [-356.384] -- 0:01:03
99500 -- (-359.102) (-362.820) (-362.651) [-361.574] * (-357.487) (-358.365) (-359.411) [-358.005] -- 0:01:03
100000 -- (-358.162) (-359.979) (-359.524) [-357.873] * (-360.836) (-358.718) [-357.936] (-361.547) -- 0:01:02
Average standard deviation of split frequencies: 0.027577
100500 -- [-358.497] (-357.719) (-357.597) (-360.644) * [-357.295] (-360.175) (-360.154) (-359.067) -- 0:01:02
101000 -- (-359.203) [-357.949] (-357.751) (-359.565) * (-361.602) (-362.000) (-359.794) [-359.327] -- 0:01:11
101500 -- (-358.028) (-357.865) [-358.607] (-359.447) * (-359.299) [-358.350] (-361.822) (-358.531) -- 0:01:10
102000 -- (-357.268) (-358.607) [-357.437] (-358.428) * (-359.241) (-359.964) [-359.469] (-359.491) -- 0:01:10
102500 -- (-358.062) [-360.881] (-358.322) (-362.094) * (-359.000) [-357.358] (-359.442) (-361.577) -- 0:01:10
103000 -- (-357.188) (-356.971) (-360.807) [-359.909] * (-357.287) (-360.100) [-357.867] (-359.221) -- 0:01:09
103500 -- (-359.083) (-358.254) [-357.355] (-361.651) * (-358.527) [-357.817] (-360.109) (-358.962) -- 0:01:09
104000 -- [-356.968] (-358.651) (-357.966) (-360.927) * (-359.627) (-361.605) [-357.910] (-360.785) -- 0:01:08
104500 -- (-358.246) [-358.728] (-356.856) (-360.424) * (-358.018) [-358.183] (-357.597) (-362.111) -- 0:01:08
105000 -- [-357.196] (-357.661) (-356.868) (-357.245) * (-360.656) [-358.617] (-360.072) (-357.627) -- 0:01:08
Average standard deviation of split frequencies: 0.024460
105500 -- (-359.224) (-359.463) (-357.215) [-358.662] * (-358.235) (-359.964) (-357.520) [-357.000] -- 0:01:07
106000 -- [-357.547] (-361.277) (-358.998) (-358.692) * [-356.456] (-359.103) (-360.348) (-358.730) -- 0:01:07
106500 -- [-358.162] (-358.516) (-358.987) (-356.372) * [-358.223] (-357.460) (-360.954) (-357.655) -- 0:01:07
107000 -- (-360.567) (-358.122) [-358.101] (-360.522) * (-357.499) (-358.436) [-361.093] (-358.521) -- 0:01:06
107500 -- (-363.938) (-356.780) [-358.883] (-358.003) * (-356.331) [-359.925] (-361.862) (-359.328) -- 0:01:06
108000 -- (-356.789) [-357.647] (-358.846) (-360.706) * (-358.456) (-361.588) [-362.239] (-361.576) -- 0:01:06
108500 -- (-357.269) (-358.211) (-358.018) [-360.847] * (-358.412) (-358.682) (-362.165) [-358.971] -- 0:01:05
109000 -- (-358.373) [-357.666] (-358.592) (-360.610) * (-361.624) [-356.952] (-360.331) (-358.105) -- 0:01:05
109500 -- [-357.151] (-358.840) (-362.178) (-357.070) * (-359.957) (-364.021) [-356.376] (-357.971) -- 0:01:05
110000 -- (-361.561) (-359.647) (-359.749) [-358.875] * (-358.513) (-359.403) [-357.569] (-359.010) -- 0:01:04
Average standard deviation of split frequencies: 0.023192
110500 -- (-358.910) (-360.977) [-356.970] (-362.833) * (-359.534) [-357.484] (-358.239) (-358.190) -- 0:01:04
111000 -- (-360.216) [-360.010] (-357.943) (-359.216) * [-356.910] (-362.254) (-357.617) (-357.964) -- 0:01:04
111500 -- (-359.692) (-357.469) (-358.744) [-356.941] * [-358.549] (-356.654) (-360.932) (-360.545) -- 0:01:03
112000 -- [-357.757] (-362.487) (-356.961) (-356.787) * (-358.371) [-357.587] (-361.529) (-358.642) -- 0:01:03
112500 -- (-361.862) (-356.996) (-357.022) [-358.427] * (-359.131) (-360.042) [-356.628] (-359.826) -- 0:01:03
113000 -- [-358.410] (-357.089) (-358.365) (-360.119) * (-358.319) (-361.435) (-356.362) [-359.909] -- 0:01:02
113500 -- (-366.014) (-358.089) (-356.292) [-361.244] * (-359.896) (-360.116) [-364.181] (-362.660) -- 0:01:10
114000 -- (-361.426) [-357.186] (-357.319) (-358.219) * (-357.648) [-357.628] (-360.795) (-365.686) -- 0:01:09
114500 -- [-361.989] (-360.267) (-357.411) (-356.746) * (-358.323) [-356.811] (-358.543) (-359.992) -- 0:01:09
115000 -- (-359.340) (-360.321) [-361.173] (-358.609) * (-360.545) (-359.730) [-357.039] (-359.406) -- 0:01:09
Average standard deviation of split frequencies: 0.023254
115500 -- (-357.653) (-359.574) [-359.162] (-358.698) * (-357.991) (-357.698) (-357.792) [-358.908] -- 0:01:08
116000 -- [-357.407] (-363.163) (-360.947) (-357.733) * [-357.484] (-358.968) (-360.996) (-358.147) -- 0:01:08
116500 -- [-358.816] (-359.814) (-361.271) (-360.323) * [-357.558] (-358.412) (-363.812) (-362.190) -- 0:01:08
117000 -- [-357.200] (-359.916) (-359.577) (-359.819) * (-357.550) (-357.410) (-361.367) [-360.046] -- 0:01:07
117500 -- [-357.177] (-357.678) (-357.211) (-358.713) * [-358.206] (-359.255) (-362.026) (-356.349) -- 0:01:07
118000 -- (-358.518) (-358.150) [-357.765] (-358.679) * (-358.305) [-358.345] (-359.603) (-359.825) -- 0:01:07
118500 -- (-362.634) (-357.491) [-359.363] (-358.947) * (-359.048) [-357.488] (-358.362) (-356.794) -- 0:01:06
119000 -- [-362.111] (-358.278) (-358.248) (-356.901) * (-357.743) (-361.884) (-358.578) [-358.496] -- 0:01:06
119500 -- (-358.004) (-357.383) [-357.431] (-358.115) * (-359.044) (-360.057) (-359.824) [-358.259] -- 0:01:06
120000 -- [-358.662] (-356.898) (-361.056) (-359.838) * (-359.543) [-357.977] (-357.022) (-357.571) -- 0:01:06
Average standard deviation of split frequencies: 0.021921
120500 -- (-358.246) [-356.984] (-360.219) (-362.221) * [-356.910] (-358.543) (-359.842) (-359.257) -- 0:01:05
121000 -- (-358.222) (-360.447) [-360.866] (-363.777) * (-356.391) [-357.812] (-358.070) (-358.465) -- 0:01:05
121500 -- [-356.933] (-358.594) (-357.038) (-362.514) * (-358.340) (-358.080) (-359.965) [-361.828] -- 0:01:05
122000 -- (-358.396) (-359.263) [-360.001] (-359.849) * (-361.780) (-356.927) [-358.153] (-358.516) -- 0:01:04
122500 -- (-357.614) [-361.283] (-357.721) (-358.886) * (-360.070) (-358.678) (-361.925) [-363.419] -- 0:01:04
123000 -- (-359.206) (-361.174) (-363.114) [-356.721] * (-360.171) [-358.222] (-356.636) (-361.969) -- 0:01:04
123500 -- (-359.167) [-359.791] (-359.909) (-358.105) * (-358.930) [-358.673] (-356.673) (-361.506) -- 0:01:03
124000 -- (-358.137) (-360.279) [-357.858] (-360.827) * (-357.100) (-357.226) (-362.965) [-357.433] -- 0:01:03
124500 -- (-358.164) [-356.953] (-362.851) (-357.145) * (-357.032) (-358.819) (-359.616) [-358.738] -- 0:01:03
125000 -- [-359.447] (-358.385) (-360.303) (-357.938) * (-357.270) [-361.435] (-360.985) (-360.795) -- 0:01:03
Average standard deviation of split frequencies: 0.019494
125500 -- (-359.909) (-356.985) [-360.148] (-359.568) * (-358.798) (-358.814) [-361.148] (-363.753) -- 0:01:02
126000 -- (-361.129) [-358.486] (-357.380) (-357.734) * (-357.945) (-360.088) (-362.483) [-360.705] -- 0:01:09
126500 -- [-360.212] (-358.298) (-358.269) (-360.033) * (-357.942) [-361.783] (-358.765) (-362.298) -- 0:01:09
127000 -- (-359.587) (-358.569) [-357.104] (-358.422) * (-357.660) (-359.484) (-362.340) [-361.220] -- 0:01:08
127500 -- (-360.419) (-359.252) (-356.825) [-359.135] * [-357.599] (-359.137) (-360.941) (-357.128) -- 0:01:08
128000 -- [-359.911] (-365.138) (-358.633) (-360.291) * (-357.122) (-363.222) (-359.763) [-359.903] -- 0:01:08
128500 -- (-358.955) (-358.801) (-359.155) [-359.866] * [-357.885] (-359.680) (-358.833) (-358.001) -- 0:01:07
129000 -- [-358.075] (-358.382) (-361.591) (-357.283) * [-360.500] (-358.467) (-359.395) (-361.259) -- 0:01:07
129500 -- (-357.894) [-357.226] (-362.327) (-358.218) * (-360.535) (-357.515) (-357.061) [-358.204] -- 0:01:07
130000 -- (-358.128) (-362.616) (-359.208) [-358.633] * (-359.459) (-358.670) (-359.178) [-357.248] -- 0:01:06
Average standard deviation of split frequencies: 0.020697
130500 -- (-357.855) (-358.418) [-357.892] (-358.967) * (-357.924) [-358.204] (-359.758) (-358.792) -- 0:01:06
131000 -- [-358.232] (-360.450) (-357.696) (-359.288) * (-358.695) [-359.281] (-356.866) (-361.284) -- 0:01:06
131500 -- (-358.978) (-357.438) [-357.998] (-357.609) * (-357.813) [-360.455] (-357.798) (-358.287) -- 0:01:06
132000 -- [-357.990] (-357.557) (-360.815) (-362.668) * (-362.345) (-359.120) (-357.066) [-359.327] -- 0:01:05
132500 -- (-357.312) (-356.680) [-359.010] (-357.039) * [-360.576] (-357.908) (-356.683) (-357.477) -- 0:01:05
133000 -- (-359.125) (-358.869) [-358.386] (-358.594) * (-357.271) [-360.283] (-358.981) (-357.283) -- 0:01:05
133500 -- (-361.174) (-358.587) [-357.840] (-361.536) * (-357.753) (-358.909) [-359.778] (-359.289) -- 0:01:04
134000 -- (-369.804) [-356.867] (-357.837) (-356.980) * (-357.853) (-357.411) [-358.217] (-356.684) -- 0:01:04
134500 -- (-359.376) [-357.736] (-357.162) (-358.927) * (-358.721) (-358.555) [-358.016] (-358.774) -- 0:01:04
135000 -- (-361.670) (-360.134) [-356.404] (-361.080) * (-356.770) (-357.076) [-357.869] (-360.326) -- 0:01:04
Average standard deviation of split frequencies: 0.021182
135500 -- [-357.825] (-358.561) (-358.032) (-360.497) * (-358.667) [-359.657] (-358.530) (-356.685) -- 0:01:03
136000 -- (-360.266) [-361.487] (-357.709) (-358.289) * (-361.023) (-358.768) (-359.895) [-360.293] -- 0:01:03
136500 -- (-359.565) (-358.805) (-356.495) [-359.063] * [-360.561] (-359.192) (-358.817) (-360.235) -- 0:01:03
137000 -- (-358.521) (-359.448) [-358.126] (-356.840) * (-357.789) (-362.278) [-359.351] (-356.905) -- 0:01:02
137500 -- (-357.562) (-360.760) [-357.804] (-356.941) * (-358.038) (-357.026) [-359.079] (-358.609) -- 0:01:02
138000 -- (-358.029) [-361.534] (-356.599) (-357.608) * (-358.009) (-358.061) (-356.446) [-357.369] -- 0:01:02
138500 -- (-361.435) (-357.826) (-359.180) [-357.330] * (-357.532) (-357.847) [-357.815] (-362.954) -- 0:01:08
139000 -- (-360.774) [-362.297] (-366.546) (-358.579) * (-358.691) (-358.121) [-358.478] (-358.347) -- 0:01:08
139500 -- (-360.189) (-358.443) [-357.361] (-356.854) * (-357.365) (-360.203) [-357.925] (-357.806) -- 0:01:07
140000 -- (-359.887) [-356.351] (-359.738) (-359.651) * [-357.657] (-358.069) (-357.692) (-358.161) -- 0:01:07
Average standard deviation of split frequencies: 0.023086
140500 -- (-358.384) (-356.900) (-357.447) [-356.480] * [-359.038] (-358.126) (-357.479) (-357.285) -- 0:01:07
141000 -- (-360.187) [-357.149] (-357.154) (-356.776) * (-358.021) (-357.282) [-357.099] (-357.046) -- 0:01:07
141500 -- [-357.961] (-358.840) (-359.281) (-358.420) * (-356.896) [-357.282] (-358.550) (-358.117) -- 0:01:06
142000 -- (-357.483) (-359.564) [-357.245] (-357.408) * (-359.568) (-358.711) [-357.759] (-358.706) -- 0:01:06
142500 -- [-356.583] (-356.675) (-358.198) (-358.797) * (-360.516) [-357.452] (-358.898) (-356.902) -- 0:01:06
143000 -- [-358.016] (-357.464) (-360.950) (-360.392) * (-360.252) (-359.532) [-359.117] (-359.262) -- 0:01:05
143500 -- (-358.462) (-357.620) [-359.347] (-360.978) * (-359.550) [-359.780] (-357.422) (-358.035) -- 0:01:05
144000 -- (-362.802) [-358.992] (-359.631) (-362.813) * (-358.060) [-359.289] (-358.013) (-358.166) -- 0:01:05
144500 -- [-357.137] (-361.181) (-358.427) (-358.914) * (-359.081) (-356.794) [-357.003] (-357.378) -- 0:01:05
145000 -- [-356.631] (-359.297) (-360.630) (-357.405) * (-359.241) (-358.614) (-357.704) [-356.657] -- 0:01:04
Average standard deviation of split frequencies: 0.022092
145500 -- (-361.770) (-357.879) (-360.996) [-360.487] * (-359.399) (-361.068) [-359.079] (-357.395) -- 0:01:04
146000 -- [-362.528] (-357.600) (-359.940) (-359.876) * [-358.159] (-360.564) (-363.336) (-357.300) -- 0:01:04
146500 -- (-363.438) [-359.109] (-359.655) (-361.047) * (-357.256) (-362.937) (-361.862) [-358.769] -- 0:01:04
147000 -- (-359.520) (-357.186) [-359.507] (-361.498) * (-356.631) (-359.014) (-357.323) [-359.948] -- 0:01:03
147500 -- [-360.277] (-362.642) (-359.606) (-358.095) * (-360.359) (-361.113) (-359.967) [-357.622] -- 0:01:03
148000 -- (-362.860) [-357.536] (-359.133) (-359.039) * (-357.378) (-360.097) [-359.529] (-358.168) -- 0:01:03
148500 -- (-358.217) (-357.302) [-359.077] (-359.441) * (-358.481) [-359.639] (-358.023) (-357.187) -- 0:01:03
149000 -- (-357.267) [-358.444] (-362.329) (-357.613) * (-358.417) [-360.119] (-360.503) (-358.061) -- 0:01:02
149500 -- (-357.037) (-361.028) (-359.481) [-356.824] * (-360.323) (-357.368) (-358.533) [-358.470] -- 0:01:02
150000 -- (-361.523) (-363.578) (-357.908) [-359.211] * (-361.839) (-357.813) (-361.966) [-358.535] -- 0:01:02
Average standard deviation of split frequencies: 0.022771
150500 -- (-357.756) [-360.738] (-358.290) (-356.769) * (-362.626) [-357.914] (-361.224) (-359.041) -- 0:01:02
151000 -- (-359.808) (-359.749) (-360.939) [-359.215] * (-359.903) [-358.159] (-359.305) (-362.204) -- 0:01:01
151500 -- (-361.085) (-362.716) [-357.474] (-359.999) * (-359.835) (-360.100) [-359.924] (-359.850) -- 0:01:01
152000 -- (-357.930) (-363.413) [-359.888] (-358.515) * [-359.666] (-357.871) (-359.635) (-357.795) -- 0:01:06
152500 -- (-358.215) [-357.635] (-358.736) (-357.987) * (-357.532) [-356.830] (-358.066) (-361.229) -- 0:01:06
153000 -- (-360.603) (-360.415) [-357.505] (-359.446) * (-358.852) [-357.604] (-359.178) (-359.032) -- 0:01:06
153500 -- (-359.251) (-359.479) (-359.116) [-356.540] * (-361.561) (-357.867) [-357.565] (-358.995) -- 0:01:06
154000 -- (-357.844) [-358.463] (-358.938) (-358.340) * [-358.765] (-365.235) (-359.072) (-360.671) -- 0:01:05
154500 -- (-358.253) [-357.730] (-360.527) (-357.380) * [-357.537] (-359.480) (-359.071) (-357.749) -- 0:01:05
155000 -- (-358.145) [-359.169] (-361.005) (-359.192) * (-365.463) [-361.462] (-359.147) (-358.467) -- 0:01:05
Average standard deviation of split frequencies: 0.022832
155500 -- (-359.938) (-358.909) [-361.515] (-360.239) * (-359.967) [-357.809] (-362.907) (-357.224) -- 0:01:05
156000 -- (-358.695) (-361.327) [-357.276] (-357.771) * (-358.235) (-357.388) (-363.585) [-357.441] -- 0:01:04
156500 -- (-358.999) (-358.063) (-360.246) [-360.589] * [-356.595] (-359.511) (-361.111) (-359.048) -- 0:01:04
157000 -- (-358.162) (-357.316) (-359.151) [-358.402] * [-356.786] (-357.228) (-360.428) (-357.780) -- 0:01:04
157500 -- (-359.247) (-360.257) [-357.053] (-357.285) * [-359.696] (-358.239) (-358.948) (-357.275) -- 0:01:04
158000 -- (-358.927) [-357.116] (-357.079) (-360.278) * (-358.398) (-358.250) [-357.406] (-357.311) -- 0:01:03
158500 -- (-358.590) (-358.429) (-362.194) [-357.573] * (-360.096) (-357.806) [-357.177] (-357.273) -- 0:01:03
159000 -- (-357.971) (-360.073) (-359.269) [-360.714] * (-358.765) (-359.810) (-361.907) [-358.215] -- 0:01:03
159500 -- (-357.578) [-357.658] (-359.082) (-356.809) * (-358.486) (-359.130) (-359.787) [-357.201] -- 0:01:03
160000 -- (-357.878) (-358.833) [-358.457] (-363.113) * (-357.918) (-358.736) [-359.142] (-357.364) -- 0:01:02
Average standard deviation of split frequencies: 0.021679
160500 -- (-356.930) (-358.514) [-360.410] (-358.353) * (-361.540) [-357.585] (-358.687) (-358.320) -- 0:01:02
161000 -- [-358.108] (-361.778) (-363.491) (-364.106) * (-361.066) [-357.231] (-357.002) (-363.346) -- 0:01:02
161500 -- (-359.297) [-360.753] (-360.476) (-357.752) * (-361.316) (-359.489) (-358.301) [-361.617] -- 0:01:02
162000 -- (-358.539) (-360.214) [-359.104] (-357.795) * [-358.935] (-360.055) (-359.715) (-361.108) -- 0:01:02
162500 -- (-360.150) [-359.043] (-356.624) (-356.676) * (-360.306) (-359.101) (-358.707) [-362.216] -- 0:01:01
163000 -- [-357.252] (-359.819) (-356.729) (-361.178) * (-357.513) [-359.929] (-361.908) (-360.051) -- 0:01:01
163500 -- (-359.949) (-363.391) (-360.341) [-358.863] * (-358.651) [-358.211] (-356.536) (-360.926) -- 0:01:01
164000 -- [-358.127] (-360.035) (-359.915) (-358.025) * (-358.411) [-357.880] (-359.935) (-360.131) -- 0:01:01
164500 -- [-357.718] (-358.228) (-358.542) (-357.388) * [-358.820] (-359.266) (-359.444) (-358.834) -- 0:01:00
165000 -- [-356.566] (-358.193) (-358.224) (-358.050) * (-360.592) (-363.276) [-358.770] (-361.160) -- 0:01:00
Average standard deviation of split frequencies: 0.022087
165500 -- (-358.182) [-361.517] (-359.087) (-360.824) * (-357.026) (-362.987) [-359.197] (-363.315) -- 0:01:00
166000 -- [-360.423] (-356.678) (-361.886) (-359.464) * (-356.578) (-358.686) (-358.773) [-359.994] -- 0:01:05
166500 -- (-360.729) (-358.452) (-364.823) [-356.904] * (-357.638) (-358.168) [-357.156] (-358.939) -- 0:01:05
167000 -- (-357.565) [-358.649] (-360.463) (-357.679) * (-356.610) (-357.222) [-358.053] (-360.007) -- 0:01:04
167500 -- [-359.098] (-359.434) (-358.333) (-361.242) * [-356.817] (-356.948) (-363.813) (-356.995) -- 0:01:04
168000 -- (-360.728) (-359.853) (-357.906) [-360.617] * (-359.280) [-358.021] (-363.073) (-357.698) -- 0:01:04
168500 -- [-359.443] (-357.925) (-357.692) (-363.354) * [-358.966] (-357.904) (-360.780) (-360.983) -- 0:01:04
169000 -- (-358.783) (-359.471) (-359.036) [-359.829] * [-357.646] (-360.265) (-360.740) (-360.376) -- 0:01:03
169500 -- (-358.177) (-357.013) (-359.087) [-357.991] * [-357.050] (-359.923) (-357.975) (-359.424) -- 0:01:03
170000 -- (-359.796) [-357.265] (-357.313) (-356.857) * (-357.591) (-357.443) (-356.612) [-356.424] -- 0:01:03
Average standard deviation of split frequencies: 0.021772
170500 -- (-358.788) (-358.171) (-358.520) [-358.065] * (-358.190) (-361.376) [-358.020] (-359.716) -- 0:01:03
171000 -- (-357.629) [-358.711] (-358.687) (-358.742) * (-360.553) (-362.158) (-357.755) [-361.156] -- 0:01:03
171500 -- [-357.357] (-356.796) (-359.594) (-358.018) * (-359.572) [-358.426] (-357.009) (-358.718) -- 0:01:02
172000 -- (-361.692) (-360.537) [-359.319] (-357.599) * (-360.944) [-356.850] (-358.092) (-357.170) -- 0:01:02
172500 -- (-357.633) (-357.823) [-357.916] (-358.439) * (-358.184) [-356.549] (-357.578) (-365.519) -- 0:01:02
173000 -- (-360.531) (-357.750) [-357.438] (-361.757) * (-358.323) (-358.373) (-358.113) [-361.075] -- 0:01:02
173500 -- [-358.704] (-362.442) (-359.710) (-360.437) * (-358.166) [-357.324] (-357.072) (-357.986) -- 0:01:01
174000 -- (-362.413) (-364.868) (-358.169) [-356.519] * (-357.908) (-358.520) [-357.375] (-359.318) -- 0:01:01
174500 -- (-358.019) (-359.065) (-359.583) [-358.547] * (-359.277) (-357.534) (-359.808) [-358.090] -- 0:01:01
175000 -- (-358.427) (-358.618) (-358.249) [-358.188] * [-358.613] (-359.547) (-357.645) (-357.820) -- 0:01:01
Average standard deviation of split frequencies: 0.018326
175500 -- (-357.228) [-358.778] (-357.629) (-358.001) * (-357.639) (-359.302) (-359.004) [-361.441] -- 0:01:01
176000 -- (-358.321) [-358.498] (-360.634) (-361.392) * (-358.873) (-356.491) [-357.398] (-359.334) -- 0:01:00
176500 -- (-359.006) (-357.251) [-360.422] (-360.616) * (-359.508) (-356.966) [-357.849] (-359.393) -- 0:01:00
177000 -- (-359.307) (-357.390) (-358.711) [-359.513] * (-360.035) (-357.583) [-357.057] (-358.263) -- 0:01:00
177500 -- (-360.497) (-359.246) [-358.730] (-361.569) * (-358.128) (-357.452) (-359.122) [-359.538] -- 0:01:00
178000 -- (-359.058) (-357.153) (-357.851) [-357.368] * [-358.183] (-357.264) (-358.466) (-361.398) -- 0:01:00
178500 -- (-358.999) (-362.374) [-357.031] (-360.331) * [-362.625] (-357.702) (-358.497) (-359.995) -- 0:00:59
179000 -- [-357.386] (-357.886) (-361.848) (-357.728) * (-358.305) (-357.942) (-357.232) [-357.964] -- 0:00:59
179500 -- (-360.961) [-359.615] (-366.998) (-357.759) * (-356.860) [-358.501] (-361.788) (-358.776) -- 0:00:59
180000 -- (-361.245) [-359.138] (-364.015) (-361.570) * (-358.815) (-358.194) [-360.423] (-361.968) -- 0:00:59
Average standard deviation of split frequencies: 0.016670
180500 -- (-359.386) (-358.550) (-358.834) [-357.577] * (-357.778) (-362.282) [-361.898] (-358.019) -- 0:00:59
181000 -- [-357.588] (-359.489) (-357.659) (-358.168) * (-358.442) [-358.994] (-360.539) (-357.162) -- 0:01:03
181500 -- [-358.660] (-358.231) (-357.743) (-360.437) * (-357.883) [-358.010] (-360.764) (-360.403) -- 0:01:03
182000 -- (-358.197) (-358.105) [-357.021] (-357.877) * (-357.195) [-357.981] (-361.572) (-357.932) -- 0:01:02
182500 -- (-358.798) (-359.165) (-358.711) [-359.312] * [-356.473] (-357.902) (-358.256) (-360.908) -- 0:01:02
183000 -- (-358.429) (-358.379) [-359.073] (-359.073) * (-359.881) [-361.908] (-363.593) (-361.402) -- 0:01:02
183500 -- (-358.135) (-359.125) (-361.487) [-359.978] * [-358.343] (-357.751) (-358.068) (-359.068) -- 0:01:02
184000 -- (-358.718) (-359.194) (-361.702) [-358.138] * (-358.980) (-357.322) (-359.789) [-357.705] -- 0:01:02
184500 -- [-360.450] (-360.201) (-358.569) (-358.956) * (-359.954) [-360.842] (-361.612) (-362.234) -- 0:01:01
185000 -- [-360.593] (-361.248) (-359.092) (-360.041) * (-356.979) [-358.132] (-363.453) (-367.220) -- 0:01:01
Average standard deviation of split frequencies: 0.016220
185500 -- (-357.201) [-359.896] (-359.383) (-358.408) * (-356.722) (-356.311) [-360.534] (-361.402) -- 0:01:01
186000 -- (-359.060) (-358.255) (-360.624) [-357.536] * [-358.923] (-356.510) (-361.379) (-357.235) -- 0:01:01
186500 -- (-356.968) [-361.717] (-365.852) (-357.528) * (-358.061) (-360.846) (-358.171) [-359.294] -- 0:01:01
187000 -- (-356.580) (-358.187) [-358.197] (-358.584) * (-359.268) [-358.049] (-360.788) (-361.443) -- 0:01:00
187500 -- [-360.033] (-356.721) (-357.920) (-361.568) * (-356.714) [-357.983] (-359.511) (-358.685) -- 0:01:00
188000 -- (-358.290) (-367.650) [-357.715] (-360.340) * (-358.128) (-360.523) [-359.612] (-358.879) -- 0:01:00
188500 -- (-360.010) (-363.433) (-357.276) [-357.503] * (-359.452) [-359.008] (-361.171) (-359.146) -- 0:01:00
189000 -- [-356.985] (-358.337) (-359.024) (-356.821) * [-359.044] (-357.123) (-356.964) (-361.420) -- 0:01:00
189500 -- (-357.020) [-357.400] (-359.544) (-357.706) * [-360.696] (-357.632) (-358.458) (-362.358) -- 0:00:59
190000 -- (-357.209) (-357.478) [-358.911] (-359.014) * (-362.746) [-357.357] (-361.522) (-363.028) -- 0:00:59
Average standard deviation of split frequencies: 0.015933
190500 -- (-358.932) (-358.809) (-359.437) [-358.974] * (-356.525) (-356.633) [-358.341] (-358.011) -- 0:00:59
191000 -- (-360.761) [-358.528] (-359.248) (-357.243) * [-357.594] (-357.554) (-358.572) (-358.550) -- 0:00:59
191500 -- (-363.610) [-360.819] (-360.172) (-360.355) * (-357.643) [-358.148] (-358.199) (-357.587) -- 0:00:59
192000 -- [-357.452] (-359.380) (-358.044) (-359.274) * (-363.437) [-357.772] (-357.032) (-358.499) -- 0:00:58
192500 -- (-360.418) (-360.456) [-357.963] (-361.198) * (-364.105) (-359.066) (-357.147) [-358.587] -- 0:00:58
193000 -- (-357.068) [-360.213] (-359.501) (-359.985) * (-359.302) (-358.941) [-357.311] (-357.455) -- 0:00:58
193500 -- (-356.964) (-362.546) (-357.072) [-357.134] * (-360.802) (-357.943) (-359.463) [-356.616] -- 0:00:58
194000 -- [-357.848] (-360.304) (-358.938) (-357.830) * (-362.121) (-357.689) (-359.140) [-357.201] -- 0:00:58
194500 -- (-356.622) (-357.437) (-361.290) [-356.892] * (-361.516) (-359.601) (-356.933) [-360.112] -- 0:00:57
195000 -- [-359.253] (-357.051) (-358.462) (-357.214) * (-359.547) (-358.064) (-357.732) [-357.781] -- 0:00:57
Average standard deviation of split frequencies: 0.015366
195500 -- [-357.131] (-358.383) (-359.497) (-360.650) * (-358.762) (-358.362) [-357.014] (-359.996) -- 0:01:01
196000 -- (-358.724) (-358.582) (-358.797) [-357.857] * [-357.645] (-358.270) (-357.895) (-358.865) -- 0:01:01
196500 -- [-359.034] (-356.984) (-358.566) (-360.333) * [-357.312] (-359.333) (-361.958) (-364.312) -- 0:01:01
197000 -- (-357.306) [-357.137] (-358.523) (-362.823) * (-360.290) (-359.570) (-360.852) [-358.679] -- 0:01:01
197500 -- (-361.698) [-359.126] (-360.804) (-358.000) * [-360.654] (-359.182) (-358.869) (-358.313) -- 0:01:00
198000 -- (-359.413) [-358.193] (-358.582) (-358.181) * (-357.942) (-357.370) [-357.821] (-358.897) -- 0:01:00
198500 -- (-359.136) [-357.304] (-361.002) (-360.200) * (-356.563) (-360.497) (-362.561) [-359.497] -- 0:01:00
199000 -- [-361.010] (-356.766) (-360.987) (-359.483) * (-356.562) (-356.916) [-357.559] (-361.819) -- 0:01:00
199500 -- (-359.699) (-358.424) [-360.516] (-357.733) * (-356.605) (-356.993) (-357.341) [-357.076] -- 0:01:00
200000 -- [-359.325] (-363.316) (-359.152) (-358.046) * [-357.917] (-359.892) (-358.973) (-356.552) -- 0:00:59
Average standard deviation of split frequencies: 0.014617
200500 -- (-360.454) (-363.750) (-361.515) [-357.792] * [-361.510] (-361.729) (-357.221) (-360.744) -- 0:00:59
201000 -- [-359.041] (-362.586) (-359.861) (-357.568) * (-362.790) [-359.080] (-358.575) (-360.431) -- 0:00:59
201500 -- (-360.319) [-357.425] (-362.002) (-362.965) * [-361.951] (-358.065) (-357.441) (-360.649) -- 0:00:59
202000 -- [-360.135] (-357.328) (-358.614) (-358.260) * [-359.172] (-361.723) (-359.608) (-360.958) -- 0:00:59
202500 -- (-357.228) (-366.418) (-359.233) [-361.762] * (-364.866) [-357.882] (-358.645) (-359.715) -- 0:00:59
203000 -- (-357.566) [-364.425] (-358.289) (-358.573) * (-360.543) (-359.120) [-359.130] (-358.129) -- 0:00:58
203500 -- [-356.417] (-360.981) (-367.174) (-362.525) * (-361.400) (-358.931) [-359.333] (-357.730) -- 0:00:58
204000 -- [-359.919] (-357.724) (-358.499) (-358.880) * (-358.618) [-358.264] (-359.151) (-357.351) -- 0:00:58
204500 -- (-357.964) [-357.944] (-363.090) (-360.398) * [-361.056] (-360.361) (-358.627) (-358.445) -- 0:00:58
205000 -- (-356.599) (-357.760) [-359.144] (-360.355) * (-357.509) (-358.348) (-359.913) [-358.940] -- 0:00:58
Average standard deviation of split frequencies: 0.014112
205500 -- (-359.565) (-359.857) (-357.773) [-357.458] * (-358.583) (-362.608) (-359.635) [-361.474] -- 0:00:57
206000 -- [-361.229] (-357.817) (-356.628) (-358.158) * [-356.821] (-361.793) (-357.382) (-360.736) -- 0:00:57
206500 -- (-364.250) [-356.850] (-356.725) (-357.381) * [-359.575] (-359.400) (-356.965) (-358.558) -- 0:00:57
207000 -- [-357.528] (-363.613) (-359.081) (-358.221) * (-357.552) (-358.380) [-356.956] (-357.880) -- 0:00:57
207500 -- [-358.165] (-356.971) (-361.178) (-358.863) * (-357.378) (-362.604) [-365.098] (-359.210) -- 0:00:57
208000 -- (-358.018) (-360.340) [-358.944] (-365.914) * (-361.204) (-358.924) (-357.496) [-360.515] -- 0:00:57
208500 -- (-356.404) [-360.443] (-358.954) (-359.531) * (-359.379) (-357.812) [-361.420] (-356.996) -- 0:01:00
209000 -- [-359.093] (-360.166) (-357.515) (-358.925) * [-359.227] (-357.432) (-359.619) (-358.339) -- 0:01:00
209500 -- (-357.321) (-356.919) (-359.281) [-360.560] * (-358.336) (-357.723) (-358.215) [-358.325] -- 0:01:00
210000 -- (-359.931) [-357.160] (-357.130) (-365.956) * [-358.684] (-357.223) (-358.043) (-361.528) -- 0:01:00
Average standard deviation of split frequencies: 0.014486
210500 -- (-357.935) [-361.861] (-357.120) (-359.960) * (-357.795) [-358.147] (-361.140) (-366.208) -- 0:01:00
211000 -- (-360.469) [-360.350] (-360.002) (-359.139) * (-356.938) [-360.519] (-358.041) (-357.307) -- 0:00:59
211500 -- [-362.741] (-359.717) (-361.104) (-359.374) * [-361.499] (-358.610) (-360.758) (-364.342) -- 0:00:59
212000 -- (-358.699) [-357.430] (-358.263) (-362.483) * (-363.167) (-362.642) (-357.770) [-357.479] -- 0:00:59
212500 -- [-357.888] (-358.729) (-357.533) (-358.332) * (-357.759) (-357.427) [-357.723] (-358.227) -- 0:00:59
213000 -- (-357.732) (-361.380) (-358.785) [-357.585] * (-357.987) (-357.611) [-357.908] (-356.674) -- 0:00:59
213500 -- [-358.390] (-359.452) (-357.239) (-358.372) * (-357.161) (-358.694) (-359.497) [-362.652] -- 0:00:58
214000 -- [-361.401] (-356.744) (-357.955) (-357.538) * (-357.093) (-359.803) (-357.616) [-359.731] -- 0:00:58
214500 -- (-358.716) (-358.641) (-359.270) [-358.257] * (-361.229) (-361.349) [-357.442] (-358.670) -- 0:00:58
215000 -- (-358.573) (-359.755) [-359.651] (-359.001) * (-359.394) (-359.191) [-358.549] (-357.894) -- 0:00:58
Average standard deviation of split frequencies: 0.014358
215500 -- (-359.778) (-361.463) (-361.437) [-358.962] * [-358.766] (-358.848) (-358.563) (-357.689) -- 0:00:58
216000 -- (-359.284) [-359.540] (-359.250) (-361.783) * (-356.954) [-357.315] (-360.409) (-357.365) -- 0:00:58
216500 -- (-358.000) [-357.089] (-357.247) (-358.365) * [-357.163] (-357.980) (-361.067) (-358.520) -- 0:00:57
217000 -- (-358.038) (-358.558) (-356.967) [-357.709] * [-358.294] (-359.427) (-358.713) (-359.670) -- 0:00:57
217500 -- (-357.635) (-361.654) (-359.486) [-357.046] * (-359.480) (-359.609) (-358.852) [-358.291] -- 0:00:57
218000 -- (-357.914) (-360.107) [-364.818] (-358.053) * (-358.447) [-358.659] (-357.350) (-363.572) -- 0:00:57
218500 -- (-356.693) [-358.427] (-359.822) (-358.077) * (-357.473) (-360.110) (-359.238) [-362.533] -- 0:00:57
219000 -- (-358.367) (-360.344) [-360.930] (-359.757) * [-357.312] (-359.688) (-357.800) (-361.540) -- 0:00:57
219500 -- (-358.845) [-360.596] (-360.702) (-358.550) * (-357.398) (-358.328) (-357.950) [-358.165] -- 0:00:56
220000 -- (-359.365) (-358.358) (-359.453) [-360.007] * (-358.790) (-361.288) [-358.038] (-358.215) -- 0:00:56
Average standard deviation of split frequencies: 0.012143
220500 -- (-358.411) [-359.582] (-358.389) (-360.272) * (-358.392) (-363.552) (-358.511) [-361.423] -- 0:00:56
221000 -- (-360.546) [-359.179] (-357.164) (-359.264) * (-360.810) (-360.009) [-359.490] (-361.154) -- 0:00:56
221500 -- [-357.318] (-357.349) (-359.972) (-361.086) * (-360.282) (-358.037) [-359.787] (-359.615) -- 0:00:56
222000 -- (-358.167) (-357.875) (-358.400) [-359.916] * (-361.381) (-357.548) [-360.469] (-356.796) -- 0:00:56
222500 -- (-357.719) (-360.414) (-367.260) [-357.378] * [-359.065] (-358.348) (-364.942) (-360.144) -- 0:00:59
223000 -- [-357.234] (-356.994) (-359.122) (-357.279) * (-358.425) [-357.927] (-360.847) (-360.143) -- 0:00:59
223500 -- (-357.170) (-357.141) (-359.733) [-360.551] * (-358.713) [-362.806] (-357.215) (-358.203) -- 0:00:59
224000 -- (-358.681) [-357.557] (-358.264) (-357.227) * (-357.073) [-361.160] (-358.692) (-358.631) -- 0:00:58
224500 -- (-357.716) [-356.658] (-357.373) (-360.075) * (-357.606) (-358.387) [-356.851] (-358.380) -- 0:00:58
225000 -- (-358.195) (-357.755) (-358.464) [-358.125] * (-357.191) (-357.442) [-358.040] (-358.535) -- 0:00:58
Average standard deviation of split frequencies: 0.012405
225500 -- (-357.489) (-356.848) (-362.924) [-360.749] * (-359.597) [-359.125] (-358.397) (-360.512) -- 0:00:58
226000 -- (-358.515) [-356.832] (-358.400) (-360.132) * (-357.643) (-359.646) (-359.125) [-358.266] -- 0:00:58
226500 -- [-358.642] (-358.784) (-359.644) (-361.124) * (-358.661) (-356.895) (-358.586) [-359.236] -- 0:00:58
227000 -- (-359.573) (-361.810) [-357.297] (-358.063) * (-358.388) (-357.322) [-357.348] (-356.588) -- 0:00:57
227500 -- (-360.825) [-362.824] (-359.731) (-358.174) * (-356.531) [-358.509] (-359.111) (-357.070) -- 0:00:57
228000 -- (-358.585) (-358.083) (-357.051) [-357.550] * (-358.202) (-359.928) (-360.091) [-358.688] -- 0:00:57
228500 -- (-358.546) [-357.006] (-357.577) (-358.818) * (-366.544) (-360.201) (-357.342) [-357.594] -- 0:00:57
229000 -- [-358.272] (-359.973) (-361.867) (-357.452) * (-364.450) (-361.546) (-360.718) [-360.893] -- 0:00:57
229500 -- (-358.148) [-361.942] (-361.823) (-361.804) * (-361.715) [-358.621] (-363.558) (-359.674) -- 0:00:57
230000 -- (-363.771) (-356.743) (-358.889) [-359.163] * (-357.802) (-358.374) [-359.773] (-361.542) -- 0:00:56
Average standard deviation of split frequencies: 0.011581
230500 -- (-357.258) [-359.989] (-357.707) (-357.291) * [-359.543] (-360.994) (-359.265) (-362.316) -- 0:00:56
231000 -- [-357.583] (-358.894) (-357.451) (-357.688) * [-360.674] (-358.773) (-359.545) (-357.675) -- 0:00:56
231500 -- (-360.650) [-361.611] (-357.903) (-358.879) * (-359.947) (-358.366) [-357.143] (-364.264) -- 0:00:56
232000 -- (-357.820) (-359.914) [-359.110] (-356.846) * (-357.561) (-360.073) (-357.784) [-357.256] -- 0:00:56
232500 -- (-359.397) (-357.261) [-357.184] (-357.251) * (-363.893) (-360.291) [-357.006] (-357.231) -- 0:00:56
233000 -- [-357.382] (-360.727) (-357.563) (-357.952) * (-358.484) [-359.884] (-361.425) (-357.483) -- 0:00:55
233500 -- [-357.552] (-357.207) (-357.399) (-361.098) * [-358.755] (-360.757) (-358.032) (-356.547) -- 0:00:55
234000 -- (-362.107) (-357.091) (-357.162) [-359.525] * (-361.402) [-359.586] (-358.339) (-358.817) -- 0:00:55
234500 -- (-362.798) (-357.740) (-357.692) [-356.564] * (-360.705) [-358.524] (-357.189) (-358.093) -- 0:00:55
235000 -- (-359.568) [-358.538] (-360.159) (-357.665) * (-359.801) (-361.408) [-360.753] (-356.746) -- 0:00:55
Average standard deviation of split frequencies: 0.009765
235500 -- (-361.644) [-359.994] (-358.886) (-360.138) * [-358.743] (-356.652) (-358.192) (-358.095) -- 0:00:55
236000 -- (-361.064) (-361.191) [-357.548] (-360.235) * (-357.584) (-358.334) (-361.398) [-359.693] -- 0:00:58
236500 -- [-359.322] (-357.650) (-359.536) (-362.356) * (-361.694) [-358.309] (-360.044) (-357.087) -- 0:00:58
237000 -- (-362.820) [-360.022] (-358.437) (-356.691) * (-364.126) (-357.497) (-359.657) [-357.861] -- 0:00:57
237500 -- (-358.650) [-361.745] (-359.271) (-359.894) * (-357.222) (-359.609) [-358.923] (-358.764) -- 0:00:57
238000 -- [-358.913] (-359.306) (-360.518) (-357.398) * [-359.045] (-357.513) (-366.356) (-357.260) -- 0:00:57
238500 -- [-359.599] (-357.018) (-357.946) (-361.618) * [-359.749] (-357.421) (-359.396) (-360.217) -- 0:00:57
239000 -- (-357.656) (-359.487) [-357.494] (-359.132) * (-358.878) (-359.180) [-357.515] (-357.398) -- 0:00:57
239500 -- [-362.224] (-359.073) (-357.993) (-360.880) * (-357.926) (-357.854) [-357.985] (-363.007) -- 0:00:57
240000 -- (-356.880) (-358.923) [-358.360] (-358.352) * (-359.734) (-357.853) [-359.138] (-359.747) -- 0:00:56
Average standard deviation of split frequencies: 0.010024
240500 -- (-358.499) (-357.929) [-358.296] (-361.603) * (-358.672) [-357.154] (-361.411) (-358.155) -- 0:00:56
241000 -- [-357.746] (-367.301) (-359.238) (-359.631) * (-360.531) (-361.478) (-363.307) [-358.712] -- 0:00:56
241500 -- (-364.055) [-358.683] (-357.877) (-362.834) * (-358.248) [-358.151] (-362.096) (-359.433) -- 0:00:56
242000 -- [-360.928] (-363.201) (-357.465) (-359.323) * (-357.079) [-358.463] (-359.241) (-362.563) -- 0:00:56
242500 -- (-358.564) [-356.671] (-357.420) (-362.577) * (-358.776) (-357.375) (-357.929) [-358.545] -- 0:00:56
243000 -- (-358.345) [-359.102] (-358.727) (-357.113) * (-359.497) [-358.081] (-359.885) (-358.759) -- 0:00:56
243500 -- (-359.796) (-358.341) (-359.928) [-359.609] * [-359.171] (-357.489) (-361.205) (-362.045) -- 0:00:55
244000 -- (-360.399) (-358.064) [-358.430] (-356.973) * (-359.366) [-357.376] (-358.590) (-357.570) -- 0:00:55
244500 -- (-363.128) [-362.456] (-360.257) (-359.315) * (-357.076) [-356.805] (-356.976) (-357.510) -- 0:00:55
245000 -- [-357.081] (-359.313) (-359.972) (-361.217) * (-357.080) (-358.627) (-362.106) [-357.450] -- 0:00:55
Average standard deviation of split frequencies: 0.010258
245500 -- (-358.471) (-357.659) (-361.084) [-360.072] * [-358.548] (-359.452) (-358.898) (-359.189) -- 0:00:55
246000 -- [-360.279] (-358.439) (-361.545) (-356.659) * (-358.248) [-357.846] (-359.610) (-357.718) -- 0:00:55
246500 -- (-357.991) (-360.416) [-360.208] (-359.935) * (-359.277) (-357.837) [-357.177] (-356.365) -- 0:00:55
247000 -- (-357.867) (-360.459) [-359.192] (-357.034) * (-359.437) [-357.003] (-357.262) (-358.141) -- 0:00:54
247500 -- (-359.095) [-359.127] (-357.251) (-358.727) * (-359.595) (-358.902) [-357.571] (-357.127) -- 0:00:54
248000 -- (-360.219) (-365.141) (-356.844) [-359.236] * [-359.537] (-358.911) (-361.682) (-358.813) -- 0:00:54
248500 -- (-360.413) (-362.735) [-359.043] (-362.510) * (-356.972) (-362.698) [-361.538] (-360.205) -- 0:00:54
249000 -- (-360.745) (-359.820) (-356.882) [-358.352] * (-363.334) [-362.280] (-359.492) (-362.110) -- 0:00:54
249500 -- (-358.846) (-359.324) [-356.855] (-361.907) * (-358.716) (-361.512) (-359.450) [-359.196] -- 0:00:54
250000 -- (-358.196) [-357.137] (-358.354) (-361.026) * [-358.255] (-357.683) (-358.717) (-360.287) -- 0:00:57
Average standard deviation of split frequencies: 0.011505
250500 -- (-357.488) (-361.315) (-358.397) [-358.320] * (-359.433) (-357.083) [-357.194] (-357.883) -- 0:00:56
251000 -- [-357.822] (-364.896) (-360.824) (-359.438) * (-359.948) [-358.368] (-359.404) (-358.279) -- 0:00:56
251500 -- (-359.384) [-357.518] (-357.945) (-356.574) * (-361.050) [-357.628] (-357.474) (-357.283) -- 0:00:56
252000 -- [-359.699] (-360.131) (-357.227) (-359.004) * (-356.811) [-362.075] (-358.629) (-357.723) -- 0:00:56
252500 -- [-359.458] (-360.322) (-359.960) (-361.375) * [-356.797] (-359.331) (-358.973) (-364.544) -- 0:00:56
253000 -- (-361.236) (-368.417) [-360.306] (-362.431) * (-356.787) (-359.555) [-358.684] (-357.733) -- 0:00:56
253500 -- [-358.469] (-360.864) (-356.874) (-361.329) * (-357.624) [-359.251] (-358.121) (-357.572) -- 0:00:55
254000 -- (-358.912) (-360.473) (-356.787) [-356.920] * [-356.554] (-359.151) (-358.057) (-357.409) -- 0:00:55
254500 -- [-357.873] (-358.965) (-358.181) (-359.327) * (-357.719) (-360.754) [-356.491] (-358.023) -- 0:00:55
255000 -- (-358.685) [-357.276] (-358.671) (-358.515) * (-361.462) [-358.927] (-360.735) (-358.510) -- 0:00:55
Average standard deviation of split frequencies: 0.010832
255500 -- (-358.549) (-361.030) [-360.804] (-359.626) * (-362.292) [-359.255] (-359.785) (-360.596) -- 0:00:55
256000 -- (-357.857) (-362.110) [-359.612] (-360.532) * (-360.857) (-359.265) (-359.744) [-358.927] -- 0:00:55
256500 -- [-359.204] (-356.904) (-358.594) (-358.914) * (-359.734) [-358.505] (-357.878) (-362.935) -- 0:00:55
257000 -- [-357.432] (-359.784) (-358.339) (-358.014) * (-357.499) [-358.093] (-360.925) (-363.882) -- 0:00:54
257500 -- (-357.594) [-358.662] (-356.973) (-358.455) * [-358.287] (-358.339) (-358.260) (-358.103) -- 0:00:54
258000 -- (-357.004) (-360.583) (-359.535) [-358.748] * (-357.764) [-358.123] (-358.789) (-359.056) -- 0:00:54
258500 -- [-357.889] (-356.781) (-358.800) (-358.474) * [-358.838] (-357.738) (-357.159) (-358.007) -- 0:00:54
259000 -- (-358.173) (-358.216) [-357.508] (-358.518) * (-359.000) [-357.318] (-358.033) (-366.166) -- 0:00:54
259500 -- (-358.951) [-358.678] (-358.126) (-358.812) * [-359.182] (-357.414) (-358.934) (-358.868) -- 0:00:54
260000 -- (-358.758) (-358.409) [-359.458] (-358.721) * (-359.780) [-357.348] (-359.036) (-361.848) -- 0:00:54
Average standard deviation of split frequencies: 0.010625
260500 -- (-357.542) [-359.043] (-357.206) (-358.415) * (-359.552) (-357.793) [-357.766] (-361.155) -- 0:00:53
261000 -- [-358.585] (-359.261) (-358.412) (-361.816) * (-358.087) (-359.893) (-361.285) [-357.648] -- 0:00:53
261500 -- (-359.356) (-358.766) [-360.263] (-362.722) * (-357.725) (-357.748) [-360.392] (-359.422) -- 0:00:53
262000 -- (-361.405) (-359.642) [-357.155] (-361.241) * (-357.367) (-357.878) [-357.826] (-360.396) -- 0:00:53
262500 -- [-360.268] (-360.252) (-359.214) (-362.893) * (-359.878) [-357.767] (-360.351) (-364.718) -- 0:00:53
263000 -- (-360.279) (-364.723) (-362.111) [-358.457] * (-359.910) (-357.980) (-358.423) [-361.033] -- 0:00:53
263500 -- (-360.809) (-362.613) (-358.421) [-357.656] * (-357.878) (-357.060) [-359.435] (-358.855) -- 0:00:55
264000 -- (-358.955) [-364.085] (-357.210) (-359.463) * (-357.944) (-362.036) (-358.580) [-357.219] -- 0:00:55
264500 -- (-357.533) (-361.222) (-359.547) [-359.724] * (-357.683) (-359.248) [-358.954] (-360.732) -- 0:00:55
265000 -- (-358.418) [-362.308] (-358.183) (-362.738) * (-359.716) (-359.632) (-357.978) [-360.745] -- 0:00:55
Average standard deviation of split frequencies: 0.010412
265500 -- (-358.693) [-358.067] (-357.440) (-359.742) * (-356.878) [-360.385] (-357.308) (-359.665) -- 0:00:55
266000 -- [-360.310] (-358.479) (-358.275) (-360.069) * (-357.483) (-360.718) (-358.786) [-357.727] -- 0:00:55
266500 -- (-360.531) [-358.621] (-357.370) (-358.782) * (-358.477) [-357.609] (-357.610) (-358.874) -- 0:00:55
267000 -- [-361.814] (-362.479) (-357.777) (-359.410) * (-356.803) [-358.493] (-356.997) (-360.804) -- 0:00:54
267500 -- (-359.823) (-360.259) [-361.764] (-358.850) * (-358.606) (-358.929) (-359.064) [-356.744] -- 0:00:54
268000 -- [-358.306] (-360.483) (-364.778) (-359.713) * [-357.272] (-358.323) (-358.948) (-358.112) -- 0:00:54
268500 -- [-358.321] (-358.523) (-359.272) (-358.101) * (-357.967) (-358.285) (-361.333) [-362.446] -- 0:00:54
269000 -- (-359.196) (-358.966) (-358.632) [-357.734] * (-358.307) [-361.013] (-360.877) (-358.449) -- 0:00:54
269500 -- (-360.276) (-358.063) [-357.016] (-357.796) * (-358.707) (-359.690) (-360.190) [-358.137] -- 0:00:54
270000 -- (-357.411) (-359.940) [-359.100] (-360.843) * (-358.009) (-359.011) (-357.850) [-357.388] -- 0:00:54
Average standard deviation of split frequencies: 0.010450
270500 -- (-356.957) (-360.363) (-358.626) [-358.089] * (-359.695) (-358.977) (-358.916) [-357.582] -- 0:00:53
271000 -- (-357.749) (-359.171) [-358.690] (-360.398) * [-358.568] (-359.708) (-357.828) (-358.481) -- 0:00:53
271500 -- [-357.545] (-360.387) (-360.099) (-358.159) * [-357.806] (-357.421) (-359.126) (-357.610) -- 0:00:53
272000 -- (-357.309) (-357.338) [-358.205] (-361.170) * (-360.725) (-357.832) (-360.793) [-359.302] -- 0:00:53
272500 -- [-358.206] (-361.300) (-358.467) (-360.768) * (-356.645) [-359.333] (-357.456) (-358.622) -- 0:00:53
273000 -- (-358.179) [-357.882] (-357.825) (-357.897) * (-359.262) (-358.918) (-361.251) [-359.706] -- 0:00:53
273500 -- (-358.804) [-358.152] (-358.487) (-357.381) * (-364.308) (-359.662) [-359.694] (-363.881) -- 0:00:53
274000 -- (-358.306) [-359.228] (-357.557) (-358.770) * (-361.084) (-357.549) [-361.074] (-360.945) -- 0:00:52
274500 -- (-360.063) (-357.123) (-357.823) [-356.421] * (-358.636) [-357.639] (-362.323) (-361.495) -- 0:00:52
275000 -- (-359.900) [-359.317] (-358.619) (-358.795) * (-356.672) (-356.698) [-357.778] (-356.611) -- 0:00:52
Average standard deviation of split frequencies: 0.011454
275500 -- [-362.492] (-357.743) (-359.667) (-358.910) * (-358.531) (-358.939) [-357.232] (-358.086) -- 0:00:52
276000 -- (-363.586) (-357.824) (-357.910) [-360.422] * [-358.516] (-356.696) (-357.728) (-358.090) -- 0:00:52
276500 -- (-364.941) (-358.186) [-358.310] (-359.476) * [-360.800] (-357.257) (-360.292) (-358.144) -- 0:00:52
277000 -- [-357.792] (-361.618) (-359.321) (-356.456) * (-356.934) (-358.882) (-361.845) [-358.948] -- 0:00:52
277500 -- (-357.606) [-359.379] (-357.303) (-358.926) * [-357.452] (-358.860) (-359.685) (-358.325) -- 0:00:52
278000 -- [-360.323] (-358.571) (-359.095) (-359.880) * (-357.882) [-358.768] (-357.756) (-360.173) -- 0:00:51
278500 -- [-358.185] (-358.513) (-362.779) (-359.732) * (-358.642) (-359.783) (-356.817) [-358.933] -- 0:00:51
279000 -- [-360.751] (-356.864) (-356.874) (-358.504) * (-359.005) (-358.283) (-361.475) [-356.644] -- 0:00:54
279500 -- (-358.932) [-358.987] (-360.999) (-357.568) * (-357.524) [-358.900] (-357.859) (-357.289) -- 0:00:54
280000 -- [-359.435] (-357.113) (-363.710) (-363.520) * (-357.144) (-362.350) [-357.055] (-357.779) -- 0:00:53
Average standard deviation of split frequencies: 0.011164
280500 -- (-358.121) (-357.035) (-363.531) [-358.203] * (-361.700) (-361.420) [-359.982] (-357.258) -- 0:00:53
281000 -- [-358.873] (-359.382) (-356.880) (-361.105) * (-360.981) (-357.603) (-360.017) [-358.419] -- 0:00:53
281500 -- (-358.400) (-357.675) (-360.547) [-358.445] * [-357.153] (-357.757) (-357.162) (-361.307) -- 0:00:53
282000 -- [-359.541] (-363.141) (-361.898) (-358.490) * (-360.696) [-358.783] (-358.890) (-361.194) -- 0:00:53
282500 -- (-360.989) (-368.175) [-357.409] (-357.466) * [-359.752] (-358.975) (-360.666) (-361.960) -- 0:00:53
283000 -- (-359.203) (-357.112) [-357.007] (-358.557) * [-359.206] (-357.406) (-358.858) (-358.349) -- 0:00:53
283500 -- (-361.470) [-360.781] (-358.624) (-357.125) * (-358.834) (-357.536) [-357.824] (-360.193) -- 0:00:53
284000 -- (-359.625) (-359.830) (-360.119) [-359.413] * [-359.498] (-359.395) (-358.867) (-360.363) -- 0:00:52
284500 -- (-361.640) (-360.879) (-359.301) [-357.653] * (-361.652) [-359.318] (-358.530) (-360.686) -- 0:00:52
285000 -- [-358.227] (-359.563) (-358.502) (-356.716) * (-356.666) (-359.846) [-357.852] (-359.508) -- 0:00:52
Average standard deviation of split frequencies: 0.011053
285500 -- (-356.713) [-362.341] (-357.979) (-359.045) * (-360.705) [-361.746] (-358.081) (-356.867) -- 0:00:52
286000 -- (-359.841) (-359.382) (-357.805) [-357.723] * (-358.634) (-361.019) (-357.546) [-359.665] -- 0:00:52
286500 -- (-360.735) (-361.462) [-360.333] (-359.041) * (-360.007) (-358.358) [-358.722] (-358.106) -- 0:00:52
287000 -- [-357.649] (-359.524) (-360.378) (-361.981) * (-358.807) (-363.419) (-358.125) [-365.264] -- 0:00:52
287500 -- (-357.045) (-358.414) (-357.630) [-358.527] * (-357.790) (-357.214) (-362.150) [-359.094] -- 0:00:52
288000 -- [-356.671] (-360.077) (-359.751) (-360.589) * [-359.961] (-358.008) (-359.312) (-358.699) -- 0:00:51
288500 -- (-358.366) (-359.574) [-359.268] (-361.012) * (-357.818) (-358.593) [-359.225] (-359.324) -- 0:00:51
289000 -- (-359.105) [-359.708] (-361.225) (-360.443) * (-357.743) [-356.962] (-358.230) (-359.186) -- 0:00:51
289500 -- [-360.035] (-358.456) (-358.682) (-359.445) * [-356.537] (-363.091) (-356.959) (-359.668) -- 0:00:51
290000 -- (-356.944) (-359.001) (-361.175) [-359.206] * (-358.980) (-359.862) [-356.855] (-360.434) -- 0:00:51
Average standard deviation of split frequencies: 0.011162
290500 -- [-357.444] (-359.630) (-356.820) (-358.627) * [-358.270] (-361.406) (-357.502) (-357.476) -- 0:00:51
291000 -- (-357.060) (-358.341) [-357.496] (-359.721) * (-362.653) (-360.469) [-356.975] (-358.791) -- 0:00:51
291500 -- [-356.828] (-360.003) (-361.908) (-363.002) * (-359.618) (-358.258) (-357.757) [-357.598] -- 0:00:51
292000 -- [-358.219] (-358.169) (-361.894) (-363.149) * [-359.040] (-359.421) (-357.751) (-358.830) -- 0:00:50
292500 -- [-359.649] (-358.653) (-357.984) (-362.703) * (-359.414) (-357.688) [-358.743] (-357.628) -- 0:00:50
293000 -- (-359.020) (-362.461) (-357.412) [-358.650] * [-359.154] (-361.310) (-357.750) (-360.051) -- 0:00:50
293500 -- [-356.642] (-360.547) (-360.919) (-358.856) * (-357.722) (-362.347) (-357.236) [-360.156] -- 0:00:50
294000 -- (-357.443) (-359.918) (-357.490) [-360.218] * [-358.337] (-359.699) (-362.499) (-362.481) -- 0:00:50
294500 -- (-358.160) [-358.649] (-357.376) (-359.339) * [-358.829] (-357.882) (-359.666) (-359.454) -- 0:00:50
295000 -- (-359.371) (-356.952) (-358.873) [-357.689] * [-357.984] (-359.187) (-358.338) (-359.144) -- 0:00:50
Average standard deviation of split frequencies: 0.011804
295500 -- (-358.597) (-359.510) [-357.626] (-358.868) * [-358.835] (-356.987) (-357.344) (-361.855) -- 0:00:52
296000 -- (-358.384) (-359.160) (-359.053) [-359.534] * (-359.515) (-358.905) (-357.839) [-358.066] -- 0:00:52
296500 -- (-357.832) (-357.301) [-359.500] (-361.481) * [-357.920] (-359.994) (-359.123) (-357.800) -- 0:00:52
297000 -- (-357.949) (-358.588) (-359.182) [-359.909] * (-356.834) (-360.628) [-357.547] (-357.906) -- 0:00:52
297500 -- (-357.983) (-358.242) (-359.578) [-358.124] * (-357.193) [-358.672] (-358.349) (-357.539) -- 0:00:51
298000 -- (-359.249) [-357.822] (-358.120) (-358.389) * (-359.284) (-363.787) [-359.531] (-359.125) -- 0:00:51
298500 -- [-358.984] (-358.521) (-357.262) (-358.673) * [-356.687] (-357.325) (-361.460) (-357.004) -- 0:00:51
299000 -- (-356.875) (-357.206) [-356.790] (-359.032) * (-357.492) [-357.544] (-361.424) (-359.848) -- 0:00:51
299500 -- (-358.688) (-360.283) [-357.952] (-357.969) * [-357.871] (-362.378) (-357.667) (-358.544) -- 0:00:51
300000 -- [-359.518] (-358.250) (-358.998) (-357.634) * [-360.385] (-359.028) (-359.740) (-358.599) -- 0:00:51
Average standard deviation of split frequencies: 0.011621
300500 -- (-359.100) (-357.899) [-360.963] (-362.047) * (-362.989) [-357.726] (-359.860) (-361.083) -- 0:00:51
301000 -- (-360.278) [-357.676] (-363.731) (-358.903) * (-367.954) (-357.446) (-358.273) [-361.327] -- 0:00:51
301500 -- [-357.253] (-358.103) (-361.375) (-360.886) * [-360.670] (-359.554) (-359.842) (-360.904) -- 0:00:50
302000 -- (-357.642) [-359.160] (-358.272) (-357.025) * [-363.992] (-358.232) (-358.206) (-361.008) -- 0:00:50
302500 -- [-357.243] (-358.153) (-359.403) (-361.656) * [-357.840] (-360.602) (-358.660) (-357.304) -- 0:00:50
303000 -- [-361.000] (-358.178) (-357.792) (-360.518) * (-356.708) [-361.218] (-358.603) (-357.414) -- 0:00:50
303500 -- (-357.072) (-357.603) [-359.403] (-358.546) * (-358.917) (-360.123) [-358.644] (-357.361) -- 0:00:50
304000 -- (-358.470) (-363.275) [-357.592] (-357.821) * [-357.774] (-362.769) (-357.855) (-365.615) -- 0:00:50
304500 -- (-359.134) [-358.741] (-358.222) (-358.295) * [-358.788] (-358.233) (-356.891) (-357.821) -- 0:00:50
305000 -- (-360.531) (-357.570) (-359.483) [-357.136] * (-358.037) (-357.623) (-357.139) [-359.297] -- 0:00:50
Average standard deviation of split frequencies: 0.011297
305500 -- (-359.182) [-363.838] (-358.776) (-358.216) * [-357.736] (-360.051) (-361.359) (-359.088) -- 0:00:50
306000 -- [-358.418] (-357.401) (-360.752) (-358.414) * (-357.057) (-360.266) [-358.447] (-362.854) -- 0:00:49
306500 -- [-357.633] (-359.287) (-358.574) (-361.436) * (-358.373) [-357.934] (-358.425) (-361.308) -- 0:00:49
307000 -- (-357.895) (-356.840) [-358.029] (-357.613) * (-357.563) (-357.257) [-358.617] (-363.819) -- 0:00:49
307500 -- (-359.002) [-357.903] (-360.743) (-358.554) * (-357.446) [-359.655] (-359.826) (-359.709) -- 0:00:49
308000 -- [-358.313] (-359.122) (-357.430) (-357.705) * [-357.381] (-359.036) (-359.869) (-360.869) -- 0:00:49
308500 -- (-358.319) (-358.219) (-359.013) [-357.008] * (-359.292) (-359.946) (-357.793) [-358.204] -- 0:00:49
309000 -- (-359.036) (-357.133) (-361.256) [-359.371] * [-359.015] (-359.240) (-358.052) (-359.384) -- 0:00:49
309500 -- (-359.457) (-361.473) [-357.617] (-358.008) * (-359.218) (-359.493) (-357.423) [-359.447] -- 0:00:49
310000 -- (-361.032) (-358.806) [-358.213] (-357.792) * (-358.422) (-359.897) (-358.537) [-361.796] -- 0:00:48
Average standard deviation of split frequencies: 0.012055
310500 -- (-361.971) (-357.577) (-363.832) [-359.512] * [-358.451] (-357.994) (-359.173) (-358.948) -- 0:00:48
311000 -- (-362.826) (-358.317) [-359.581] (-357.727) * (-359.307) (-358.018) [-359.880] (-358.646) -- 0:00:48
311500 -- [-362.603] (-356.636) (-360.838) (-360.272) * (-365.634) (-356.972) (-359.775) [-360.775] -- 0:00:50
312000 -- (-358.076) (-359.573) (-359.877) [-359.962] * [-357.713] (-357.842) (-357.045) (-358.949) -- 0:00:50
312500 -- (-358.713) [-357.575] (-357.918) (-358.716) * (-360.498) (-358.784) [-356.849] (-358.456) -- 0:00:50
313000 -- (-356.488) [-358.766] (-357.090) (-358.289) * (-358.106) (-359.079) [-359.965] (-359.001) -- 0:00:50
313500 -- (-357.065) [-358.402] (-358.318) (-359.528) * (-358.792) (-360.189) [-357.001] (-358.509) -- 0:00:50
314000 -- [-356.704] (-358.977) (-363.332) (-358.645) * (-357.384) [-359.534] (-360.731) (-360.796) -- 0:00:50
314500 -- (-360.943) (-357.867) [-360.246] (-357.988) * (-358.577) (-362.310) (-358.128) [-363.844] -- 0:00:50
315000 -- (-360.520) [-357.468] (-360.844) (-359.979) * [-358.878] (-357.111) (-356.837) (-359.638) -- 0:00:50
Average standard deviation of split frequencies: 0.011232
315500 -- (-358.565) [-359.940] (-361.868) (-357.490) * (-363.143) (-358.774) (-356.840) [-357.697] -- 0:00:49
316000 -- [-360.171] (-361.552) (-358.984) (-364.400) * [-358.315] (-363.115) (-357.456) (-357.095) -- 0:00:49
316500 -- [-359.414] (-359.389) (-359.871) (-365.385) * (-358.408) (-357.555) (-361.126) [-358.668] -- 0:00:49
317000 -- (-359.408) [-363.420] (-357.502) (-359.888) * (-358.179) [-359.771] (-361.080) (-357.038) -- 0:00:49
317500 -- [-362.501] (-362.647) (-359.290) (-359.963) * (-358.846) (-357.711) [-364.868] (-358.916) -- 0:00:49
318000 -- (-359.881) (-362.586) (-357.735) [-358.032] * (-359.513) (-359.577) (-358.089) [-359.103] -- 0:00:49
318500 -- (-358.826) (-358.869) (-358.958) [-358.250] * [-360.675] (-358.651) (-357.027) (-358.056) -- 0:00:49
319000 -- (-357.287) (-359.576) [-357.395] (-359.751) * (-358.828) (-361.404) (-359.746) [-361.052] -- 0:00:49
319500 -- (-357.962) [-357.763] (-360.827) (-358.989) * [-357.468] (-363.811) (-357.121) (-359.624) -- 0:00:48
320000 -- [-356.509] (-358.962) (-360.084) (-361.648) * (-360.057) [-359.825] (-367.167) (-360.980) -- 0:00:48
Average standard deviation of split frequencies: 0.010896
320500 -- (-360.113) (-358.987) (-362.199) [-360.013] * (-357.905) [-357.362] (-366.977) (-357.064) -- 0:00:48
321000 -- [-358.230] (-363.079) (-358.820) (-358.377) * (-359.901) [-358.032] (-369.691) (-358.161) -- 0:00:48
321500 -- (-359.778) (-360.972) [-358.209] (-357.686) * (-356.588) (-356.796) [-360.212] (-358.501) -- 0:00:48
322000 -- (-360.807) (-362.266) [-357.622] (-359.327) * (-358.156) [-359.984] (-358.411) (-359.193) -- 0:00:48
322500 -- (-360.146) [-359.705] (-359.673) (-358.101) * (-358.236) (-358.294) (-356.825) [-357.285] -- 0:00:48
323000 -- (-360.515) [-362.804] (-357.046) (-358.427) * (-357.624) (-358.201) [-357.562] (-364.786) -- 0:00:48
323500 -- (-358.243) [-360.001] (-357.426) (-362.569) * (-358.000) (-359.182) [-357.052] (-358.944) -- 0:00:48
324000 -- [-357.089] (-358.603) (-357.015) (-359.658) * (-358.287) (-358.845) (-357.476) [-366.261] -- 0:00:47
324500 -- (-357.741) [-361.390] (-357.319) (-359.736) * (-357.430) (-362.736) [-356.833] (-364.357) -- 0:00:47
325000 -- (-360.426) [-361.845] (-357.335) (-357.343) * (-357.615) (-364.582) (-360.907) [-361.269] -- 0:00:47
Average standard deviation of split frequencies: 0.009881
325500 -- (-360.685) (-358.586) [-358.082] (-358.841) * (-358.717) (-366.290) (-357.603) [-362.135] -- 0:00:47
326000 -- (-360.051) (-360.457) [-358.618] (-362.955) * (-356.804) [-358.495] (-357.030) (-357.860) -- 0:00:47
326500 -- (-360.553) [-358.545] (-356.371) (-358.796) * (-357.009) (-357.189) (-360.019) [-357.389] -- 0:00:47
327000 -- [-357.488] (-356.735) (-357.694) (-360.000) * [-358.774] (-358.471) (-359.109) (-356.947) -- 0:00:47
327500 -- [-356.568] (-358.235) (-357.576) (-357.293) * [-356.618] (-359.289) (-362.740) (-359.143) -- 0:00:47
328000 -- (-358.456) (-360.761) (-359.670) [-359.328] * [-357.827] (-363.775) (-357.454) (-357.199) -- 0:00:47
328500 -- (-358.419) (-358.501) [-358.197] (-358.267) * (-359.287) (-358.314) (-357.780) [-357.366] -- 0:00:49
329000 -- [-358.292] (-362.194) (-360.004) (-356.773) * (-360.628) [-356.820] (-358.433) (-357.323) -- 0:00:48
329500 -- (-357.205) (-359.181) (-358.562) [-358.167] * [-365.642] (-363.349) (-356.683) (-357.669) -- 0:00:48
330000 -- (-361.575) (-363.375) (-356.522) [-357.725] * [-358.448] (-361.704) (-356.377) (-359.096) -- 0:00:48
Average standard deviation of split frequencies: 0.009141
330500 -- (-360.210) (-367.611) (-356.996) [-357.966] * (-360.473) (-359.101) [-356.716] (-360.756) -- 0:00:48
331000 -- [-357.142] (-360.335) (-358.499) (-357.954) * (-362.743) (-358.704) (-357.672) [-357.895] -- 0:00:48
331500 -- (-359.304) [-359.165] (-357.681) (-359.749) * (-358.246) [-357.276] (-358.189) (-357.634) -- 0:00:48
332000 -- (-357.128) (-358.791) [-357.057] (-358.865) * (-358.523) (-360.205) (-363.207) [-357.922] -- 0:00:48
332500 -- (-360.015) (-359.562) [-359.324] (-359.431) * (-360.805) (-361.838) (-357.966) [-358.017] -- 0:00:48
333000 -- (-357.223) (-356.648) [-357.577] (-358.905) * (-359.182) (-360.538) (-359.748) [-358.606] -- 0:00:48
333500 -- (-363.869) (-358.804) (-357.307) [-358.044] * (-357.114) (-361.564) (-362.486) [-359.876] -- 0:00:47
334000 -- [-360.121] (-362.805) (-359.807) (-361.399) * (-359.649) [-357.812] (-356.991) (-358.743) -- 0:00:47
334500 -- (-359.289) [-357.177] (-358.036) (-357.140) * [-357.404] (-358.011) (-356.538) (-359.351) -- 0:00:47
335000 -- (-360.821) (-358.752) [-359.756] (-362.068) * (-357.229) [-361.400] (-358.062) (-358.646) -- 0:00:47
Average standard deviation of split frequencies: 0.009041
335500 -- [-356.884] (-359.141) (-358.309) (-360.420) * [-359.286] (-357.207) (-356.555) (-360.799) -- 0:00:47
336000 -- (-358.783) (-361.031) (-357.202) [-361.678] * (-356.880) (-359.310) [-357.587] (-357.050) -- 0:00:47
336500 -- [-357.923] (-360.916) (-357.557) (-364.134) * (-358.637) (-357.663) (-358.322) [-357.443] -- 0:00:47
337000 -- (-360.529) (-358.803) (-356.674) [-357.392] * (-359.951) (-357.329) (-358.719) [-361.697] -- 0:00:47
337500 -- (-363.533) (-359.202) (-358.451) [-358.238] * [-359.181] (-360.971) (-359.595) (-360.551) -- 0:00:47
338000 -- (-358.242) (-360.211) (-359.193) [-357.399] * [-358.736] (-357.260) (-360.945) (-359.280) -- 0:00:47
338500 -- (-359.010) (-359.428) [-358.195] (-357.723) * (-359.880) (-360.644) [-357.607] (-357.988) -- 0:00:46
339000 -- (-357.899) (-359.516) [-357.064] (-363.094) * (-358.136) (-357.684) [-358.923] (-358.142) -- 0:00:46
339500 -- [-357.971] (-358.606) (-357.851) (-356.859) * (-358.991) (-358.241) (-359.822) [-358.714] -- 0:00:46
340000 -- [-358.983] (-358.639) (-360.083) (-356.992) * (-357.170) [-358.888] (-360.330) (-358.876) -- 0:00:46
Average standard deviation of split frequencies: 0.008841
340500 -- (-359.897) (-358.927) [-357.499] (-357.645) * (-357.858) (-357.566) [-360.449] (-361.269) -- 0:00:46
341000 -- (-359.699) (-356.730) [-359.475] (-359.572) * (-359.363) [-356.862] (-360.139) (-361.778) -- 0:00:46
341500 -- (-358.935) [-357.566] (-360.176) (-357.775) * (-358.757) [-358.499] (-358.809) (-359.204) -- 0:00:46
342000 -- (-360.523) (-359.914) (-360.614) [-356.931] * [-357.595] (-362.722) (-358.065) (-358.136) -- 0:00:46
342500 -- (-357.133) (-362.309) [-360.290] (-359.533) * (-356.537) [-358.158] (-360.142) (-356.959) -- 0:00:46
343000 -- (-363.114) (-358.015) (-366.772) [-358.875] * (-358.480) (-358.331) (-360.843) [-356.498] -- 0:00:45
343500 -- [-358.989] (-357.159) (-358.197) (-359.558) * (-357.855) [-356.574] (-359.365) (-358.352) -- 0:00:45
344000 -- (-357.867) [-358.350] (-359.816) (-359.810) * (-360.269) (-356.780) (-358.655) [-358.148] -- 0:00:45
344500 -- [-356.782] (-358.029) (-358.683) (-359.424) * [-357.757] (-358.596) (-358.706) (-357.027) -- 0:00:45
345000 -- [-357.283] (-358.092) (-357.323) (-361.291) * (-361.160) (-361.219) (-357.021) [-357.795] -- 0:00:45
Average standard deviation of split frequencies: 0.008326
345500 -- (-358.792) [-358.197] (-359.743) (-361.409) * (-358.151) (-357.482) [-356.978] (-357.847) -- 0:00:47
346000 -- (-360.456) (-360.894) [-357.798] (-363.979) * (-356.950) (-359.639) [-357.743] (-357.931) -- 0:00:47
346500 -- (-356.865) (-360.627) [-358.419] (-358.256) * [-357.011] (-359.377) (-357.455) (-361.774) -- 0:00:47
347000 -- (-358.665) (-356.979) (-358.809) [-358.031] * (-358.110) (-361.865) [-357.873] (-358.492) -- 0:00:47
347500 -- (-358.788) (-358.121) (-360.131) [-359.718] * [-357.659] (-358.669) (-365.098) (-357.184) -- 0:00:46
348000 -- (-362.656) (-357.540) (-363.194) [-357.815] * (-359.390) (-360.480) (-361.940) [-356.416] -- 0:00:46
348500 -- (-359.343) (-359.541) [-362.102] (-359.212) * (-359.680) (-358.064) [-361.383] (-358.505) -- 0:00:46
349000 -- (-358.864) (-357.736) (-364.181) [-357.204] * (-360.203) (-358.626) (-357.323) [-359.590] -- 0:00:46
349500 -- (-359.142) [-359.511] (-358.905) (-357.305) * (-361.436) (-356.554) [-357.474] (-358.858) -- 0:00:46
350000 -- (-359.298) (-360.153) (-359.013) [-358.983] * (-358.359) (-356.859) (-360.321) [-359.364] -- 0:00:46
Average standard deviation of split frequencies: 0.009111
350500 -- (-356.622) (-357.863) (-356.397) [-359.660] * (-358.881) [-357.268] (-360.788) (-360.533) -- 0:00:46
351000 -- (-360.658) (-363.426) (-358.538) [-358.598] * (-356.904) [-357.757] (-361.358) (-358.581) -- 0:00:46
351500 -- (-360.425) (-357.737) (-360.011) [-360.692] * (-361.129) [-357.521] (-357.402) (-359.449) -- 0:00:46
352000 -- (-358.464) (-359.093) (-358.181) [-356.656] * [-359.984] (-358.874) (-356.826) (-359.521) -- 0:00:46
352500 -- (-359.747) [-360.066] (-361.646) (-357.952) * (-357.835) (-358.574) [-357.834] (-357.352) -- 0:00:45
353000 -- (-358.032) (-359.618) (-358.885) [-358.820] * [-356.772] (-356.841) (-357.391) (-359.776) -- 0:00:45
353500 -- [-359.425] (-359.453) (-359.773) (-357.679) * [-359.639] (-358.651) (-358.552) (-358.585) -- 0:00:45
354000 -- [-359.089] (-361.122) (-360.540) (-357.786) * [-360.561] (-359.051) (-357.341) (-358.443) -- 0:00:45
354500 -- (-357.883) (-357.240) (-357.626) [-358.565] * (-358.318) (-356.673) (-358.633) [-358.966] -- 0:00:45
355000 -- (-358.302) (-358.330) (-357.340) [-357.791] * (-358.392) [-358.528] (-357.703) (-365.284) -- 0:00:45
Average standard deviation of split frequencies: 0.009048
355500 -- [-357.876] (-358.575) (-357.672) (-358.363) * [-360.770] (-359.034) (-360.479) (-361.545) -- 0:00:45
356000 -- (-358.915) (-361.085) [-360.144] (-358.883) * (-357.543) (-359.811) [-358.063] (-366.938) -- 0:00:45
356500 -- (-357.491) [-361.483] (-357.957) (-358.228) * [-360.009] (-360.191) (-358.507) (-357.324) -- 0:00:45
357000 -- [-356.637] (-357.332) (-358.386) (-356.997) * (-356.487) (-359.050) (-357.617) [-361.344] -- 0:00:45
357500 -- (-363.531) [-358.953] (-359.802) (-359.839) * (-357.043) (-357.311) [-358.244] (-359.468) -- 0:00:44
358000 -- (-360.962) (-359.202) [-358.254] (-357.434) * (-357.512) (-360.247) [-356.991] (-357.712) -- 0:00:44
358500 -- (-358.397) [-357.315] (-359.988) (-358.187) * (-360.674) (-360.953) [-359.808] (-357.987) -- 0:00:44
359000 -- [-360.055] (-357.911) (-362.282) (-361.000) * (-358.434) (-358.652) [-358.188] (-357.443) -- 0:00:44
359500 -- [-357.253] (-359.497) (-360.247) (-357.249) * (-357.858) (-358.848) (-361.388) [-356.836] -- 0:00:44
360000 -- (-360.694) [-357.862] (-358.690) (-358.297) * (-357.233) (-357.786) (-357.630) [-359.226] -- 0:00:44
Average standard deviation of split frequencies: 0.009303
360500 -- (-362.382) (-358.452) (-361.560) [-358.235] * (-358.417) [-357.612] (-359.621) (-369.021) -- 0:00:44
361000 -- (-362.663) (-358.170) [-359.281] (-359.306) * (-361.934) [-359.807] (-359.507) (-364.482) -- 0:00:44
361500 -- (-359.749) (-358.786) (-361.939) [-361.887] * (-362.831) (-362.704) (-357.968) [-359.454] -- 0:00:45
362000 -- (-365.245) (-357.703) (-361.090) [-359.198] * [-357.009] (-358.433) (-360.226) (-360.222) -- 0:00:45
362500 -- (-359.908) (-358.246) [-358.733] (-358.685) * (-357.442) (-358.303) [-358.954] (-358.927) -- 0:00:45
363000 -- (-359.490) (-359.424) [-357.537] (-361.956) * (-359.121) (-358.511) (-359.521) [-361.764] -- 0:00:45
363500 -- (-358.103) (-358.215) [-359.428] (-357.474) * (-363.140) (-358.587) [-357.231] (-359.768) -- 0:00:45
364000 -- [-357.227] (-359.298) (-357.925) (-357.965) * (-357.756) (-358.093) (-358.465) [-359.199] -- 0:00:45
364500 -- (-357.411) (-357.248) [-362.513] (-360.379) * (-358.621) [-359.803] (-358.889) (-362.385) -- 0:00:45
365000 -- (-356.718) [-358.941] (-361.013) (-357.633) * (-357.766) [-359.818] (-358.005) (-360.857) -- 0:00:45
Average standard deviation of split frequencies: 0.008944
365500 -- (-356.963) (-362.464) (-359.362) [-357.590] * (-359.102) [-358.006] (-360.152) (-359.226) -- 0:00:45
366000 -- [-358.609] (-358.595) (-360.167) (-357.915) * (-359.119) (-359.326) (-359.469) [-361.571] -- 0:00:45
366500 -- (-360.625) [-358.007] (-359.428) (-357.316) * [-357.382] (-357.267) (-356.981) (-364.336) -- 0:00:44
367000 -- [-357.434] (-357.561) (-358.995) (-356.810) * (-358.230) (-358.569) (-359.198) [-362.522] -- 0:00:44
367500 -- (-359.803) [-358.301] (-360.526) (-358.212) * [-359.258] (-359.235) (-360.981) (-361.995) -- 0:00:44
368000 -- (-360.917) (-359.287) [-358.998] (-359.682) * [-357.789] (-360.199) (-359.175) (-359.040) -- 0:00:44
368500 -- (-360.128) [-359.778] (-358.354) (-360.787) * [-359.135] (-357.331) (-361.443) (-359.890) -- 0:00:44
369000 -- (-358.831) (-360.243) (-359.678) [-357.534] * (-358.439) [-357.481] (-357.607) (-357.556) -- 0:00:44
369500 -- (-358.901) [-359.211] (-357.040) (-362.667) * [-356.984] (-360.697) (-359.132) (-359.052) -- 0:00:44
370000 -- (-359.666) (-362.264) (-359.361) [-360.367] * [-357.229] (-364.997) (-358.312) (-361.530) -- 0:00:44
Average standard deviation of split frequencies: 0.009875
370500 -- (-358.178) (-361.886) [-358.076] (-356.441) * (-362.998) [-357.803] (-363.017) (-360.025) -- 0:00:44
371000 -- (-364.033) (-358.114) (-360.718) [-358.178] * (-360.159) (-357.981) (-359.848) [-356.888] -- 0:00:44
371500 -- (-357.705) [-358.485] (-358.276) (-359.721) * (-357.827) [-360.376] (-359.197) (-361.626) -- 0:00:43
372000 -- (-361.551) [-357.748] (-360.709) (-359.039) * [-357.517] (-358.921) (-359.326) (-358.868) -- 0:00:43
372500 -- (-358.763) (-359.022) (-357.707) [-357.220] * (-359.092) (-357.568) (-357.759) [-357.090] -- 0:00:43
373000 -- [-359.995] (-357.961) (-358.643) (-360.623) * (-356.856) (-357.465) (-356.599) [-358.226] -- 0:00:43
373500 -- (-359.610) [-356.967] (-358.665) (-357.502) * [-356.803] (-357.768) (-357.432) (-358.227) -- 0:00:43
374000 -- (-357.100) (-357.152) (-359.316) [-357.952] * (-361.692) [-357.675] (-356.957) (-358.626) -- 0:00:43
374500 -- (-358.085) (-358.840) (-358.535) [-358.146] * (-362.209) [-359.072] (-362.014) (-358.380) -- 0:00:43
375000 -- [-358.727] (-358.923) (-358.152) (-360.596) * (-363.393) (-358.345) [-359.023] (-357.503) -- 0:00:43
Average standard deviation of split frequencies: 0.009071
375500 -- (-362.130) [-359.036] (-359.770) (-357.415) * (-357.949) [-357.608] (-357.095) (-358.646) -- 0:00:43
376000 -- (-359.355) [-360.555] (-357.718) (-362.531) * [-358.856] (-356.919) (-358.323) (-357.525) -- 0:00:43
376500 -- (-359.926) (-357.102) [-357.163] (-362.393) * (-359.152) [-357.872] (-357.600) (-357.134) -- 0:00:43
377000 -- [-360.421] (-357.686) (-356.995) (-357.772) * [-358.162] (-358.234) (-361.582) (-359.154) -- 0:00:42
377500 -- (-359.503) (-361.970) [-358.249] (-362.025) * [-358.770] (-357.575) (-357.241) (-359.475) -- 0:00:42
378000 -- [-360.703] (-357.707) (-359.705) (-359.866) * [-358.352] (-356.533) (-357.767) (-356.445) -- 0:00:42
378500 -- (-357.373) [-357.287] (-362.417) (-359.928) * [-360.272] (-359.457) (-357.647) (-356.823) -- 0:00:44
379000 -- (-357.299) (-358.193) (-366.185) [-360.018] * (-358.121) (-359.790) [-358.671] (-357.553) -- 0:00:44
379500 -- (-356.854) (-358.975) (-365.314) [-359.654] * (-357.954) (-358.498) [-356.616] (-356.393) -- 0:00:44
380000 -- (-360.339) [-359.048] (-359.789) (-358.456) * (-357.414) (-358.750) (-357.360) [-357.203] -- 0:00:44
Average standard deviation of split frequencies: 0.009033
380500 -- (-360.532) (-360.383) (-358.178) [-357.083] * [-357.633] (-360.645) (-356.459) (-357.813) -- 0:00:43
381000 -- (-359.990) (-360.435) (-357.889) [-356.971] * (-359.397) [-359.494] (-357.101) (-357.371) -- 0:00:43
381500 -- (-361.940) (-360.348) (-359.362) [-358.842] * (-357.367) (-360.044) [-356.600] (-357.239) -- 0:00:43
382000 -- (-361.249) (-359.839) (-359.411) [-357.277] * (-356.939) [-356.995] (-357.080) (-360.315) -- 0:00:43
382500 -- [-359.182] (-358.863) (-359.902) (-356.906) * [-359.351] (-361.903) (-360.209) (-357.569) -- 0:00:43
383000 -- (-359.603) [-360.385] (-359.591) (-357.404) * [-359.982] (-361.134) (-359.962) (-360.499) -- 0:00:43
383500 -- (-359.575) [-360.062] (-357.859) (-358.832) * [-356.690] (-357.427) (-362.656) (-360.628) -- 0:00:43
384000 -- (-360.642) [-360.338] (-360.034) (-358.650) * (-360.142) [-357.792] (-359.053) (-356.948) -- 0:00:43
384500 -- [-363.341] (-357.004) (-360.763) (-357.165) * [-364.208] (-358.693) (-358.302) (-359.635) -- 0:00:43
385000 -- (-359.990) (-360.150) (-360.377) [-357.756] * (-359.020) (-360.759) [-356.863] (-358.536) -- 0:00:43
Average standard deviation of split frequencies: 0.008481
385500 -- (-362.601) (-359.416) [-357.830] (-356.770) * [-356.655] (-361.334) (-358.203) (-358.477) -- 0:00:43
386000 -- (-360.084) (-360.074) (-360.125) [-358.888] * [-358.799] (-357.926) (-358.783) (-357.073) -- 0:00:42
386500 -- (-361.313) [-357.529] (-361.085) (-357.440) * (-357.282) [-357.534] (-357.927) (-363.492) -- 0:00:42
387000 -- [-358.414] (-359.331) (-358.506) (-361.470) * (-362.919) (-361.650) (-358.615) [-359.243] -- 0:00:42
387500 -- (-359.307) (-359.960) [-360.653] (-363.879) * (-365.848) (-358.573) [-357.325] (-360.756) -- 0:00:42
388000 -- (-358.250) (-357.824) [-364.604] (-365.645) * (-360.863) (-357.888) (-360.022) [-359.811] -- 0:00:42
388500 -- (-359.455) (-357.612) (-361.398) [-361.950] * (-364.660) (-360.491) (-357.421) [-356.985] -- 0:00:42
389000 -- (-357.229) (-359.762) (-362.816) [-359.598] * (-358.847) [-358.623] (-367.076) (-360.036) -- 0:00:42
389500 -- (-358.871) (-358.566) (-362.184) [-357.457] * (-357.628) (-357.552) [-357.264] (-360.509) -- 0:00:42
390000 -- [-360.149] (-359.983) (-360.625) (-357.960) * [-360.461] (-358.562) (-359.793) (-360.195) -- 0:00:42
Average standard deviation of split frequencies: 0.008021
390500 -- (-361.766) (-360.185) [-359.496] (-359.116) * (-362.210) (-361.333) [-357.710] (-360.861) -- 0:00:42
391000 -- (-357.686) (-359.398) [-362.484] (-361.204) * (-362.357) (-359.389) [-357.062] (-366.285) -- 0:00:42
391500 -- (-360.013) [-357.988] (-357.984) (-359.551) * (-357.841) (-367.218) (-359.356) [-363.585] -- 0:00:41
392000 -- (-360.588) (-358.637) (-358.253) [-357.416] * [-359.939] (-359.016) (-361.157) (-367.990) -- 0:00:41
392500 -- (-359.593) (-360.612) [-357.068] (-356.709) * (-357.134) [-358.324] (-359.220) (-362.391) -- 0:00:41
393000 -- (-359.278) [-359.097] (-357.612) (-358.355) * (-360.515) [-362.620] (-360.490) (-363.062) -- 0:00:41
393500 -- [-361.252] (-357.798) (-358.082) (-356.965) * (-361.653) [-359.426] (-360.003) (-359.464) -- 0:00:41
394000 -- [-359.682] (-357.255) (-356.582) (-358.654) * (-362.131) (-360.722) [-361.491] (-357.653) -- 0:00:41
394500 -- (-357.898) (-358.363) (-357.778) [-357.165] * (-363.303) [-357.928] (-361.377) (-356.875) -- 0:00:41
395000 -- (-357.139) (-363.355) [-359.870] (-358.037) * [-357.917] (-360.349) (-360.268) (-362.857) -- 0:00:42
Average standard deviation of split frequencies: 0.009453
395500 -- (-362.452) (-363.538) (-357.307) [-360.395] * (-362.177) (-358.827) [-356.565] (-361.166) -- 0:00:42
396000 -- [-358.184] (-356.984) (-357.332) (-359.169) * (-357.001) [-361.018] (-357.051) (-361.841) -- 0:00:42
396500 -- [-357.395] (-356.617) (-362.437) (-363.462) * (-361.212) (-360.113) [-357.407] (-362.658) -- 0:00:42
397000 -- [-361.108] (-357.169) (-361.278) (-357.879) * (-357.281) (-358.451) [-356.935] (-358.625) -- 0:00:42
397500 -- (-357.805) (-358.751) (-358.463) [-357.890] * [-360.263] (-357.950) (-357.597) (-357.259) -- 0:00:42
398000 -- [-358.548] (-357.695) (-358.786) (-358.463) * (-356.893) [-358.392] (-361.261) (-360.216) -- 0:00:42
398500 -- (-361.401) (-359.280) [-359.484] (-358.446) * (-358.817) (-358.719) (-361.578) [-357.808] -- 0:00:42
399000 -- (-361.350) [-357.129] (-360.146) (-357.584) * (-360.478) [-362.422] (-358.295) (-357.736) -- 0:00:42
399500 -- [-360.097] (-357.563) (-358.282) (-362.087) * [-356.979] (-358.249) (-358.005) (-357.222) -- 0:00:42
400000 -- [-357.460] (-359.018) (-358.524) (-360.355) * (-357.394) [-359.285] (-359.998) (-357.392) -- 0:00:41
Average standard deviation of split frequencies: 0.009045
400500 -- (-360.805) (-358.645) [-358.237] (-358.707) * (-358.456) [-363.338] (-361.594) (-358.560) -- 0:00:41
401000 -- (-358.589) [-359.166] (-356.990) (-359.064) * (-360.342) (-359.156) (-359.049) [-357.772] -- 0:00:41
401500 -- (-361.327) (-357.226) (-357.259) [-358.003] * (-357.711) (-359.859) (-360.355) [-358.062] -- 0:00:41
402000 -- (-359.047) (-362.572) (-357.931) [-358.769] * (-357.027) (-363.063) (-357.113) [-358.834] -- 0:00:41
402500 -- (-361.805) (-357.935) (-357.150) [-357.524] * (-363.154) (-364.616) [-357.016] (-357.146) -- 0:00:41
403000 -- (-358.280) (-361.005) (-356.930) [-358.656] * [-358.576] (-359.071) (-358.816) (-357.355) -- 0:00:41
403500 -- (-357.948) [-358.697] (-357.245) (-357.259) * (-357.261) (-362.039) (-366.537) [-358.473] -- 0:00:41
404000 -- (-358.429) (-357.699) [-357.222] (-357.458) * (-358.711) (-357.861) [-358.405] (-358.173) -- 0:00:41
404500 -- (-360.313) (-357.533) (-361.662) [-358.509] * (-359.617) (-363.163) (-358.198) [-358.436] -- 0:00:41
405000 -- [-357.041] (-358.687) (-357.934) (-357.994) * (-359.869) [-357.230] (-356.679) (-358.345) -- 0:00:41
Average standard deviation of split frequencies: 0.010385
405500 -- [-359.577] (-361.790) (-362.367) (-357.451) * (-360.236) [-357.628] (-357.785) (-359.608) -- 0:00:41
406000 -- (-358.468) [-361.603] (-359.080) (-359.974) * (-360.885) (-357.597) [-357.506] (-357.674) -- 0:00:40
406500 -- [-358.085] (-358.664) (-358.029) (-358.351) * (-357.898) (-360.121) (-358.797) [-356.960] -- 0:00:40
407000 -- (-356.689) [-356.977] (-358.671) (-357.682) * (-363.849) (-359.545) (-357.592) [-358.545] -- 0:00:40
407500 -- [-358.373] (-361.482) (-356.615) (-359.481) * [-359.458] (-361.347) (-360.927) (-358.898) -- 0:00:40
408000 -- [-356.615] (-359.896) (-361.527) (-357.231) * (-359.894) [-358.644] (-357.819) (-359.284) -- 0:00:40
408500 -- (-362.350) (-357.687) [-357.650] (-358.523) * (-357.315) [-358.415] (-357.560) (-359.829) -- 0:00:40
409000 -- (-356.672) [-357.107] (-358.261) (-356.598) * (-359.919) [-357.732] (-359.427) (-356.781) -- 0:00:40
409500 -- (-360.465) (-358.702) (-357.978) [-361.120] * (-357.636) (-357.860) (-365.066) [-358.169] -- 0:00:40
410000 -- [-358.001] (-359.417) (-358.116) (-357.550) * (-359.275) (-360.927) [-358.519] (-357.845) -- 0:00:40
Average standard deviation of split frequencies: 0.010522
410500 -- (-358.755) (-358.604) [-358.256] (-357.718) * (-359.692) (-367.508) (-357.656) [-359.541] -- 0:00:40
411000 -- (-361.221) (-357.326) [-361.372] (-359.577) * (-363.540) [-359.800] (-357.157) (-360.702) -- 0:00:40
411500 -- (-357.540) [-359.062] (-357.304) (-364.006) * (-363.078) (-358.471) [-357.415] (-360.800) -- 0:00:41
412000 -- (-358.149) (-358.931) [-359.696] (-359.512) * (-359.541) (-358.117) [-359.797] (-357.216) -- 0:00:41
412500 -- (-360.008) [-357.909] (-359.132) (-357.513) * [-359.346] (-359.228) (-359.730) (-360.587) -- 0:00:41
413000 -- (-359.118) [-359.192] (-359.773) (-360.392) * [-364.777] (-358.951) (-358.244) (-359.806) -- 0:00:41
413500 -- [-359.264] (-357.960) (-358.490) (-361.909) * (-364.956) [-357.163] (-358.600) (-358.258) -- 0:00:41
414000 -- [-360.912] (-358.443) (-360.394) (-359.187) * (-362.059) (-357.598) [-359.325] (-359.556) -- 0:00:41
414500 -- [-361.226] (-357.028) (-357.534) (-359.984) * (-357.942) (-359.825) (-357.112) [-356.907] -- 0:00:40
415000 -- (-360.071) (-360.898) [-359.300] (-358.921) * (-357.377) [-359.361] (-358.032) (-357.556) -- 0:00:40
Average standard deviation of split frequencies: 0.010450
415500 -- (-360.791) [-357.237] (-358.849) (-357.523) * (-357.352) (-358.108) [-358.537] (-357.942) -- 0:00:40
416000 -- (-359.192) (-358.757) [-363.030] (-359.769) * [-359.697] (-357.471) (-360.261) (-358.898) -- 0:00:40
416500 -- [-357.317] (-361.686) (-357.433) (-357.761) * (-356.423) (-357.183) [-359.151] (-358.072) -- 0:00:40
417000 -- [-358.828] (-361.481) (-359.736) (-363.465) * [-357.263] (-357.463) (-357.595) (-360.609) -- 0:00:40
417500 -- (-358.133) (-359.245) (-356.649) [-360.370] * [-359.084] (-360.241) (-358.103) (-358.324) -- 0:00:40
418000 -- (-358.037) [-358.699] (-358.520) (-358.327) * (-358.051) [-360.924] (-360.715) (-357.584) -- 0:00:40
418500 -- [-360.803] (-359.225) (-358.402) (-357.455) * [-356.518] (-358.607) (-358.735) (-358.384) -- 0:00:40
419000 -- (-363.060) (-363.381) [-358.784] (-357.667) * [-356.971] (-358.981) (-360.089) (-358.598) -- 0:00:40
419500 -- (-363.070) (-361.317) (-362.157) [-358.037] * (-363.395) (-357.971) [-360.780] (-357.498) -- 0:00:40
420000 -- (-363.868) (-362.196) [-362.072] (-358.343) * (-358.296) (-357.498) (-358.440) [-361.599] -- 0:00:40
Average standard deviation of split frequencies: 0.009888
420500 -- (-358.606) (-361.803) (-359.626) [-358.891] * (-358.301) (-357.821) (-359.366) [-358.024] -- 0:00:39
421000 -- (-358.154) [-359.380] (-357.478) (-358.708) * (-358.952) [-357.819] (-362.986) (-358.737) -- 0:00:39
421500 -- [-356.387] (-357.470) (-357.428) (-359.650) * (-360.097) (-359.293) [-364.127] (-359.562) -- 0:00:39
422000 -- (-361.354) [-359.224] (-356.466) (-358.483) * (-358.511) (-358.411) [-357.156] (-360.014) -- 0:00:39
422500 -- (-361.079) (-358.385) [-359.021] (-357.899) * [-358.527] (-358.432) (-357.363) (-361.385) -- 0:00:39
423000 -- (-358.059) (-358.000) (-358.369) [-357.731] * (-357.260) (-358.755) (-356.906) [-358.642] -- 0:00:39
423500 -- (-358.909) (-362.866) (-357.271) [-357.381] * (-357.852) (-356.880) (-365.108) [-356.930] -- 0:00:39
424000 -- (-358.157) (-358.390) (-361.053) [-359.208] * (-363.146) (-357.559) (-361.234) [-360.211] -- 0:00:39
424500 -- [-358.186] (-357.300) (-358.827) (-360.112) * (-361.843) (-358.502) (-357.384) [-360.112] -- 0:00:39
425000 -- (-357.342) [-358.337] (-358.074) (-358.485) * [-361.274] (-357.915) (-358.253) (-358.381) -- 0:00:39
Average standard deviation of split frequencies: 0.010205
425500 -- (-360.443) [-357.115] (-359.461) (-362.855) * (-358.936) (-359.394) [-358.290] (-360.445) -- 0:00:39
426000 -- (-357.336) [-357.178] (-361.102) (-361.049) * (-357.591) (-364.719) [-357.436] (-360.400) -- 0:00:39
426500 -- (-361.504) (-360.493) (-359.599) [-361.833] * (-357.190) (-360.149) [-361.682] (-358.807) -- 0:00:38
427000 -- (-360.505) (-358.176) (-357.181) [-360.207] * [-362.221] (-360.149) (-362.604) (-359.391) -- 0:00:38
427500 -- [-359.357] (-356.332) (-362.665) (-361.844) * [-358.656] (-359.802) (-359.588) (-363.140) -- 0:00:38
428000 -- (-356.389) (-358.429) [-359.275] (-359.764) * [-361.048] (-359.732) (-358.800) (-360.593) -- 0:00:38
428500 -- [-359.688] (-357.985) (-359.754) (-356.812) * (-358.552) (-360.753) (-359.540) [-358.926] -- 0:00:40
429000 -- (-359.104) (-359.480) [-357.762] (-366.520) * (-357.694) (-359.138) [-358.251] (-360.262) -- 0:00:39
429500 -- (-358.333) [-361.205] (-358.205) (-363.562) * (-359.180) (-358.458) (-357.911) [-357.253] -- 0:00:39
430000 -- (-357.619) (-361.734) [-357.515] (-358.862) * (-358.732) (-356.745) (-357.166) [-358.284] -- 0:00:39
Average standard deviation of split frequencies: 0.009973
430500 -- (-358.604) (-358.197) (-356.947) [-357.522] * [-358.366] (-356.787) (-356.842) (-358.388) -- 0:00:39
431000 -- (-358.166) (-357.802) [-356.939] (-360.810) * (-357.347) [-357.323] (-358.944) (-357.867) -- 0:00:39
431500 -- (-360.081) (-356.891) (-357.016) [-357.941] * [-357.805] (-361.675) (-357.099) (-358.175) -- 0:00:39
432000 -- (-360.142) (-358.948) (-358.543) [-363.467] * [-357.863] (-362.481) (-357.431) (-360.899) -- 0:00:39
432500 -- (-356.872) [-360.624] (-359.750) (-359.509) * (-358.326) [-360.360] (-360.680) (-362.316) -- 0:00:39
433000 -- (-358.799) (-357.160) [-363.198] (-359.727) * (-356.580) [-356.619] (-358.165) (-358.509) -- 0:00:39
433500 -- (-359.260) (-357.450) [-361.118] (-360.076) * (-357.834) [-358.982] (-359.848) (-357.820) -- 0:00:39
434000 -- (-361.748) (-359.157) [-357.958] (-359.320) * (-359.914) (-358.004) (-357.568) [-363.094] -- 0:00:39
434500 -- (-359.379) (-360.790) (-359.328) [-359.563] * (-360.046) [-359.129] (-357.928) (-359.066) -- 0:00:39
435000 -- (-357.276) [-359.005] (-357.179) (-358.876) * (-358.364) (-359.478) [-356.691] (-357.857) -- 0:00:38
Average standard deviation of split frequencies: 0.009791
435500 -- (-358.181) (-359.131) [-358.235] (-359.590) * (-358.640) (-359.349) [-359.006] (-360.579) -- 0:00:38
436000 -- (-358.925) (-360.663) [-362.065] (-358.203) * (-357.963) (-359.062) [-358.396] (-357.836) -- 0:00:38
436500 -- (-363.682) (-358.036) [-360.730] (-366.862) * [-358.338] (-361.260) (-364.576) (-360.627) -- 0:00:38
437000 -- (-363.816) (-359.837) (-363.504) [-366.309] * [-358.050] (-357.297) (-360.557) (-366.922) -- 0:00:38
437500 -- (-362.618) [-359.446] (-359.488) (-356.773) * (-358.393) (-359.839) (-363.015) [-359.174] -- 0:00:38
438000 -- (-361.279) (-359.634) [-358.398] (-357.032) * (-360.765) [-357.524] (-360.235) (-357.812) -- 0:00:38
438500 -- (-357.881) (-359.406) (-357.974) [-358.392] * (-359.852) (-359.930) (-359.080) [-357.259] -- 0:00:38
439000 -- (-359.072) (-361.100) (-358.659) [-358.708] * (-359.738) (-359.305) (-358.545) [-356.918] -- 0:00:38
439500 -- (-357.904) [-357.162] (-357.092) (-361.483) * (-360.111) [-358.767] (-357.499) (-358.693) -- 0:00:38
440000 -- [-363.292] (-357.284) (-356.704) (-360.819) * (-357.926) (-357.483) [-357.002] (-358.152) -- 0:00:38
Average standard deviation of split frequencies: 0.009331
440500 -- [-359.413] (-358.952) (-359.557) (-358.633) * (-364.072) (-358.648) (-356.597) [-360.382] -- 0:00:38
441000 -- [-359.380] (-360.507) (-358.964) (-362.811) * (-360.484) [-361.420] (-356.677) (-359.680) -- 0:00:38
441500 -- (-357.454) [-358.276] (-357.305) (-360.371) * (-357.005) (-362.909) [-357.774] (-357.746) -- 0:00:37
442000 -- (-359.796) (-357.793) [-357.064] (-357.678) * (-357.921) [-361.167] (-361.775) (-357.848) -- 0:00:37
442500 -- (-358.445) (-359.352) [-364.878] (-357.677) * (-357.712) (-364.346) (-357.932) [-358.182] -- 0:00:37
443000 -- (-364.224) (-359.403) (-360.513) [-358.565] * [-357.601] (-360.209) (-357.456) (-360.825) -- 0:00:37
443500 -- (-362.525) (-359.313) (-362.087) [-360.261] * (-358.082) (-361.205) [-357.599] (-359.512) -- 0:00:37
444000 -- (-358.552) [-359.166] (-359.218) (-358.831) * (-357.287) (-357.185) [-358.789] (-357.491) -- 0:00:37
444500 -- (-358.335) (-359.180) (-359.929) [-358.827] * [-358.601] (-357.082) (-357.258) (-359.422) -- 0:00:37
445000 -- (-359.713) (-361.158) (-357.539) [-357.249] * (-357.967) [-357.320] (-364.202) (-359.191) -- 0:00:37
Average standard deviation of split frequencies: 0.009336
445500 -- (-361.862) [-356.912] (-358.333) (-359.089) * (-357.920) (-358.311) [-358.945] (-356.645) -- 0:00:38
446000 -- (-358.992) [-357.710] (-360.478) (-361.033) * (-359.576) [-357.316] (-358.185) (-356.680) -- 0:00:38
446500 -- (-358.259) (-361.543) [-357.680] (-358.679) * (-360.429) (-359.650) [-357.399] (-358.484) -- 0:00:38
447000 -- [-357.904] (-357.162) (-356.534) (-359.645) * (-358.891) (-359.342) [-357.259] (-360.607) -- 0:00:38
447500 -- (-359.161) (-358.782) (-358.482) [-359.313] * [-358.522] (-358.134) (-358.521) (-358.019) -- 0:00:38
448000 -- (-361.675) (-359.057) [-357.232] (-359.738) * [-356.740] (-358.747) (-356.666) (-361.244) -- 0:00:38
448500 -- (-357.790) (-362.862) (-361.332) [-358.156] * (-357.687) (-357.218) [-356.883] (-360.253) -- 0:00:38
449000 -- (-357.060) (-361.189) [-357.388] (-358.042) * [-357.014] (-361.998) (-358.306) (-357.225) -- 0:00:38
449500 -- (-361.645) (-362.882) [-358.727] (-358.545) * (-359.169) [-358.184] (-360.086) (-357.378) -- 0:00:37
450000 -- (-358.839) [-360.463] (-359.489) (-358.177) * (-359.486) (-356.877) (-360.541) [-359.621] -- 0:00:37
Average standard deviation of split frequencies: 0.008676
450500 -- (-358.421) [-359.893] (-357.845) (-357.591) * (-357.395) [-356.729] (-357.454) (-363.590) -- 0:00:37
451000 -- [-359.137] (-358.022) (-357.831) (-357.761) * (-358.219) (-357.513) (-360.943) [-358.290] -- 0:00:37
451500 -- (-358.147) [-358.515] (-358.509) (-357.436) * (-357.341) (-358.316) [-357.733] (-358.544) -- 0:00:37
452000 -- (-357.314) [-358.552] (-360.793) (-356.583) * (-359.185) [-357.333] (-357.243) (-361.822) -- 0:00:37
452500 -- (-359.610) (-359.840) [-357.302] (-359.201) * [-357.150] (-360.060) (-357.143) (-357.430) -- 0:00:37
453000 -- (-359.100) (-360.082) [-359.519] (-360.574) * [-357.902] (-358.550) (-359.839) (-358.481) -- 0:00:37
453500 -- (-356.969) [-362.128] (-360.446) (-360.275) * (-357.420) (-358.212) [-358.116] (-360.232) -- 0:00:37
454000 -- (-356.776) [-358.391] (-357.895) (-361.791) * [-359.087] (-363.034) (-357.675) (-357.988) -- 0:00:37
454500 -- (-357.478) (-361.413) (-357.066) [-363.661] * (-365.162) (-360.542) [-360.827] (-360.209) -- 0:00:37
455000 -- [-360.483] (-362.592) (-359.558) (-358.776) * (-358.680) [-356.589] (-359.730) (-358.072) -- 0:00:37
Average standard deviation of split frequencies: 0.009361
455500 -- (-360.756) [-358.403] (-358.773) (-357.470) * (-360.071) (-359.725) (-361.477) [-358.125] -- 0:00:37
456000 -- (-359.634) [-358.945] (-364.252) (-359.730) * (-357.990) (-357.182) [-365.082] (-357.708) -- 0:00:36
456500 -- (-358.300) (-359.962) (-360.994) [-361.190] * [-356.390] (-358.714) (-360.290) (-359.222) -- 0:00:36
457000 -- (-357.628) [-360.352] (-358.401) (-358.975) * [-359.527] (-362.253) (-358.870) (-357.762) -- 0:00:36
457500 -- (-362.113) [-358.151] (-357.940) (-359.923) * (-359.841) [-358.183] (-356.513) (-360.308) -- 0:00:36
458000 -- [-359.501] (-359.563) (-358.199) (-360.041) * (-359.783) (-359.483) (-356.795) [-359.075] -- 0:00:36
458500 -- (-358.470) (-361.653) (-358.072) [-358.564] * [-358.881] (-357.986) (-357.197) (-357.641) -- 0:00:36
459000 -- [-358.089] (-360.738) (-361.854) (-359.048) * (-358.557) (-359.586) [-360.577] (-358.959) -- 0:00:36
459500 -- (-358.164) [-359.006] (-358.147) (-358.164) * [-357.600] (-363.496) (-357.530) (-358.719) -- 0:00:36
460000 -- (-357.090) [-359.667] (-362.106) (-357.357) * (-358.006) (-357.113) (-358.527) [-358.177] -- 0:00:36
Average standard deviation of split frequencies: 0.009608
460500 -- (-359.632) [-357.965] (-361.791) (-357.083) * (-359.243) (-362.548) [-358.835] (-361.330) -- 0:00:36
461000 -- (-359.178) (-358.566) [-361.819] (-359.703) * [-357.426] (-357.182) (-357.803) (-358.904) -- 0:00:36
461500 -- (-360.292) (-360.614) (-357.140) [-358.264] * (-357.858) (-357.436) (-360.820) [-361.760] -- 0:00:36
462000 -- (-356.826) [-358.428] (-360.484) (-362.198) * (-357.354) [-359.480] (-359.822) (-356.867) -- 0:00:36
462500 -- (-357.582) (-357.538) (-359.679) [-357.394] * (-358.896) [-357.816] (-358.407) (-357.025) -- 0:00:37
463000 -- [-358.146] (-358.622) (-359.935) (-357.639) * (-357.439) (-361.537) (-358.199) [-359.426] -- 0:00:37
463500 -- (-357.720) (-360.126) [-360.273] (-356.891) * (-357.975) (-358.889) [-358.603] (-358.848) -- 0:00:37
464000 -- (-357.322) (-357.979) [-362.890] (-361.521) * (-366.527) (-360.608) [-358.792] (-359.088) -- 0:00:36
464500 -- (-357.913) (-357.702) (-359.698) [-357.269] * [-359.493] (-358.750) (-357.584) (-358.465) -- 0:00:36
465000 -- [-357.064] (-356.724) (-359.702) (-357.467) * (-359.455) [-357.102] (-360.298) (-361.386) -- 0:00:36
Average standard deviation of split frequencies: 0.009584
465500 -- (-357.808) (-356.718) [-359.560] (-359.254) * (-357.784) (-362.424) (-356.849) [-358.757] -- 0:00:36
466000 -- (-359.804) (-357.656) [-357.551] (-357.939) * [-359.815] (-359.698) (-356.818) (-358.256) -- 0:00:36
466500 -- (-357.145) (-360.576) [-357.557] (-357.835) * (-357.846) (-356.800) [-358.092] (-358.368) -- 0:00:36
467000 -- [-358.836] (-357.272) (-358.646) (-361.289) * [-358.695] (-357.252) (-359.434) (-359.098) -- 0:00:36
467500 -- (-356.777) (-362.187) [-356.502] (-359.762) * (-361.526) (-357.310) (-357.849) [-357.162] -- 0:00:36
468000 -- (-359.093) (-357.856) [-357.278] (-359.245) * [-359.698] (-357.971) (-360.702) (-359.659) -- 0:00:36
468500 -- (-361.764) [-358.858] (-359.449) (-358.516) * [-358.404] (-358.273) (-359.356) (-361.471) -- 0:00:36
469000 -- [-358.228] (-358.866) (-361.081) (-358.462) * (-357.855) (-357.336) [-361.759] (-358.975) -- 0:00:36
469500 -- [-357.561] (-360.188) (-361.881) (-362.150) * [-358.673] (-357.376) (-363.926) (-363.280) -- 0:00:36
470000 -- [-357.759] (-359.614) (-360.643) (-360.307) * (-357.589) [-362.401] (-362.053) (-360.402) -- 0:00:36
Average standard deviation of split frequencies: 0.010227
470500 -- (-358.075) (-358.593) [-356.673] (-360.619) * [-360.058] (-359.073) (-358.487) (-357.764) -- 0:00:36
471000 -- (-358.571) (-357.501) (-357.170) [-357.826] * [-360.641] (-359.865) (-357.614) (-358.766) -- 0:00:35
471500 -- [-357.379] (-358.639) (-358.118) (-356.795) * (-360.080) (-357.095) [-357.508] (-362.854) -- 0:00:35
472000 -- (-357.974) (-361.598) (-357.553) [-356.844] * (-358.967) (-356.958) [-359.190] (-359.857) -- 0:00:35
472500 -- (-360.927) (-362.867) (-358.461) [-357.247] * (-361.456) [-356.832] (-359.952) (-359.506) -- 0:00:35
473000 -- (-359.485) (-364.251) [-360.796] (-357.145) * [-358.696] (-357.619) (-357.334) (-357.466) -- 0:00:35
473500 -- (-357.395) (-358.397) (-358.486) [-359.326] * [-362.051] (-362.204) (-357.578) (-357.021) -- 0:00:35
474000 -- [-360.591] (-358.540) (-358.703) (-357.654) * (-359.705) (-358.866) [-359.571] (-360.537) -- 0:00:35
474500 -- (-358.965) (-359.302) (-357.213) [-357.534] * (-357.764) (-362.887) (-360.348) [-357.711] -- 0:00:35
475000 -- (-359.126) [-360.859] (-357.973) (-357.241) * [-356.517] (-364.684) (-356.385) (-359.680) -- 0:00:35
Average standard deviation of split frequencies: 0.010253
475500 -- (-361.100) (-360.137) (-356.686) [-359.421] * [-356.299] (-356.902) (-359.691) (-360.006) -- 0:00:35
476000 -- (-363.012) (-360.916) [-360.287] (-359.189) * (-356.883) (-357.054) [-358.980] (-359.757) -- 0:00:35
476500 -- (-358.152) (-358.952) [-359.300] (-357.871) * [-358.467] (-357.444) (-357.045) (-358.375) -- 0:00:35
477000 -- (-358.697) (-358.132) [-358.141] (-360.328) * (-359.138) (-357.103) (-360.016) [-359.878] -- 0:00:35
477500 -- (-357.043) [-358.362] (-358.162) (-359.706) * (-359.300) (-357.983) (-363.332) [-360.546] -- 0:00:35
478000 -- (-360.399) (-357.616) (-357.930) [-362.610] * (-361.839) (-358.951) (-357.049) [-358.116] -- 0:00:34
478500 -- [-358.809] (-360.275) (-358.786) (-358.177) * (-362.071) (-358.980) (-358.020) [-358.080] -- 0:00:34
479000 -- [-358.808] (-359.092) (-356.800) (-360.753) * (-357.846) (-356.923) (-360.916) [-360.279] -- 0:00:34
479500 -- (-359.839) (-357.082) [-358.790] (-360.320) * [-357.699] (-358.260) (-358.395) (-359.467) -- 0:00:35
480000 -- [-357.025] (-357.946) (-356.959) (-364.377) * (-357.744) [-357.154] (-358.693) (-357.791) -- 0:00:35
Average standard deviation of split frequencies: 0.010269
480500 -- (-361.239) [-357.445] (-357.308) (-365.937) * (-359.528) (-359.169) [-359.664] (-359.627) -- 0:00:35
481000 -- [-360.735] (-359.508) (-361.297) (-357.004) * (-359.376) (-359.342) (-358.409) [-361.733] -- 0:00:35
481500 -- (-358.573) [-356.943] (-358.800) (-363.266) * (-359.963) (-359.322) [-359.586] (-357.805) -- 0:00:35
482000 -- (-356.570) [-359.625] (-359.047) (-358.886) * [-360.348] (-370.605) (-359.310) (-357.700) -- 0:00:35
482500 -- (-358.007) (-358.480) [-358.557] (-357.748) * (-357.498) [-359.007] (-361.806) (-359.955) -- 0:00:35
483000 -- [-357.809] (-363.293) (-358.404) (-358.116) * (-361.044) [-359.143] (-357.464) (-361.023) -- 0:00:35
483500 -- [-358.421] (-360.513) (-356.464) (-356.565) * [-359.734] (-358.119) (-357.306) (-357.389) -- 0:00:35
484000 -- (-358.743) (-360.096) [-359.025] (-363.760) * [-359.611] (-358.532) (-358.109) (-358.639) -- 0:00:35
484500 -- [-359.852] (-358.145) (-357.624) (-370.422) * (-359.134) (-358.035) [-359.118] (-357.773) -- 0:00:35
485000 -- (-365.243) (-358.657) [-357.448] (-358.903) * (-357.894) [-359.559] (-360.850) (-357.711) -- 0:00:35
Average standard deviation of split frequencies: 0.010556
485500 -- [-360.148] (-358.025) (-359.309) (-358.347) * [-359.449] (-358.832) (-361.510) (-358.834) -- 0:00:34
486000 -- (-360.108) (-356.345) [-357.794] (-360.367) * (-358.234) (-358.496) (-360.295) [-360.005] -- 0:00:34
486500 -- (-358.792) (-357.895) [-360.651] (-361.695) * (-363.757) (-360.339) [-358.370] (-359.964) -- 0:00:34
487000 -- (-361.627) (-359.421) (-362.105) [-360.375] * (-363.731) (-357.743) (-358.509) [-359.294] -- 0:00:34
487500 -- (-357.945) (-361.190) (-363.481) [-357.198] * (-357.640) (-359.587) [-357.257] (-359.368) -- 0:00:34
488000 -- (-358.521) (-358.810) (-358.880) [-358.896] * (-359.960) (-358.419) [-357.667] (-359.286) -- 0:00:34
488500 -- (-360.411) (-356.860) (-362.627) [-357.605] * [-359.306] (-359.386) (-359.063) (-359.429) -- 0:00:34
489000 -- (-357.440) [-357.463] (-362.739) (-357.654) * [-358.799] (-360.141) (-359.946) (-358.314) -- 0:00:34
489500 -- (-360.532) (-356.873) (-362.124) [-358.565] * [-358.069] (-359.376) (-357.461) (-363.295) -- 0:00:34
490000 -- (-357.421) (-357.933) (-361.869) [-357.802] * [-358.935] (-357.704) (-357.726) (-359.672) -- 0:00:34
Average standard deviation of split frequencies: 0.010625
490500 -- [-363.467] (-359.821) (-358.945) (-358.474) * (-358.633) (-359.900) (-362.661) [-360.938] -- 0:00:34
491000 -- (-358.964) (-359.232) (-358.121) [-359.692] * (-357.827) (-357.917) [-356.604] (-358.100) -- 0:00:34
491500 -- (-359.981) [-361.806] (-357.199) (-358.347) * (-359.829) [-357.592] (-356.995) (-362.038) -- 0:00:34
492000 -- (-361.722) [-356.563] (-359.309) (-359.028) * (-357.929) (-359.898) (-360.379) [-357.490] -- 0:00:34
492500 -- (-360.479) [-362.608] (-361.301) (-360.309) * (-360.451) (-360.948) (-357.533) [-357.261] -- 0:00:34
493000 -- (-360.684) [-359.191] (-357.876) (-359.088) * [-360.783] (-357.960) (-359.846) (-359.091) -- 0:00:33
493500 -- [-358.597] (-359.296) (-357.669) (-360.838) * (-362.078) (-359.987) [-358.125] (-358.634) -- 0:00:33
494000 -- (-358.606) [-359.068] (-357.489) (-360.332) * (-357.497) [-357.288] (-357.477) (-358.346) -- 0:00:33
494500 -- (-360.254) (-357.584) [-358.338] (-360.207) * (-358.435) [-359.964] (-362.031) (-357.514) -- 0:00:33
495000 -- [-359.325] (-360.708) (-359.225) (-360.785) * (-358.450) [-356.635] (-360.380) (-357.689) -- 0:00:33
Average standard deviation of split frequencies: 0.010276
495500 -- (-358.252) (-360.278) (-358.564) [-358.910] * (-362.483) (-357.406) [-357.414] (-357.872) -- 0:00:33
496000 -- [-357.488] (-359.847) (-359.585) (-358.906) * [-357.183] (-359.363) (-358.857) (-358.775) -- 0:00:33
496500 -- (-357.539) [-358.137] (-357.789) (-358.966) * [-359.283] (-359.413) (-358.053) (-358.350) -- 0:00:34
497000 -- (-359.800) (-360.319) [-357.311] (-357.915) * [-363.478] (-358.396) (-358.995) (-358.655) -- 0:00:34
497500 -- (-358.400) (-360.107) [-358.299] (-359.819) * [-361.239] (-359.683) (-360.300) (-360.728) -- 0:00:34
498000 -- (-361.334) (-360.896) [-359.318] (-361.498) * (-359.937) (-357.305) [-358.978] (-358.939) -- 0:00:34
498500 -- (-358.180) [-358.913] (-360.329) (-359.389) * (-360.027) [-360.865] (-360.557) (-358.052) -- 0:00:34
499000 -- (-356.820) (-359.422) (-358.107) [-357.490] * (-358.864) (-358.791) (-357.192) [-357.882] -- 0:00:34
499500 -- (-358.172) [-359.259] (-358.739) (-359.016) * (-358.230) (-357.728) [-360.059] (-358.920) -- 0:00:34
500000 -- (-357.819) (-358.389) (-359.717) [-356.553] * (-357.130) (-363.112) (-358.337) [-361.209] -- 0:00:34
Average standard deviation of split frequencies: 0.010710
500500 -- (-358.321) (-357.893) [-357.395] (-359.518) * (-360.628) [-357.674] (-358.731) (-359.085) -- 0:00:33
501000 -- (-359.224) (-357.762) (-358.903) [-357.864] * [-360.749] (-357.853) (-357.710) (-361.872) -- 0:00:33
501500 -- (-360.302) (-356.994) [-357.176] (-359.177) * (-356.453) (-359.600) (-357.352) [-360.303] -- 0:00:33
502000 -- (-357.364) (-360.892) (-358.749) [-358.171] * (-358.271) [-358.837] (-361.584) (-358.478) -- 0:00:33
502500 -- (-357.169) [-357.965] (-361.283) (-361.206) * (-357.395) (-359.455) [-359.644] (-358.114) -- 0:00:33
503000 -- [-361.528] (-358.068) (-360.626) (-358.104) * (-357.416) (-358.579) (-358.965) [-362.602] -- 0:00:33
503500 -- (-359.100) [-357.679] (-361.377) (-358.241) * (-359.617) (-358.043) [-360.250] (-360.597) -- 0:00:33
504000 -- (-359.795) [-360.270] (-359.116) (-357.246) * (-359.759) (-357.332) [-360.024] (-358.599) -- 0:00:33
504500 -- (-357.961) (-362.169) [-357.375] (-357.612) * (-359.038) [-357.675] (-364.267) (-356.886) -- 0:00:33
505000 -- (-358.209) [-358.613] (-357.009) (-358.330) * (-358.335) (-358.916) [-356.654] (-360.067) -- 0:00:33
Average standard deviation of split frequencies: 0.010522
505500 -- (-357.458) (-358.005) (-359.220) [-359.137] * (-361.569) (-358.362) (-357.507) [-361.031] -- 0:00:33
506000 -- [-357.847] (-357.653) (-359.536) (-358.935) * (-359.361) [-359.205] (-357.338) (-362.085) -- 0:00:33
506500 -- (-359.446) [-359.562] (-360.487) (-363.524) * (-358.260) (-360.695) (-362.413) [-356.389] -- 0:00:33
507000 -- (-359.663) (-359.339) (-363.233) [-357.169] * [-357.891] (-360.006) (-358.412) (-358.608) -- 0:00:33
507500 -- (-362.238) [-358.829] (-362.095) (-357.049) * (-362.605) [-358.838] (-358.381) (-361.685) -- 0:00:32
508000 -- (-359.710) (-359.357) [-360.212] (-356.596) * (-359.204) (-372.036) (-358.950) [-360.316] -- 0:00:32
508500 -- (-358.879) [-360.331] (-358.333) (-356.749) * (-357.703) [-359.170] (-359.404) (-362.081) -- 0:00:32
509000 -- (-359.788) (-358.196) (-359.253) [-356.804] * (-357.516) [-358.907] (-357.624) (-361.705) -- 0:00:32
509500 -- (-359.568) [-357.561] (-360.887) (-361.067) * (-359.183) (-360.884) [-357.403] (-360.618) -- 0:00:32
510000 -- (-359.645) (-357.183) (-357.696) [-359.602] * [-358.940] (-356.825) (-357.409) (-359.024) -- 0:00:32
Average standard deviation of split frequencies: 0.010209
510500 -- (-361.318) (-358.948) (-360.156) [-357.605] * (-357.565) [-356.821] (-357.557) (-360.865) -- 0:00:32
511000 -- (-358.189) (-358.262) [-357.411] (-361.724) * [-357.578] (-362.738) (-357.247) (-357.347) -- 0:00:32
511500 -- [-357.899] (-362.743) (-361.141) (-357.172) * [-357.562] (-359.672) (-360.384) (-357.037) -- 0:00:32
512000 -- (-358.745) (-363.521) [-357.073] (-358.829) * (-359.337) (-357.231) [-358.681] (-358.221) -- 0:00:32
512500 -- (-357.958) (-356.546) [-358.232] (-359.047) * (-357.305) (-358.179) [-357.871] (-357.484) -- 0:00:32
513000 -- [-358.687] (-359.854) (-358.553) (-359.321) * (-358.747) [-356.650] (-360.038) (-356.992) -- 0:00:33
513500 -- [-359.317] (-358.217) (-360.156) (-358.833) * (-358.773) [-362.084] (-359.095) (-358.008) -- 0:00:33
514000 -- (-358.061) [-359.111] (-361.421) (-358.676) * [-358.368] (-359.892) (-357.337) (-357.182) -- 0:00:33
514500 -- (-358.741) [-359.677] (-360.178) (-357.910) * (-358.736) (-361.582) [-358.505] (-357.456) -- 0:00:33
515000 -- (-361.662) (-359.199) (-360.184) [-356.887] * [-358.485] (-362.086) (-360.141) (-357.205) -- 0:00:32
Average standard deviation of split frequencies: 0.009834
515500 -- (-361.391) (-359.760) [-356.662] (-357.316) * [-359.939] (-361.494) (-361.963) (-358.949) -- 0:00:32
516000 -- (-363.053) (-358.918) [-358.277] (-356.848) * [-357.505] (-358.467) (-359.474) (-357.671) -- 0:00:32
516500 -- (-359.461) (-362.353) (-360.417) [-360.253] * (-358.572) [-357.979] (-358.859) (-357.343) -- 0:00:32
517000 -- (-358.230) (-360.666) [-360.397] (-358.286) * (-358.170) (-358.619) [-359.989] (-359.233) -- 0:00:32
517500 -- (-359.747) [-357.619] (-359.797) (-361.221) * (-359.192) (-361.153) (-357.940) [-357.280] -- 0:00:32
518000 -- (-358.431) (-357.663) [-359.340] (-360.197) * (-361.247) (-361.284) [-357.947] (-362.830) -- 0:00:32
518500 -- (-359.632) (-358.674) [-359.651] (-360.225) * [-358.801] (-358.448) (-361.404) (-361.089) -- 0:00:32
519000 -- (-357.738) [-358.209] (-358.272) (-358.389) * (-358.468) (-361.212) (-358.008) [-362.432] -- 0:00:32
519500 -- (-358.854) (-358.478) [-358.985] (-361.328) * (-357.084) [-361.117] (-357.462) (-365.392) -- 0:00:32
520000 -- (-356.669) [-358.040] (-359.769) (-359.443) * (-356.998) (-359.913) (-359.821) [-364.305] -- 0:00:32
Average standard deviation of split frequencies: 0.009906
520500 -- (-358.324) [-358.915] (-357.369) (-358.650) * (-356.597) (-359.577) [-358.742] (-362.443) -- 0:00:32
521000 -- (-360.575) (-358.006) [-356.864] (-356.905) * (-359.457) [-358.233] (-358.721) (-359.770) -- 0:00:32
521500 -- (-358.653) [-356.777] (-358.778) (-358.795) * [-357.744] (-356.850) (-359.561) (-356.952) -- 0:00:32
522000 -- (-357.515) [-358.164] (-358.619) (-359.317) * (-358.890) [-357.247] (-358.344) (-360.554) -- 0:00:32
522500 -- [-358.162] (-357.096) (-357.917) (-361.620) * [-359.690] (-357.394) (-360.614) (-358.669) -- 0:00:31
523000 -- (-358.729) (-358.527) (-357.181) [-357.322] * (-357.385) [-358.762] (-358.346) (-359.151) -- 0:00:31
523500 -- [-359.363] (-357.233) (-360.619) (-358.394) * (-361.855) (-358.726) [-360.457] (-357.713) -- 0:00:31
524000 -- (-357.885) (-359.957) (-360.365) [-359.037] * (-360.993) [-359.012] (-357.867) (-357.946) -- 0:00:31
524500 -- (-356.718) (-362.806) (-357.901) [-358.509] * (-359.196) [-357.198] (-357.010) (-357.745) -- 0:00:31
525000 -- [-357.695] (-362.052) (-359.016) (-360.944) * (-358.761) (-358.635) [-359.863] (-357.631) -- 0:00:31
Average standard deviation of split frequencies: 0.010605
525500 -- (-357.139) (-357.772) [-358.790] (-358.250) * (-359.080) (-356.984) (-360.315) [-358.357] -- 0:00:31
526000 -- (-358.363) [-358.268] (-360.556) (-358.040) * [-359.646] (-357.935) (-357.289) (-359.609) -- 0:00:31
526500 -- (-357.545) [-359.656] (-360.428) (-356.843) * (-358.705) [-359.882] (-359.733) (-359.481) -- 0:00:31
527000 -- (-357.624) [-358.809] (-358.199) (-358.462) * (-359.053) [-357.054] (-361.870) (-357.167) -- 0:00:31
527500 -- (-358.846) (-359.402) (-357.662) [-357.994] * (-357.716) (-357.653) (-361.758) [-357.433] -- 0:00:31
528000 -- [-358.912] (-361.594) (-361.630) (-358.155) * [-360.029] (-358.726) (-357.709) (-361.502) -- 0:00:31
528500 -- (-357.596) (-361.336) [-357.747] (-356.801) * [-358.338] (-359.962) (-360.225) (-358.811) -- 0:00:31
529000 -- (-357.819) (-360.590) [-356.822] (-358.878) * (-360.232) (-358.875) (-366.323) [-358.405] -- 0:00:31
529500 -- (-363.090) (-358.601) (-356.836) [-359.421] * (-360.997) [-356.807] (-364.300) (-361.341) -- 0:00:31
530000 -- (-361.725) (-360.364) [-358.405] (-360.000) * (-358.289) (-359.407) (-360.755) [-359.188] -- 0:00:31
Average standard deviation of split frequencies: 0.010956
530500 -- (-359.712) (-358.317) (-358.733) [-358.029] * (-358.061) [-357.275] (-361.840) (-357.111) -- 0:00:31
531000 -- (-358.047) [-359.746] (-360.022) (-358.759) * (-362.008) (-357.062) [-358.604] (-357.651) -- 0:00:31
531500 -- (-360.322) [-357.083] (-358.251) (-360.928) * (-359.762) [-356.961] (-361.298) (-356.968) -- 0:00:31
532000 -- [-359.221] (-359.074) (-359.763) (-360.303) * (-359.575) (-357.399) [-359.302] (-358.430) -- 0:00:31
532500 -- (-358.196) (-358.182) (-358.383) [-359.859] * (-356.685) (-359.355) [-356.824] (-357.584) -- 0:00:31
533000 -- (-358.714) [-360.190] (-359.449) (-356.631) * (-360.215) (-357.455) [-356.698] (-357.776) -- 0:00:31
533500 -- (-362.994) (-358.432) (-357.409) [-359.415] * (-362.863) [-356.783] (-363.483) (-358.543) -- 0:00:31
534000 -- (-357.051) (-358.726) (-357.407) [-358.491] * (-357.565) (-357.054) [-360.269] (-357.807) -- 0:00:31
534500 -- (-357.099) [-357.257] (-359.356) (-359.548) * (-360.933) [-360.382] (-358.444) (-359.661) -- 0:00:31
535000 -- [-356.602] (-356.919) (-360.685) (-358.281) * [-357.851] (-358.034) (-357.756) (-361.400) -- 0:00:31
Average standard deviation of split frequencies: 0.010749
535500 -- [-357.989] (-357.220) (-359.830) (-358.113) * (-358.563) [-356.881] (-359.177) (-358.454) -- 0:00:31
536000 -- [-359.482] (-357.287) (-357.835) (-359.964) * (-358.495) [-360.483] (-357.835) (-359.087) -- 0:00:31
536500 -- (-358.650) [-357.310] (-361.790) (-361.224) * (-364.273) (-359.131) [-357.777] (-358.654) -- 0:00:31
537000 -- (-358.570) (-356.451) (-357.908) [-359.973] * (-359.907) (-360.899) [-357.130] (-361.878) -- 0:00:31
537500 -- (-357.926) [-363.999] (-357.118) (-358.822) * [-358.563] (-358.858) (-359.657) (-357.725) -- 0:00:30
538000 -- (-357.159) (-362.859) (-358.866) [-359.181] * (-357.403) (-359.361) [-359.446] (-359.464) -- 0:00:30
538500 -- (-362.373) [-360.263] (-359.584) (-363.878) * [-357.544] (-361.166) (-358.887) (-360.587) -- 0:00:30
539000 -- [-357.979] (-359.369) (-361.883) (-363.641) * [-357.565] (-358.000) (-359.356) (-358.181) -- 0:00:30
539500 -- (-358.156) (-358.145) (-363.273) [-358.610] * (-356.995) [-358.226] (-357.815) (-360.035) -- 0:00:30
540000 -- (-357.565) [-359.972] (-361.279) (-356.582) * (-359.987) (-357.553) [-358.487] (-357.790) -- 0:00:30
Average standard deviation of split frequencies: 0.010511
540500 -- (-357.230) (-357.213) (-358.757) [-359.042] * (-357.557) [-358.658] (-361.277) (-359.496) -- 0:00:30
541000 -- (-357.927) (-356.930) [-359.306] (-360.550) * (-358.468) (-356.996) [-360.857] (-358.818) -- 0:00:30
541500 -- (-357.863) (-358.498) [-365.041] (-358.455) * (-361.179) (-357.455) [-357.867] (-361.783) -- 0:00:30
542000 -- (-359.108) (-359.064) (-360.347) [-356.915] * (-364.276) [-357.129] (-357.942) (-360.182) -- 0:00:30
542500 -- [-359.246] (-360.889) (-360.946) (-358.141) * (-357.814) (-357.941) [-358.586] (-358.366) -- 0:00:30
543000 -- [-360.525] (-359.387) (-361.985) (-359.261) * (-357.299) [-358.717] (-358.666) (-356.786) -- 0:00:30
543500 -- (-357.131) (-358.319) (-364.583) [-360.571] * (-358.001) [-360.221] (-359.355) (-357.798) -- 0:00:30
544000 -- (-357.705) (-360.535) [-358.622] (-358.482) * (-359.639) (-357.732) [-356.743] (-357.602) -- 0:00:31
544500 -- (-357.444) (-360.399) [-357.013] (-357.384) * (-357.858) [-358.899] (-360.953) (-359.777) -- 0:00:30
545000 -- (-358.966) (-361.553) [-357.378] (-360.947) * (-359.481) [-356.739] (-357.718) (-358.039) -- 0:00:30
Average standard deviation of split frequencies: 0.010504
545500 -- (-358.871) (-359.762) [-360.366] (-358.344) * (-361.117) (-359.415) (-358.438) [-358.117] -- 0:00:30
546000 -- (-358.319) (-358.254) [-357.697] (-360.696) * (-357.427) (-357.259) (-359.341) [-358.717] -- 0:00:30
546500 -- (-358.634) (-360.037) (-358.374) [-359.188] * [-358.116] (-360.340) (-357.998) (-357.019) -- 0:00:30
547000 -- (-356.492) (-357.837) [-359.495] (-357.245) * [-357.836] (-357.724) (-359.370) (-358.823) -- 0:00:30
547500 -- [-356.858] (-362.120) (-358.468) (-357.315) * (-356.743) (-357.625) (-358.783) [-358.601] -- 0:00:30
548000 -- (-356.660) (-364.504) (-359.517) [-358.087] * (-360.356) [-357.963] (-359.276) (-356.803) -- 0:00:30
548500 -- (-357.649) (-362.198) (-358.434) [-359.848] * [-358.258] (-356.691) (-361.563) (-358.567) -- 0:00:30
549000 -- [-357.697] (-365.936) (-358.955) (-358.963) * (-357.961) (-357.998) [-357.847] (-357.210) -- 0:00:30
549500 -- (-360.225) [-359.844] (-356.452) (-357.703) * (-362.891) (-357.692) (-357.453) [-359.408] -- 0:00:30
550000 -- (-356.897) (-357.873) [-356.755] (-359.861) * (-359.345) [-356.833] (-359.629) (-358.325) -- 0:00:30
Average standard deviation of split frequencies: 0.009512
550500 -- (-357.296) [-357.346] (-362.698) (-359.419) * (-361.047) (-358.625) [-359.208] (-359.643) -- 0:00:30
551000 -- (-359.526) [-359.811] (-362.715) (-359.435) * (-359.993) [-358.863] (-358.496) (-360.913) -- 0:00:30
551500 -- (-358.281) (-365.480) [-359.103] (-357.023) * [-359.691] (-361.158) (-358.943) (-358.584) -- 0:00:30
552000 -- (-358.262) (-360.376) [-357.600] (-358.206) * (-359.744) (-360.690) [-357.481] (-360.744) -- 0:00:30
552500 -- (-360.231) (-359.369) (-359.815) [-358.469] * (-364.440) (-358.226) [-358.984] (-359.008) -- 0:00:29
553000 -- (-358.062) [-358.706] (-357.373) (-356.923) * (-356.292) [-357.077] (-361.154) (-362.110) -- 0:00:29
553500 -- (-357.467) [-358.706] (-359.847) (-357.853) * (-358.910) (-358.574) [-356.814] (-363.634) -- 0:00:29
554000 -- [-357.632] (-357.114) (-358.141) (-358.805) * (-358.404) [-361.936] (-356.819) (-363.029) -- 0:00:29
554500 -- (-360.984) (-356.957) (-358.400) [-362.922] * (-358.112) (-359.391) (-357.465) [-358.848] -- 0:00:29
555000 -- (-359.848) [-359.236] (-365.816) (-357.015) * [-357.809] (-364.136) (-357.209) (-361.211) -- 0:00:29
Average standard deviation of split frequencies: 0.009426
555500 -- (-357.595) (-358.482) [-361.958] (-356.712) * [-357.860] (-361.629) (-366.846) (-357.382) -- 0:00:29
556000 -- (-357.794) (-359.228) (-362.885) [-360.455] * (-357.812) [-357.742] (-365.334) (-357.705) -- 0:00:29
556500 -- (-357.075) (-359.145) [-357.098] (-364.886) * (-358.107) (-361.039) (-360.532) [-360.318] -- 0:00:29
557000 -- (-356.707) (-357.647) [-359.035] (-359.368) * [-357.256] (-362.832) (-362.847) (-359.487) -- 0:00:29
557500 -- (-356.489) [-358.151] (-359.609) (-358.624) * (-357.642) (-361.216) (-365.419) [-358.733] -- 0:00:29
558000 -- [-357.191] (-358.318) (-357.975) (-360.515) * [-357.724] (-363.524) (-358.937) (-361.118) -- 0:00:29
558500 -- [-359.288] (-357.013) (-356.397) (-360.323) * (-357.976) (-360.589) (-359.401) [-358.226] -- 0:00:29
559000 -- (-358.331) (-358.773) (-357.437) [-358.850] * (-356.966) (-357.294) [-357.306] (-357.645) -- 0:00:29
559500 -- (-357.984) [-360.465] (-357.777) (-360.946) * [-360.359] (-360.284) (-357.945) (-361.613) -- 0:00:29
560000 -- (-360.729) [-358.668] (-357.011) (-363.539) * (-359.744) (-360.811) (-362.165) [-356.993] -- 0:00:29
Average standard deviation of split frequencies: 0.008952
560500 -- (-358.875) (-358.205) (-357.972) [-357.921] * (-358.146) [-359.513] (-360.503) (-362.821) -- 0:00:29
561000 -- (-356.939) (-359.874) [-359.060] (-360.257) * [-357.168] (-356.774) (-358.144) (-362.029) -- 0:00:29
561500 -- (-357.892) (-362.278) (-360.983) [-357.283] * (-358.982) (-358.632) [-359.305] (-356.953) -- 0:00:29
562000 -- (-356.940) (-358.559) (-357.680) [-358.617] * [-358.858] (-357.968) (-356.569) (-360.391) -- 0:00:29
562500 -- [-361.653] (-361.350) (-358.833) (-357.338) * (-360.838) [-357.326] (-360.201) (-360.370) -- 0:00:29
563000 -- (-362.182) [-358.443] (-357.589) (-360.953) * (-359.589) (-356.700) (-361.124) [-358.668] -- 0:00:29
563500 -- (-360.037) (-359.503) (-357.305) [-360.471] * [-359.766] (-361.554) (-358.006) (-362.059) -- 0:00:29
564000 -- [-363.377] (-358.879) (-361.568) (-360.062) * (-361.954) [-357.516] (-358.766) (-365.836) -- 0:00:29
564500 -- [-356.655] (-357.482) (-359.425) (-359.887) * (-362.144) [-357.649] (-358.188) (-358.907) -- 0:00:29
565000 -- (-356.963) [-358.743] (-359.713) (-361.105) * (-358.223) [-357.670] (-356.700) (-358.643) -- 0:00:29
Average standard deviation of split frequencies: 0.009300
565500 -- [-357.089] (-359.154) (-358.916) (-359.129) * (-364.690) (-361.665) [-357.200] (-362.910) -- 0:00:29
566000 -- (-358.568) [-360.919] (-358.852) (-357.167) * (-360.852) (-356.945) [-357.023] (-359.025) -- 0:00:29
566500 -- [-359.258] (-357.135) (-357.248) (-359.628) * (-360.360) [-358.893] (-356.895) (-358.319) -- 0:00:29
567000 -- (-359.156) (-358.316) [-358.182] (-358.915) * (-361.334) (-362.313) [-357.360] (-362.795) -- 0:00:29
567500 -- (-358.994) (-358.739) [-358.796] (-363.575) * [-358.978] (-363.694) (-358.859) (-361.863) -- 0:00:28
568000 -- (-360.823) (-357.303) [-358.013] (-358.475) * (-358.092) (-361.909) [-361.144] (-358.488) -- 0:00:28
568500 -- (-358.337) (-359.087) (-358.172) [-358.475] * (-358.851) [-359.258] (-359.808) (-357.801) -- 0:00:28
569000 -- [-359.329] (-362.055) (-359.104) (-357.102) * (-356.949) (-357.331) (-358.377) [-358.556] -- 0:00:28
569500 -- [-358.844] (-357.296) (-357.916) (-357.152) * [-364.636] (-362.569) (-357.294) (-359.139) -- 0:00:28
570000 -- (-362.910) (-359.118) (-359.404) [-361.565] * (-358.349) [-359.679] (-359.323) (-362.067) -- 0:00:28
Average standard deviation of split frequencies: 0.009959
570500 -- (-359.442) (-359.314) (-356.985) [-357.987] * (-358.985) (-358.535) (-357.364) [-358.817] -- 0:00:28
571000 -- (-357.722) [-358.581] (-358.175) (-358.984) * (-359.928) [-359.820] (-357.617) (-363.644) -- 0:00:28
571500 -- (-356.924) [-357.629] (-358.341) (-357.922) * [-359.447] (-361.711) (-360.245) (-360.126) -- 0:00:28
572000 -- (-360.771) [-360.749] (-358.520) (-362.698) * (-357.239) (-360.140) (-359.929) [-357.856] -- 0:00:28
572500 -- (-357.138) [-357.667] (-362.147) (-358.716) * (-359.919) (-358.029) (-361.592) [-357.934] -- 0:00:28
573000 -- [-358.351] (-357.737) (-357.740) (-358.696) * (-358.811) (-361.518) (-358.309) [-363.480] -- 0:00:28
573500 -- [-358.019] (-357.463) (-359.882) (-359.003) * (-359.039) (-359.797) (-359.065) [-356.866] -- 0:00:28
574000 -- (-360.735) [-357.630] (-356.530) (-359.126) * [-358.318] (-359.266) (-357.979) (-359.033) -- 0:00:28
574500 -- (-359.911) (-358.117) [-358.821] (-358.831) * (-357.073) [-358.810] (-360.053) (-358.057) -- 0:00:28
575000 -- (-358.805) [-358.619] (-359.571) (-359.854) * [-358.454] (-356.513) (-361.982) (-358.351) -- 0:00:28
Average standard deviation of split frequencies: 0.009821
575500 -- (-358.771) [-357.049] (-356.604) (-361.934) * [-357.632] (-365.811) (-365.328) (-357.911) -- 0:00:28
576000 -- (-357.770) [-361.374] (-357.693) (-362.711) * (-357.968) (-359.485) (-362.162) [-358.785] -- 0:00:27
576500 -- (-358.097) (-357.192) (-360.868) [-357.193] * (-363.089) [-359.199] (-357.836) (-356.955) -- 0:00:28
577000 -- (-358.097) (-361.009) (-358.324) [-357.314] * (-363.791) [-359.140] (-360.066) (-357.753) -- 0:00:28
577500 -- (-358.670) [-357.321] (-356.459) (-357.450) * [-361.511] (-359.133) (-357.781) (-360.262) -- 0:00:28
578000 -- (-356.535) (-361.464) (-357.470) [-359.036] * [-357.575] (-359.004) (-359.728) (-357.819) -- 0:00:28
578500 -- (-358.581) [-359.975] (-357.826) (-357.146) * (-359.402) [-359.729] (-357.375) (-357.323) -- 0:00:28
579000 -- (-358.495) (-358.064) (-357.041) [-357.883] * (-356.949) (-357.754) [-360.614] (-362.467) -- 0:00:28
579500 -- (-356.880) (-357.274) (-358.136) [-358.002] * (-358.096) [-358.529] (-360.006) (-359.818) -- 0:00:28
580000 -- (-357.769) [-359.525] (-356.893) (-357.064) * (-361.977) (-358.510) (-358.492) [-362.109] -- 0:00:28
Average standard deviation of split frequencies: 0.009652
580500 -- (-356.707) (-359.946) (-362.476) [-358.326] * (-359.622) (-359.108) [-359.443] (-361.469) -- 0:00:28
581000 -- (-361.661) (-359.893) (-357.241) [-358.942] * [-359.780] (-360.010) (-357.361) (-358.825) -- 0:00:28
581500 -- [-358.399] (-359.329) (-358.810) (-360.505) * (-359.402) (-359.140) [-357.049] (-360.687) -- 0:00:28
582000 -- (-357.408) (-361.128) [-361.102] (-359.306) * [-359.035] (-359.660) (-358.332) (-360.055) -- 0:00:28
582500 -- (-360.521) (-359.402) (-358.628) [-361.270] * [-360.167] (-358.266) (-361.093) (-357.326) -- 0:00:27
583000 -- (-363.529) (-358.271) (-358.599) [-358.574] * (-359.256) (-359.988) [-360.537] (-356.932) -- 0:00:27
583500 -- [-360.143] (-357.061) (-360.837) (-356.542) * (-356.881) (-361.086) (-360.074) [-356.938] -- 0:00:27
584000 -- (-359.172) (-357.090) [-361.175] (-356.789) * [-361.531] (-359.805) (-358.799) (-359.449) -- 0:00:27
584500 -- (-359.447) (-360.164) [-358.450] (-357.321) * (-363.253) (-358.968) [-359.782] (-360.362) -- 0:00:27
585000 -- (-363.191) (-358.189) (-357.721) [-356.825] * (-360.768) (-359.622) [-357.430] (-361.097) -- 0:00:27
Average standard deviation of split frequencies: 0.009117
585500 -- (-359.832) (-358.949) (-358.122) [-356.579] * (-357.769) (-360.367) (-357.461) [-360.178] -- 0:00:27
586000 -- (-359.013) (-359.391) [-358.782] (-359.996) * (-359.514) [-358.477] (-358.040) (-358.749) -- 0:00:27
586500 -- (-359.159) [-358.105] (-357.074) (-363.233) * (-359.339) (-356.715) [-357.238] (-362.544) -- 0:00:27
587000 -- (-357.412) (-356.880) (-359.331) [-363.131] * (-361.401) [-360.008] (-357.146) (-359.928) -- 0:00:27
587500 -- [-359.627] (-359.066) (-361.901) (-357.899) * (-358.682) [-359.167] (-358.200) (-359.457) -- 0:00:27
588000 -- (-356.741) (-359.242) (-361.894) [-360.307] * (-366.166) (-358.304) (-362.663) [-357.902] -- 0:00:27
588500 -- [-359.112] (-356.997) (-359.381) (-358.594) * (-362.450) [-356.803] (-358.338) (-358.532) -- 0:00:27
589000 -- (-358.608) (-358.396) (-358.321) [-356.592] * (-356.501) (-359.907) (-356.743) [-356.755] -- 0:00:27
589500 -- (-360.201) (-361.166) (-360.851) [-358.284] * [-359.051] (-357.491) (-356.728) (-357.755) -- 0:00:27
590000 -- [-359.112] (-360.671) (-360.828) (-357.809) * (-356.809) (-360.339) (-360.645) [-358.568] -- 0:00:27
Average standard deviation of split frequencies: 0.008912
590500 -- (-358.770) (-358.342) [-358.445] (-357.457) * (-363.053) [-358.388] (-359.855) (-357.198) -- 0:00:27
591000 -- (-357.730) (-359.036) [-358.167] (-357.728) * (-360.072) [-356.338] (-357.308) (-359.332) -- 0:00:26
591500 -- (-357.746) [-359.265] (-359.020) (-359.024) * [-358.262] (-359.143) (-361.323) (-357.886) -- 0:00:26
592000 -- [-359.160] (-363.549) (-359.579) (-359.888) * (-356.977) (-358.090) (-360.091) [-358.531] -- 0:00:26
592500 -- (-359.178) (-363.065) (-360.136) [-359.053] * (-360.694) [-361.383] (-358.769) (-359.236) -- 0:00:26
593000 -- (-358.222) (-358.569) (-358.643) [-359.131] * (-357.399) (-360.369) [-361.255] (-357.940) -- 0:00:26
593500 -- [-360.974] (-356.939) (-357.355) (-358.951) * (-357.271) [-359.785] (-361.381) (-357.480) -- 0:00:27
594000 -- (-358.044) [-356.552] (-357.579) (-357.899) * (-358.602) (-357.403) [-358.954] (-361.881) -- 0:00:27
594500 -- (-358.637) (-357.885) [-361.377] (-361.852) * (-361.274) [-356.783] (-359.185) (-361.857) -- 0:00:27
595000 -- (-359.648) (-359.024) (-364.535) [-358.140] * (-363.166) [-358.765] (-359.300) (-364.841) -- 0:00:27
Average standard deviation of split frequencies: 0.008525
595500 -- (-359.242) (-359.478) [-359.121] (-362.453) * (-357.984) [-358.261] (-357.380) (-360.104) -- 0:00:27
596000 -- (-359.480) (-357.530) [-356.994] (-357.904) * [-358.325] (-357.923) (-357.976) (-359.502) -- 0:00:27
596500 -- (-357.594) (-362.267) [-357.200] (-358.369) * (-357.471) (-357.998) [-360.054] (-358.592) -- 0:00:27
597000 -- (-360.588) (-360.983) [-359.055] (-357.498) * (-359.911) (-360.829) [-359.752] (-357.695) -- 0:00:27
597500 -- (-359.154) [-356.726] (-358.069) (-358.404) * (-359.832) [-356.949] (-359.576) (-359.893) -- 0:00:26
598000 -- (-360.716) [-357.130] (-358.665) (-358.641) * [-360.641] (-359.823) (-360.713) (-359.698) -- 0:00:26
598500 -- [-357.412] (-358.708) (-360.679) (-359.142) * [-360.517] (-362.567) (-364.040) (-361.305) -- 0:00:26
599000 -- (-357.346) (-360.732) [-358.860] (-361.129) * [-359.677] (-359.225) (-359.419) (-361.519) -- 0:00:26
599500 -- (-358.159) [-360.851] (-357.939) (-358.372) * (-364.061) (-357.830) [-357.877] (-359.157) -- 0:00:26
600000 -- (-359.037) (-356.892) [-360.044] (-359.022) * [-358.041] (-357.547) (-357.686) (-357.479) -- 0:00:26
Average standard deviation of split frequencies: 0.007848
600500 -- (-357.736) (-356.671) (-359.294) [-369.916] * (-357.662) (-360.411) (-361.999) [-359.881] -- 0:00:26
601000 -- [-361.157] (-359.905) (-361.255) (-360.714) * (-360.950) (-357.258) (-358.904) [-358.410] -- 0:00:26
601500 -- (-366.285) [-356.753] (-357.370) (-361.357) * (-364.939) (-358.024) (-359.799) [-361.134] -- 0:00:26
602000 -- (-358.237) (-359.759) (-358.180) [-358.692] * [-359.124] (-358.472) (-358.522) (-358.206) -- 0:00:26
602500 -- (-358.864) (-362.952) [-356.504] (-358.305) * [-357.695] (-360.495) (-358.570) (-356.929) -- 0:00:26
603000 -- (-357.706) (-363.218) [-357.097] (-358.848) * (-357.972) (-359.079) (-359.760) [-360.637] -- 0:00:26
603500 -- [-361.093] (-360.081) (-357.902) (-356.670) * (-359.684) [-357.793] (-358.437) (-359.270) -- 0:00:26
604000 -- (-358.499) (-361.374) [-356.972] (-357.266) * (-358.927) (-357.309) [-356.725] (-356.961) -- 0:00:26
604500 -- (-358.277) (-359.117) (-361.888) [-357.740] * (-365.265) (-359.498) [-358.754] (-357.755) -- 0:00:26
605000 -- (-357.539) [-358.704] (-360.266) (-358.963) * (-363.407) [-357.379] (-358.245) (-356.507) -- 0:00:26
Average standard deviation of split frequencies: 0.008686
605500 -- [-357.274] (-359.311) (-359.114) (-359.916) * (-361.757) [-358.055] (-358.310) (-359.308) -- 0:00:26
606000 -- (-357.122) (-359.160) [-362.623] (-361.401) * (-359.743) (-357.514) [-357.415] (-358.519) -- 0:00:26
606500 -- (-362.759) (-363.952) [-360.693] (-359.218) * (-358.872) (-356.304) [-359.649] (-358.215) -- 0:00:25
607000 -- (-360.827) (-360.255) [-357.034] (-357.377) * (-360.175) [-356.983] (-363.473) (-359.516) -- 0:00:25
607500 -- (-358.130) (-361.134) (-357.026) [-359.312] * (-358.780) [-359.324] (-357.688) (-362.338) -- 0:00:25
608000 -- [-358.281] (-361.862) (-359.988) (-358.191) * (-361.875) [-357.201] (-356.942) (-362.266) -- 0:00:25
608500 -- [-358.125] (-359.566) (-362.295) (-359.940) * (-360.726) (-358.114) [-358.151] (-357.047) -- 0:00:25
609000 -- (-358.683) [-358.523] (-361.436) (-358.603) * (-357.397) (-362.061) [-357.048] (-360.850) -- 0:00:25
609500 -- (-357.874) (-360.145) [-357.069] (-357.682) * (-360.354) (-363.822) [-358.578] (-359.482) -- 0:00:25
610000 -- [-365.654] (-360.011) (-357.870) (-359.591) * (-358.188) (-366.265) [-361.505] (-358.403) -- 0:00:25
Average standard deviation of split frequencies: 0.008920
610500 -- (-359.469) (-361.446) (-357.683) [-357.803] * [-361.105] (-358.561) (-358.230) (-357.481) -- 0:00:26
611000 -- (-364.162) [-358.043] (-358.283) (-362.101) * (-363.032) (-361.208) [-358.029] (-359.970) -- 0:00:26
611500 -- (-359.772) (-358.971) (-358.827) [-359.851] * (-361.472) (-359.081) [-360.154] (-363.147) -- 0:00:26
612000 -- (-358.354) (-360.865) (-361.006) [-360.997] * (-360.411) (-359.878) [-360.335] (-360.162) -- 0:00:25
612500 -- (-357.248) (-356.977) (-358.543) [-358.142] * (-362.316) (-356.873) (-360.801) [-357.369] -- 0:00:25
613000 -- (-358.470) (-358.472) [-357.909] (-360.678) * (-359.168) [-359.767] (-357.342) (-360.681) -- 0:00:25
613500 -- (-357.195) [-359.632] (-357.359) (-359.623) * (-357.551) [-358.507] (-358.498) (-360.938) -- 0:00:25
614000 -- (-358.855) [-359.089] (-357.497) (-362.534) * (-359.136) (-357.249) [-359.867] (-358.636) -- 0:00:25
614500 -- (-358.098) [-356.366] (-357.767) (-361.291) * [-357.915] (-357.778) (-359.858) (-358.811) -- 0:00:25
615000 -- (-357.732) (-359.037) [-357.784] (-363.060) * (-358.340) (-359.999) (-356.775) [-359.499] -- 0:00:25
Average standard deviation of split frequencies: 0.008801
615500 -- (-357.736) (-358.483) (-358.632) [-363.506] * (-360.742) (-359.264) [-359.813] (-362.216) -- 0:00:25
616000 -- (-359.537) (-358.018) (-358.318) [-357.760] * (-358.507) (-358.177) [-360.871] (-358.102) -- 0:00:25
616500 -- (-356.854) [-359.101] (-360.435) (-358.169) * (-360.318) (-357.813) [-360.984] (-361.770) -- 0:00:25
617000 -- (-358.458) (-357.447) (-357.855) [-358.838] * (-359.082) [-358.040] (-358.747) (-359.146) -- 0:00:25
617500 -- (-360.069) [-358.170] (-358.475) (-359.339) * (-356.946) [-358.537] (-357.745) (-359.988) -- 0:00:25
618000 -- (-359.919) (-361.484) (-360.516) [-357.462] * (-358.607) [-358.772] (-356.724) (-362.685) -- 0:00:25
618500 -- (-359.464) [-359.386] (-359.229) (-357.677) * (-357.616) (-360.112) [-359.301] (-359.953) -- 0:00:25
619000 -- (-364.429) (-356.797) (-360.381) [-358.295] * (-358.068) (-363.661) (-358.356) [-361.382] -- 0:00:25
619500 -- [-358.347] (-358.957) (-358.465) (-356.812) * (-359.143) (-360.042) [-358.011] (-362.054) -- 0:00:25
620000 -- (-356.884) (-357.781) (-360.754) [-358.554] * (-358.055) (-360.145) (-359.065) [-363.166] -- 0:00:25
Average standard deviation of split frequencies: 0.008757
620500 -- (-360.446) (-362.788) [-360.649] (-357.359) * [-358.486] (-358.560) (-364.592) (-359.297) -- 0:00:25
621000 -- (-357.536) (-363.655) (-360.022) [-357.430] * (-364.501) [-357.214] (-359.017) (-360.802) -- 0:00:25
621500 -- [-357.904] (-360.243) (-359.399) (-361.160) * [-358.408] (-361.457) (-360.229) (-357.578) -- 0:00:24
622000 -- (-357.999) (-360.323) (-359.146) [-358.290] * (-359.383) [-361.846] (-359.485) (-361.615) -- 0:00:24
622500 -- (-359.072) [-361.006] (-357.301) (-359.148) * (-360.734) (-358.097) (-360.108) [-358.350] -- 0:00:24
623000 -- (-358.619) (-359.192) [-356.801] (-358.716) * (-359.754) [-357.659] (-358.649) (-358.408) -- 0:00:24
623500 -- (-357.466) (-357.334) [-357.782] (-357.962) * (-358.968) (-359.133) (-357.281) [-361.399] -- 0:00:24
624000 -- (-357.762) (-362.865) (-366.311) [-358.805] * (-360.754) (-358.859) [-358.606] (-357.907) -- 0:00:24
624500 -- (-357.314) (-359.396) (-358.457) [-359.351] * (-360.003) (-358.702) [-358.303] (-359.650) -- 0:00:24
625000 -- [-358.501] (-357.202) (-358.897) (-358.289) * (-357.308) (-358.652) (-358.313) [-357.701] -- 0:00:24
Average standard deviation of split frequencies: 0.008785
625500 -- (-361.042) (-360.972) [-359.000] (-362.743) * (-360.115) [-358.400] (-357.737) (-357.370) -- 0:00:24
626000 -- (-358.643) (-357.485) (-356.820) [-359.097] * (-360.045) [-356.957] (-359.152) (-359.690) -- 0:00:24
626500 -- (-360.001) (-358.925) [-358.894] (-358.135) * (-365.419) (-357.867) [-358.457] (-358.273) -- 0:00:24
627000 -- (-358.522) [-357.990] (-363.697) (-362.017) * (-359.299) (-358.363) [-358.097] (-360.163) -- 0:00:24
627500 -- (-358.334) (-359.123) (-358.850) [-360.704] * [-360.563] (-359.207) (-357.013) (-358.401) -- 0:00:24
628000 -- (-357.624) (-356.599) (-358.164) [-360.755] * (-358.142) (-358.981) (-357.859) [-356.649] -- 0:00:24
628500 -- [-358.885] (-360.109) (-359.280) (-361.088) * [-360.332] (-356.599) (-360.584) (-359.285) -- 0:00:24
629000 -- (-361.543) (-362.726) (-357.567) [-357.792] * (-360.635) [-358.686] (-357.689) (-357.462) -- 0:00:24
629500 -- [-358.655] (-356.350) (-362.838) (-359.104) * (-357.431) (-360.355) [-356.806] (-359.752) -- 0:00:24
630000 -- (-359.565) [-357.150] (-360.156) (-360.122) * (-362.498) (-357.253) (-358.952) [-357.953] -- 0:00:24
Average standard deviation of split frequencies: 0.008266
630500 -- (-359.657) (-356.888) [-358.314] (-360.294) * (-360.218) [-359.676] (-359.255) (-357.762) -- 0:00:24
631000 -- (-357.129) [-360.248] (-361.471) (-362.079) * (-362.489) (-357.191) (-366.297) [-360.071] -- 0:00:24
631500 -- (-361.994) (-359.861) [-357.048] (-357.643) * (-358.419) [-358.654] (-358.581) (-357.481) -- 0:00:24
632000 -- (-361.135) (-360.826) [-360.664] (-357.444) * (-361.612) [-357.735] (-360.569) (-360.688) -- 0:00:24
632500 -- (-361.138) (-361.631) [-358.285] (-357.595) * (-358.235) (-358.561) [-358.428] (-363.232) -- 0:00:24
633000 -- [-358.329] (-358.558) (-359.352) (-361.024) * (-357.628) (-358.379) (-358.539) [-360.286] -- 0:00:24
633500 -- (-360.104) (-357.935) [-360.724] (-358.419) * [-356.697] (-357.638) (-358.449) (-361.100) -- 0:00:24
634000 -- (-358.279) [-360.898] (-358.900) (-360.097) * (-358.371) [-358.479] (-356.844) (-362.506) -- 0:00:24
634500 -- (-359.022) (-360.007) (-360.052) [-356.486] * (-361.191) (-357.182) (-358.354) [-358.071] -- 0:00:24
635000 -- (-356.661) (-361.073) (-358.772) [-357.684] * (-357.092) [-358.835] (-363.022) (-357.125) -- 0:00:24
Average standard deviation of split frequencies: 0.008110
635500 -- (-357.886) [-364.128] (-358.475) (-359.684) * (-359.713) (-357.658) (-360.675) [-358.194] -- 0:00:24
636000 -- [-359.721] (-359.956) (-358.509) (-359.501) * (-357.569) (-357.505) [-362.683] (-361.783) -- 0:00:24
636500 -- (-361.125) (-359.117) (-358.120) [-356.663] * (-359.717) (-356.973) [-360.791] (-358.019) -- 0:00:23
637000 -- (-361.838) (-361.150) [-359.335] (-357.118) * (-359.316) (-357.756) (-362.947) [-358.816] -- 0:00:23
637500 -- (-358.635) [-359.066] (-359.932) (-357.065) * [-359.132] (-358.364) (-360.450) (-358.047) -- 0:00:23
638000 -- [-361.910] (-363.444) (-361.560) (-356.753) * [-357.235] (-357.510) (-363.669) (-357.940) -- 0:00:23
638500 -- (-358.344) (-361.388) (-361.771) [-357.060] * (-357.919) (-357.276) [-362.278] (-356.887) -- 0:00:23
639000 -- (-358.327) [-359.678] (-361.246) (-358.967) * [-356.994] (-356.935) (-361.966) (-356.771) -- 0:00:23
639500 -- [-359.740] (-357.224) (-360.070) (-358.248) * (-358.630) [-357.913] (-362.979) (-358.902) -- 0:00:23
640000 -- (-358.817) (-356.461) (-362.861) [-360.384] * [-361.703] (-358.386) (-360.716) (-360.923) -- 0:00:23
Average standard deviation of split frequencies: 0.008216
640500 -- (-362.532) (-358.111) [-362.720] (-358.759) * [-359.138] (-358.443) (-358.826) (-357.330) -- 0:00:23
641000 -- (-365.985) (-357.642) [-361.213] (-359.313) * [-357.267] (-361.600) (-359.431) (-358.528) -- 0:00:23
641500 -- (-361.868) [-357.956] (-357.232) (-361.118) * (-360.773) [-359.240] (-360.349) (-359.428) -- 0:00:23
642000 -- (-362.526) [-357.837] (-360.293) (-357.758) * [-359.672] (-358.989) (-367.638) (-358.275) -- 0:00:23
642500 -- (-359.738) (-357.743) [-356.857] (-359.802) * (-358.262) (-361.138) [-359.638] (-361.894) -- 0:00:23
643000 -- (-358.344) (-357.774) (-357.523) [-358.116] * [-358.942] (-357.612) (-356.478) (-360.067) -- 0:00:23
643500 -- (-360.008) (-357.628) (-357.389) [-356.827] * (-360.029) (-360.002) [-356.774] (-359.622) -- 0:00:23
644000 -- (-358.986) (-358.571) [-358.334] (-357.565) * (-358.960) (-364.512) [-359.080] (-358.701) -- 0:00:23
644500 -- (-359.087) (-357.153) (-360.527) [-358.703] * [-357.405] (-358.906) (-360.507) (-358.340) -- 0:00:23
645000 -- (-360.951) [-358.034] (-361.440) (-359.396) * [-357.825] (-358.040) (-357.652) (-359.189) -- 0:00:23
Average standard deviation of split frequencies: 0.008230
645500 -- (-356.899) (-360.654) (-363.284) [-358.754] * (-358.442) (-357.130) (-356.919) [-360.256] -- 0:00:23
646000 -- (-359.433) (-356.782) [-356.744] (-358.102) * (-363.094) [-359.264] (-361.066) (-361.439) -- 0:00:23
646500 -- (-359.267) (-359.277) (-359.986) [-357.017] * [-360.021] (-356.955) (-359.858) (-360.060) -- 0:00:23
647000 -- (-357.674) (-358.046) [-359.540] (-359.516) * (-361.300) (-358.748) (-365.039) [-357.428] -- 0:00:23
647500 -- (-358.766) (-357.562) (-361.526) [-358.982] * (-358.953) [-359.093] (-360.140) (-360.250) -- 0:00:23
648000 -- (-358.984) (-357.822) [-357.073] (-359.780) * [-356.594] (-357.056) (-359.187) (-356.629) -- 0:00:23
648500 -- (-360.027) (-358.197) [-360.415] (-359.949) * [-356.581] (-358.312) (-361.066) (-356.756) -- 0:00:23
649000 -- [-359.521] (-357.293) (-365.336) (-358.202) * [-358.329] (-363.545) (-357.216) (-360.024) -- 0:00:23
649500 -- (-358.054) (-360.193) (-360.373) [-360.920] * (-359.059) (-357.809) (-358.271) [-358.529] -- 0:00:23
650000 -- (-358.057) (-358.054) [-358.471] (-362.255) * (-357.077) [-358.652] (-358.085) (-357.276) -- 0:00:23
Average standard deviation of split frequencies: 0.007924
650500 -- (-359.526) (-361.295) (-359.154) [-358.989] * [-358.099] (-358.326) (-358.109) (-357.485) -- 0:00:23
651000 -- (-357.967) [-358.960] (-358.317) (-357.529) * (-357.470) (-357.779) (-358.380) [-360.637] -- 0:00:23
651500 -- (-361.022) (-360.314) (-357.928) [-360.162] * [-358.248] (-360.441) (-357.329) (-360.781) -- 0:00:23
652000 -- (-362.194) (-359.899) (-361.833) [-360.405] * (-358.519) (-360.868) (-357.424) [-358.752] -- 0:00:22
652500 -- [-360.786] (-360.965) (-359.011) (-363.104) * (-358.045) (-358.690) [-360.066] (-359.790) -- 0:00:22
653000 -- [-357.963] (-361.129) (-360.475) (-356.751) * [-361.635] (-360.159) (-359.164) (-357.776) -- 0:00:22
653500 -- (-357.996) [-357.017] (-358.194) (-362.494) * (-357.279) (-357.293) [-357.868] (-357.891) -- 0:00:22
654000 -- (-357.525) [-356.893] (-361.379) (-359.260) * (-358.336) [-362.482] (-356.955) (-361.275) -- 0:00:22
654500 -- (-360.569) [-358.620] (-358.915) (-366.190) * (-363.161) (-359.161) [-356.840] (-361.180) -- 0:00:22
655000 -- (-359.707) (-362.211) [-359.267] (-356.629) * [-357.969] (-360.368) (-360.619) (-359.377) -- 0:00:22
Average standard deviation of split frequencies: 0.008792
655500 -- (-360.304) [-358.878] (-358.656) (-359.078) * [-357.424] (-357.669) (-360.452) (-360.221) -- 0:00:22
656000 -- (-358.982) (-356.782) [-356.997] (-359.260) * (-360.014) (-357.542) [-357.446] (-358.761) -- 0:00:22
656500 -- (-357.892) (-359.905) [-360.150] (-357.807) * [-360.836] (-357.349) (-359.365) (-358.148) -- 0:00:22
657000 -- [-357.061] (-357.523) (-360.353) (-358.517) * [-359.775] (-359.030) (-358.475) (-357.815) -- 0:00:22
657500 -- (-357.368) (-361.451) [-357.922] (-357.434) * (-361.153) (-357.578) (-358.807) [-362.929] -- 0:00:22
658000 -- (-361.339) (-356.995) (-356.512) [-358.154] * (-356.513) [-356.923] (-360.646) (-367.251) -- 0:00:22
658500 -- (-359.050) (-358.176) (-359.150) [-356.967] * (-358.286) [-360.081] (-359.696) (-362.696) -- 0:00:22
659000 -- (-360.204) (-357.471) [-358.361] (-360.754) * (-357.785) (-357.231) [-358.187] (-358.918) -- 0:00:22
659500 -- (-358.590) (-358.078) [-358.277] (-362.919) * (-357.696) (-360.019) [-357.530] (-356.815) -- 0:00:22
660000 -- (-363.638) [-358.290] (-359.291) (-359.533) * (-360.410) (-361.024) [-358.883] (-358.978) -- 0:00:22
Average standard deviation of split frequencies: 0.008940
660500 -- (-361.978) (-358.743) [-357.233] (-361.744) * (-363.991) (-358.875) (-360.659) [-357.257] -- 0:00:22
661000 -- (-360.895) [-359.159] (-358.016) (-363.731) * (-358.248) (-358.469) (-358.871) [-359.201] -- 0:00:22
661500 -- (-357.030) [-358.334] (-357.654) (-366.434) * (-358.032) (-358.018) (-360.260) [-359.962] -- 0:00:22
662000 -- [-357.094] (-358.927) (-359.361) (-365.450) * (-358.846) (-359.376) [-358.167] (-356.893) -- 0:00:22
662500 -- (-361.594) (-359.498) [-362.744] (-359.805) * (-358.262) (-359.327) (-357.221) [-360.939] -- 0:00:22
663000 -- [-357.107] (-357.413) (-359.411) (-362.180) * (-356.555) [-358.343] (-360.038) (-358.196) -- 0:00:22
663500 -- (-358.553) [-358.301] (-363.314) (-360.512) * (-360.009) [-359.890] (-363.160) (-358.472) -- 0:00:22
664000 -- [-357.006] (-361.042) (-358.697) (-358.766) * (-357.884) [-358.129] (-356.942) (-359.345) -- 0:00:22
664500 -- (-359.380) (-360.790) (-359.272) [-358.377] * (-358.992) (-358.660) [-357.172] (-361.667) -- 0:00:22
665000 -- (-360.201) (-357.422) (-359.554) [-359.318] * (-356.923) (-359.112) (-357.786) [-358.561] -- 0:00:22
Average standard deviation of split frequencies: 0.008910
665500 -- [-359.723] (-364.274) (-357.267) (-359.595) * (-358.941) [-359.641] (-357.735) (-362.705) -- 0:00:22
666000 -- (-360.085) [-364.628] (-357.221) (-360.760) * (-357.956) (-361.507) (-358.059) [-358.620] -- 0:00:22
666500 -- (-358.368) (-359.518) (-358.792) [-357.999] * [-357.881] (-359.060) (-358.777) (-357.317) -- 0:00:22
667000 -- [-356.959] (-360.624) (-358.791) (-358.254) * (-362.082) (-358.037) (-356.882) [-359.400] -- 0:00:21
667500 -- [-357.185] (-357.611) (-359.676) (-358.038) * (-359.123) (-357.072) (-357.011) [-358.686] -- 0:00:21
668000 -- (-357.132) [-358.376] (-360.860) (-361.872) * (-357.851) [-357.372] (-357.467) (-357.852) -- 0:00:21
668500 -- (-359.296) (-357.826) (-360.683) [-359.401] * (-357.583) (-358.269) [-357.861] (-357.977) -- 0:00:21
669000 -- [-360.437] (-358.912) (-359.163) (-358.160) * [-356.728] (-357.066) (-357.559) (-357.758) -- 0:00:21
669500 -- (-359.756) (-357.376) [-358.395] (-358.825) * (-361.321) [-358.189] (-357.095) (-362.449) -- 0:00:21
670000 -- (-357.638) [-359.383] (-359.317) (-357.820) * (-358.953) [-358.746] (-358.445) (-361.128) -- 0:00:21
Average standard deviation of split frequencies: 0.009468
670500 -- (-359.244) (-360.271) [-360.074] (-358.430) * (-361.682) (-359.719) [-359.077] (-363.763) -- 0:00:21
671000 -- (-360.944) (-363.430) [-359.342] (-362.190) * [-359.367] (-359.229) (-361.482) (-361.559) -- 0:00:21
671500 -- [-358.461] (-361.076) (-359.873) (-358.480) * (-358.158) [-356.976] (-361.067) (-361.456) -- 0:00:21
672000 -- (-360.988) (-359.779) [-359.307] (-357.193) * (-359.365) [-356.882] (-360.565) (-360.611) -- 0:00:21
672500 -- (-358.882) (-359.968) (-359.369) [-358.874] * (-358.737) (-358.036) [-359.708] (-361.084) -- 0:00:21
673000 -- (-358.215) (-360.505) [-359.278] (-362.823) * (-357.345) [-361.381] (-360.396) (-357.607) -- 0:00:21
673500 -- (-360.633) (-359.802) (-361.460) [-357.684] * (-357.799) (-358.499) (-364.389) [-360.404] -- 0:00:21
674000 -- [-359.428] (-358.907) (-358.704) (-360.984) * (-358.926) (-360.593) [-357.517] (-358.214) -- 0:00:21
674500 -- (-357.659) [-358.736] (-362.390) (-361.595) * (-359.735) (-356.959) (-357.340) [-357.423] -- 0:00:21
675000 -- [-359.620] (-357.232) (-357.674) (-361.387) * [-358.707] (-356.530) (-357.785) (-361.251) -- 0:00:21
Average standard deviation of split frequencies: 0.009414
675500 -- [-358.812] (-357.863) (-357.401) (-359.815) * (-359.994) [-356.524] (-358.171) (-359.343) -- 0:00:21
676000 -- [-358.205] (-357.953) (-356.527) (-361.206) * [-357.519] (-359.501) (-358.350) (-360.561) -- 0:00:21
676500 -- [-358.205] (-358.121) (-358.434) (-360.218) * (-360.036) [-357.042] (-359.904) (-359.748) -- 0:00:21
677000 -- [-360.009] (-357.899) (-356.521) (-360.331) * [-357.501] (-358.563) (-359.344) (-359.931) -- 0:00:20
677500 -- (-358.725) (-359.692) [-360.102] (-359.358) * [-359.852] (-361.874) (-358.616) (-357.966) -- 0:00:20
678000 -- (-359.119) [-361.584] (-360.896) (-357.208) * (-358.371) [-362.962] (-357.779) (-357.473) -- 0:00:20
678500 -- (-359.880) (-359.944) (-357.075) [-356.672] * (-357.126) [-358.100] (-358.775) (-360.287) -- 0:00:21
679000 -- (-358.670) [-358.043] (-360.013) (-357.980) * (-360.040) [-358.269] (-357.797) (-360.345) -- 0:00:21
679500 -- (-358.419) (-358.209) [-361.759] (-356.489) * (-358.484) (-359.482) (-361.261) [-359.496] -- 0:00:21
680000 -- (-358.676) (-358.639) [-359.490] (-356.871) * [-358.768] (-359.681) (-358.545) (-360.224) -- 0:00:21
Average standard deviation of split frequencies: 0.009927
680500 -- (-356.741) [-359.038] (-359.222) (-359.627) * [-356.712] (-359.090) (-358.084) (-357.498) -- 0:00:21
681000 -- (-357.812) [-357.296] (-357.744) (-363.079) * (-357.956) (-359.308) (-357.325) [-359.189] -- 0:00:21
681500 -- (-358.585) (-356.996) [-363.678] (-361.775) * (-361.641) [-359.455] (-359.898) (-356.634) -- 0:00:21
682000 -- (-360.448) (-357.815) [-364.152] (-358.814) * (-357.486) [-357.081] (-359.075) (-356.586) -- 0:00:20
682500 -- [-358.423] (-357.181) (-359.236) (-363.196) * (-357.938) (-359.135) (-359.740) [-357.234] -- 0:00:20
683000 -- (-359.212) (-357.399) (-357.402) [-358.789] * [-357.473] (-357.012) (-357.062) (-358.755) -- 0:00:20
683500 -- (-357.013) (-360.138) (-359.714) [-358.914] * (-359.487) [-362.380] (-358.984) (-359.335) -- 0:00:20
684000 -- (-357.162) (-363.425) (-357.508) [-360.566] * [-359.600] (-359.541) (-357.857) (-358.216) -- 0:00:20
684500 -- [-357.834] (-359.194) (-362.640) (-357.379) * [-357.930] (-357.641) (-358.362) (-358.343) -- 0:00:20
685000 -- (-358.577) (-358.412) (-357.219) [-357.937] * (-357.811) (-359.802) [-358.028] (-362.514) -- 0:00:20
Average standard deviation of split frequencies: 0.010308
685500 -- (-363.272) [-357.684] (-358.997) (-366.387) * [-357.319] (-358.923) (-357.942) (-360.362) -- 0:00:20
686000 -- (-358.087) (-359.857) (-360.957) [-360.336] * (-358.197) (-359.679) (-358.941) [-358.856] -- 0:00:20
686500 -- (-357.985) (-357.891) (-359.448) [-360.740] * (-356.399) [-359.030] (-357.538) (-358.368) -- 0:00:20
687000 -- [-357.584] (-356.839) (-359.429) (-357.092) * [-361.633] (-359.065) (-358.054) (-357.665) -- 0:00:20
687500 -- (-358.426) [-358.213] (-357.961) (-359.146) * (-360.873) (-360.497) (-358.203) [-359.163] -- 0:00:20
688000 -- (-360.282) [-361.317] (-357.286) (-357.069) * [-358.355] (-358.341) (-357.357) (-358.539) -- 0:00:20
688500 -- (-359.332) [-358.589] (-358.796) (-358.347) * (-358.299) [-360.628] (-364.667) (-359.267) -- 0:00:20
689000 -- (-359.877) [-359.419] (-358.012) (-359.097) * (-357.137) (-359.845) (-360.435) [-362.980] -- 0:00:20
689500 -- (-361.284) (-357.967) [-362.050] (-359.536) * (-358.910) (-358.504) [-359.160] (-359.318) -- 0:00:20
690000 -- (-358.508) [-356.725] (-358.476) (-360.319) * (-358.152) (-358.572) [-356.648] (-360.114) -- 0:00:20
Average standard deviation of split frequencies: 0.010162
690500 -- (-358.055) (-357.656) (-357.928) [-359.599] * (-359.705) (-357.143) (-363.111) [-358.045] -- 0:00:20
691000 -- (-359.137) [-358.907] (-357.129) (-362.409) * (-360.073) (-361.449) (-364.947) [-358.318] -- 0:00:20
691500 -- (-360.196) (-360.764) [-359.801] (-361.476) * [-357.994] (-356.782) (-359.298) (-359.192) -- 0:00:20
692000 -- (-361.140) (-369.541) [-357.746] (-357.589) * (-362.301) [-357.735] (-357.822) (-359.474) -- 0:00:20
692500 -- (-360.871) (-358.788) (-360.900) [-358.343] * [-360.817] (-360.127) (-357.116) (-358.530) -- 0:00:19
693000 -- (-364.345) [-358.463] (-358.511) (-361.547) * [-360.936] (-359.071) (-358.377) (-361.678) -- 0:00:19
693500 -- [-360.321] (-358.356) (-359.327) (-358.152) * (-363.994) (-359.983) (-361.469) [-358.137] -- 0:00:19
694000 -- (-360.043) (-358.317) [-360.007] (-359.230) * [-359.426] (-362.644) (-362.702) (-356.992) -- 0:00:19
694500 -- (-358.236) [-358.006] (-365.064) (-358.943) * [-358.374] (-357.737) (-360.150) (-357.001) -- 0:00:19
695000 -- (-358.280) (-357.108) (-357.783) [-356.967] * [-358.086] (-359.693) (-357.080) (-359.422) -- 0:00:19
Average standard deviation of split frequencies: 0.009971
695500 -- (-357.007) (-358.345) (-357.648) [-357.505] * (-357.993) [-357.069] (-357.860) (-359.664) -- 0:00:20
696000 -- (-358.155) [-357.179] (-357.107) (-357.744) * (-358.379) [-358.287] (-356.973) (-359.306) -- 0:00:20
696500 -- (-358.891) (-356.853) [-357.706] (-356.670) * (-358.196) (-358.450) (-360.750) [-359.404] -- 0:00:20
697000 -- (-359.046) [-356.950] (-357.616) (-357.423) * (-360.872) [-358.021] (-357.158) (-362.707) -- 0:00:19
697500 -- (-360.828) (-358.892) [-357.957] (-356.553) * (-361.524) [-360.406] (-358.920) (-358.496) -- 0:00:19
698000 -- (-359.906) [-358.650] (-362.133) (-358.449) * (-357.380) (-359.657) (-362.969) [-358.284] -- 0:00:19
698500 -- (-358.907) (-359.075) (-364.592) [-360.826] * (-357.740) [-359.988] (-362.367) (-360.137) -- 0:00:19
699000 -- (-361.916) (-360.133) (-360.707) [-359.279] * (-358.754) (-362.186) [-357.521] (-357.126) -- 0:00:19
699500 -- (-361.741) (-360.497) (-359.684) [-362.244] * (-356.704) (-360.577) [-359.999] (-356.901) -- 0:00:19
700000 -- (-358.521) (-361.274) [-357.625] (-357.616) * (-357.141) (-358.698) [-357.373] (-361.310) -- 0:00:19
Average standard deviation of split frequencies: 0.010428
700500 -- [-358.769] (-358.306) (-359.431) (-357.283) * [-360.277] (-357.408) (-360.004) (-364.208) -- 0:00:19
701000 -- (-365.563) (-357.774) [-357.970] (-358.946) * (-358.449) [-358.670] (-360.542) (-358.688) -- 0:00:19
701500 -- (-357.836) (-359.582) [-358.266] (-360.128) * [-358.239] (-358.230) (-362.722) (-359.754) -- 0:00:19
702000 -- (-361.350) (-360.085) [-358.720] (-359.208) * [-357.438] (-364.022) (-357.871) (-360.394) -- 0:00:19
702500 -- [-364.469] (-359.316) (-357.278) (-359.391) * [-358.508] (-361.873) (-357.109) (-361.033) -- 0:00:19
703000 -- (-364.553) (-359.293) [-358.016] (-360.373) * (-358.863) (-357.881) [-360.990] (-357.606) -- 0:00:19
703500 -- [-359.022] (-362.893) (-359.994) (-359.829) * (-358.777) (-363.510) (-357.866) [-358.928] -- 0:00:19
704000 -- (-359.160) (-359.933) [-359.674] (-357.812) * [-357.279] (-360.421) (-357.098) (-358.434) -- 0:00:19
704500 -- (-357.979) (-360.323) [-358.218] (-357.545) * (-358.258) (-358.333) (-359.584) [-357.874] -- 0:00:19
705000 -- (-359.453) (-358.676) [-360.524] (-358.007) * (-358.929) (-357.633) [-361.180] (-360.578) -- 0:00:19
Average standard deviation of split frequencies: 0.010275
705500 -- (-362.886) [-360.263] (-357.044) (-358.996) * [-359.058] (-357.569) (-359.631) (-360.191) -- 0:00:19
706000 -- (-363.148) [-357.310] (-357.275) (-365.896) * (-357.691) (-360.568) (-359.101) [-359.064] -- 0:00:19
706500 -- (-359.422) (-357.980) [-356.443] (-362.480) * [-357.315] (-357.701) (-357.542) (-358.636) -- 0:00:19
707000 -- (-360.414) (-361.376) [-362.608] (-357.573) * (-358.997) (-357.487) [-358.727] (-358.335) -- 0:00:19
707500 -- (-359.412) [-361.115] (-356.771) (-358.793) * (-356.695) (-360.215) (-358.167) [-358.355] -- 0:00:19
708000 -- (-356.527) [-357.227] (-358.075) (-358.488) * (-357.600) [-360.869] (-361.068) (-359.601) -- 0:00:18
708500 -- [-357.981] (-358.931) (-359.562) (-358.891) * (-360.139) (-359.905) (-360.181) [-357.864] -- 0:00:18
709000 -- (-358.256) [-356.787] (-367.347) (-360.061) * (-357.745) [-356.438] (-359.055) (-360.417) -- 0:00:18
709500 -- [-357.502] (-357.024) (-365.386) (-360.419) * (-359.155) [-356.918] (-357.443) (-359.614) -- 0:00:18
710000 -- (-359.650) (-359.532) (-357.702) [-357.592] * (-358.461) (-359.510) (-356.772) [-360.658] -- 0:00:18
Average standard deviation of split frequencies: 0.009987
710500 -- [-358.388] (-357.793) (-360.808) (-360.415) * (-361.212) (-360.580) [-358.643] (-357.747) -- 0:00:18
711000 -- (-361.850) (-360.318) (-359.175) [-361.819] * (-358.115) [-358.990] (-359.692) (-356.820) -- 0:00:18
711500 -- [-362.685] (-361.177) (-360.901) (-361.161) * (-361.874) (-358.714) (-357.228) [-357.632] -- 0:00:18
712000 -- (-357.868) [-358.828] (-358.254) (-363.342) * (-360.422) (-358.711) [-359.030] (-357.410) -- 0:00:18
712500 -- (-360.017) (-356.901) [-357.626] (-361.188) * (-357.620) [-358.354] (-363.530) (-358.950) -- 0:00:18
713000 -- (-360.258) [-357.918] (-358.213) (-359.690) * [-357.175] (-357.692) (-357.950) (-358.376) -- 0:00:18
713500 -- (-359.266) (-358.757) [-357.909] (-360.914) * (-356.881) [-360.692] (-365.240) (-364.948) -- 0:00:18
714000 -- [-359.936] (-360.972) (-359.548) (-361.230) * (-360.201) (-360.319) [-357.745] (-358.027) -- 0:00:18
714500 -- (-359.341) [-357.425] (-356.992) (-367.127) * (-357.922) (-358.060) [-360.984] (-356.665) -- 0:00:18
715000 -- (-359.280) (-358.014) (-356.867) [-357.546] * [-358.133] (-357.230) (-362.362) (-360.477) -- 0:00:18
Average standard deviation of split frequencies: 0.009803
715500 -- (-360.043) [-359.093] (-358.405) (-357.687) * (-357.298) [-357.496] (-361.410) (-357.018) -- 0:00:18
716000 -- (-360.351) (-358.087) (-359.286) [-358.858] * (-358.616) [-357.444] (-358.499) (-359.675) -- 0:00:18
716500 -- (-357.371) (-358.713) (-358.845) [-357.542] * [-356.467] (-359.520) (-359.167) (-358.912) -- 0:00:18
717000 -- (-361.056) [-357.086] (-361.279) (-357.412) * [-358.349] (-359.347) (-358.955) (-357.811) -- 0:00:18
717500 -- (-356.880) (-359.592) (-362.768) [-361.388] * [-361.492] (-359.216) (-356.711) (-357.699) -- 0:00:18
718000 -- (-360.268) (-356.509) (-359.328) [-358.618] * (-361.350) [-358.057] (-359.317) (-358.541) -- 0:00:18
718500 -- (-359.900) [-357.165] (-358.660) (-358.835) * [-360.681] (-357.844) (-357.472) (-357.587) -- 0:00:18
719000 -- (-362.249) (-357.885) [-358.702] (-360.554) * (-359.829) (-357.600) (-358.015) [-359.292] -- 0:00:18
719500 -- (-359.210) [-359.096] (-359.221) (-359.349) * (-360.445) (-357.284) [-360.146] (-359.523) -- 0:00:18
720000 -- [-357.179] (-357.506) (-362.505) (-358.284) * (-358.027) (-357.244) (-357.131) [-358.961] -- 0:00:18
Average standard deviation of split frequencies: 0.009619
720500 -- [-356.995] (-358.976) (-359.045) (-360.203) * (-363.158) (-357.880) [-357.049] (-356.490) -- 0:00:18
721000 -- (-359.467) (-358.065) [-358.955] (-357.788) * [-358.059] (-359.827) (-357.489) (-358.968) -- 0:00:18
721500 -- [-359.412] (-362.525) (-361.594) (-361.860) * (-358.971) (-360.402) (-357.195) [-361.877] -- 0:00:18
722000 -- (-357.572) (-359.568) [-362.118] (-360.198) * (-361.683) (-358.143) [-357.714] (-357.098) -- 0:00:18
722500 -- (-360.195) [-360.084] (-356.995) (-360.486) * (-362.767) (-358.562) [-358.316] (-358.563) -- 0:00:18
723000 -- (-357.868) (-360.868) (-357.197) [-359.811] * (-358.958) (-357.930) [-357.068] (-357.264) -- 0:00:18
723500 -- (-357.124) (-360.826) (-357.287) [-357.965] * (-358.663) [-357.472] (-356.543) (-359.981) -- 0:00:17
724000 -- [-357.125] (-358.598) (-358.420) (-358.530) * (-358.833) [-361.277] (-357.627) (-358.439) -- 0:00:17
724500 -- (-359.432) (-359.881) (-358.413) [-357.558] * (-360.966) (-362.807) [-359.420] (-358.255) -- 0:00:17
725000 -- (-358.817) (-357.564) [-366.481] (-360.686) * (-356.559) [-356.960] (-360.273) (-358.559) -- 0:00:17
Average standard deviation of split frequencies: 0.009663
725500 -- (-357.177) [-356.916] (-358.159) (-359.649) * (-357.798) (-358.347) (-359.275) [-356.581] -- 0:00:17
726000 -- (-357.344) [-360.190] (-361.250) (-361.663) * (-361.317) (-358.611) [-358.828] (-358.384) -- 0:00:17
726500 -- [-357.322] (-360.544) (-358.353) (-358.340) * (-358.492) (-359.177) [-357.451] (-358.250) -- 0:00:17
727000 -- (-357.407) [-357.763] (-357.748) (-359.706) * (-357.275) (-359.116) (-357.981) [-358.815] -- 0:00:17
727500 -- [-359.946] (-359.064) (-359.306) (-358.805) * (-358.055) (-357.171) (-359.137) [-358.987] -- 0:00:17
728000 -- (-358.325) (-356.893) (-357.930) [-357.152] * (-357.702) (-359.130) [-357.607] (-362.954) -- 0:00:17
728500 -- [-358.446] (-357.101) (-361.927) (-358.338) * (-359.288) [-356.727] (-360.430) (-360.516) -- 0:00:17
729000 -- [-357.980] (-360.850) (-357.369) (-358.669) * [-362.568] (-358.555) (-358.074) (-357.806) -- 0:00:17
729500 -- (-362.836) (-358.923) (-356.882) [-356.544] * (-362.194) (-357.305) (-358.484) [-359.762] -- 0:00:17
730000 -- [-356.556] (-358.145) (-358.094) (-359.454) * (-357.045) (-357.792) (-360.933) [-358.589] -- 0:00:17
Average standard deviation of split frequencies: 0.009319
730500 -- [-361.208] (-362.946) (-359.823) (-364.780) * [-358.921] (-358.148) (-359.979) (-357.286) -- 0:00:17
731000 -- (-359.516) (-358.946) (-358.375) [-358.733] * (-358.141) (-359.741) (-360.112) [-356.594] -- 0:00:17
731500 -- (-361.370) (-361.790) [-357.855] (-359.145) * (-356.655) (-363.444) (-359.150) [-356.296] -- 0:00:17
732000 -- (-358.362) (-362.611) (-357.549) [-359.227] * (-359.902) [-360.462] (-358.924) (-356.472) -- 0:00:17
732500 -- (-357.760) [-359.204] (-357.429) (-359.301) * (-360.674) (-362.670) (-358.409) [-358.084] -- 0:00:17
733000 -- (-356.980) (-360.762) (-357.856) [-361.669] * (-357.898) (-359.074) (-357.997) [-358.483] -- 0:00:17
733500 -- (-358.303) (-361.420) (-358.140) [-356.943] * [-358.171] (-362.533) (-361.987) (-361.088) -- 0:00:17
734000 -- (-360.219) (-359.944) (-357.788) [-358.161] * [-358.088] (-360.374) (-357.682) (-367.077) -- 0:00:17
734500 -- (-356.760) (-358.797) (-363.589) [-356.937] * (-358.943) (-356.723) [-360.556] (-356.430) -- 0:00:17
735000 -- [-358.959] (-357.292) (-357.343) (-356.620) * (-358.291) (-357.058) (-359.567) [-358.111] -- 0:00:17
Average standard deviation of split frequencies: 0.009572
735500 -- (-358.167) (-358.232) [-358.639] (-361.214) * [-357.319] (-359.355) (-358.603) (-356.966) -- 0:00:17
736000 -- (-358.371) [-356.725] (-357.470) (-357.021) * (-358.136) (-360.850) [-358.172] (-356.727) -- 0:00:17
736500 -- (-358.821) (-357.096) [-357.452] (-357.238) * (-358.007) (-362.347) [-358.407] (-358.727) -- 0:00:17
737000 -- (-358.067) (-361.513) [-357.222] (-360.395) * (-362.743) (-359.781) (-356.931) [-362.451] -- 0:00:17
737500 -- (-361.680) [-361.326] (-358.227) (-358.563) * (-359.425) (-359.962) (-358.611) [-359.564] -- 0:00:17
738000 -- (-356.957) [-357.801] (-362.179) (-363.331) * (-358.034) (-357.642) [-361.238] (-359.774) -- 0:00:17
738500 -- (-357.411) (-356.912) [-358.914] (-357.806) * (-362.155) (-360.889) [-360.636] (-366.407) -- 0:00:16
739000 -- (-361.011) (-357.794) [-359.295] (-359.807) * (-358.658) (-359.012) [-359.606] (-360.467) -- 0:00:16
739500 -- (-357.537) (-358.575) [-360.818] (-361.148) * (-357.075) (-358.620) [-356.337] (-363.390) -- 0:00:16
740000 -- (-357.727) [-358.878] (-358.227) (-358.714) * (-362.866) (-358.319) [-361.404] (-363.144) -- 0:00:16
Average standard deviation of split frequencies: 0.009846
740500 -- [-360.365] (-364.143) (-362.060) (-358.770) * (-359.786) (-356.702) [-359.105] (-364.355) -- 0:00:16
741000 -- (-359.632) (-360.405) (-361.561) [-358.565] * (-357.361) [-356.688] (-360.594) (-362.764) -- 0:00:16
741500 -- (-360.557) (-357.660) (-359.814) [-360.937] * [-356.465] (-358.758) (-358.929) (-359.182) -- 0:00:16
742000 -- (-359.122) (-357.618) (-361.138) [-358.394] * (-358.459) [-358.902] (-360.099) (-361.648) -- 0:00:16
742500 -- (-360.982) (-362.749) (-358.879) [-359.495] * (-359.659) (-357.260) [-357.836] (-362.286) -- 0:00:16
743000 -- (-357.615) (-363.175) (-359.009) [-360.552] * (-357.477) [-360.311] (-358.294) (-365.371) -- 0:00:16
743500 -- (-360.719) (-359.954) (-359.935) [-358.510] * (-359.630) (-359.442) [-357.466] (-359.460) -- 0:00:16
744000 -- [-359.372] (-360.455) (-362.315) (-360.425) * [-359.369] (-359.383) (-358.010) (-357.780) -- 0:00:16
744500 -- (-356.878) (-361.951) (-359.790) [-358.269] * [-359.874] (-356.425) (-360.446) (-357.835) -- 0:00:16
745000 -- (-357.596) [-357.636] (-361.119) (-360.041) * (-357.383) [-357.558] (-358.435) (-357.289) -- 0:00:16
Average standard deviation of split frequencies: 0.010036
745500 -- [-358.796] (-362.879) (-359.785) (-363.133) * (-363.779) (-361.104) [-358.311] (-359.726) -- 0:00:16
746000 -- (-359.267) (-364.150) (-359.978) [-362.090] * (-358.238) [-359.881] (-357.535) (-359.376) -- 0:00:16
746500 -- (-359.685) (-358.558) (-360.267) [-359.115] * (-357.394) [-359.207] (-357.122) (-361.247) -- 0:00:16
747000 -- (-359.734) (-358.254) [-357.872] (-361.106) * (-356.888) [-357.937] (-357.399) (-359.736) -- 0:00:16
747500 -- [-359.080] (-357.614) (-359.149) (-363.909) * (-358.113) [-358.061] (-359.434) (-357.334) -- 0:00:16
748000 -- (-361.000) (-358.928) [-359.575] (-363.540) * (-356.824) [-358.724] (-358.848) (-357.715) -- 0:00:16
748500 -- (-360.787) [-359.361] (-359.669) (-358.296) * (-359.001) (-358.841) [-357.197] (-357.095) -- 0:00:16
749000 -- (-359.812) [-357.267] (-359.073) (-360.170) * [-358.358] (-358.997) (-359.462) (-359.905) -- 0:00:16
749500 -- (-360.404) (-358.786) (-357.535) [-360.776] * (-360.021) (-361.186) (-356.459) [-357.481] -- 0:00:16
750000 -- (-360.925) (-359.630) [-357.214] (-358.039) * (-358.124) [-358.760] (-357.953) (-358.860) -- 0:00:16
Average standard deviation of split frequencies: 0.009863
750500 -- (-359.402) (-359.704) [-358.641] (-358.805) * (-360.084) [-361.672] (-364.314) (-361.350) -- 0:00:16
751000 -- [-357.831] (-361.806) (-361.735) (-357.493) * (-356.711) (-356.902) [-360.911] (-360.336) -- 0:00:16
751500 -- (-361.081) [-360.673] (-359.625) (-360.173) * (-361.188) [-358.001] (-361.259) (-357.181) -- 0:00:16
752000 -- (-361.449) (-359.291) [-358.183] (-360.251) * (-359.942) [-357.566] (-362.490) (-358.514) -- 0:00:16
752500 -- (-363.395) (-357.120) [-361.839] (-360.311) * (-359.124) (-364.190) [-358.101] (-357.055) -- 0:00:16
753000 -- (-359.995) [-358.955] (-360.231) (-357.530) * (-357.922) [-358.383] (-363.471) (-360.777) -- 0:00:16
753500 -- (-361.122) (-359.998) (-358.921) [-358.170] * (-359.788) (-358.830) [-359.154] (-361.206) -- 0:00:16
754000 -- (-360.146) (-359.675) [-359.815] (-361.207) * [-364.541] (-359.409) (-358.927) (-360.905) -- 0:00:15
754500 -- (-359.824) [-359.596] (-360.856) (-358.090) * (-358.659) (-359.201) (-358.696) [-358.295] -- 0:00:15
755000 -- (-359.883) (-358.223) (-362.403) [-360.775] * (-361.505) (-361.590) (-357.651) [-358.313] -- 0:00:15
Average standard deviation of split frequencies: 0.010150
755500 -- [-356.782] (-358.609) (-358.880) (-358.915) * (-356.985) (-358.860) (-361.191) [-359.254] -- 0:00:15
756000 -- (-357.399) (-358.508) (-358.828) [-358.460] * (-360.251) (-358.722) (-360.283) [-359.728] -- 0:00:15
756500 -- [-359.267] (-358.179) (-359.485) (-359.614) * (-356.793) (-359.003) [-356.945] (-359.339) -- 0:00:15
757000 -- (-359.230) (-358.017) (-358.849) [-358.143] * (-362.593) (-356.970) [-356.891] (-362.199) -- 0:00:15
757500 -- (-356.654) (-360.518) (-359.377) [-358.113] * (-358.514) (-356.429) (-356.943) [-359.596] -- 0:00:15
758000 -- [-358.261] (-362.310) (-358.117) (-357.954) * (-358.617) (-357.694) (-360.040) [-359.938] -- 0:00:15
758500 -- (-358.865) (-357.562) [-358.608] (-358.002) * (-359.926) (-358.719) (-361.587) [-364.955] -- 0:00:15
759000 -- (-358.727) (-358.195) [-357.628] (-357.424) * (-359.335) [-357.191] (-358.697) (-358.021) -- 0:00:15
759500 -- (-358.862) (-359.903) (-359.738) [-357.570] * [-358.299] (-357.947) (-360.867) (-358.945) -- 0:00:15
760000 -- [-357.028] (-357.707) (-359.553) (-356.664) * (-362.531) [-360.981] (-358.791) (-364.096) -- 0:00:15
Average standard deviation of split frequencies: 0.009952
760500 -- [-358.036] (-356.597) (-363.900) (-357.451) * (-359.610) [-360.518] (-358.452) (-361.240) -- 0:00:15
761000 -- (-359.123) [-357.279] (-358.871) (-359.277) * (-359.261) (-356.667) [-357.057] (-359.007) -- 0:00:15
761500 -- (-357.069) [-360.278] (-361.224) (-360.643) * (-361.136) (-357.052) (-358.831) [-358.065] -- 0:00:15
762000 -- (-358.565) (-361.685) [-359.229] (-359.927) * (-359.665) (-358.450) (-358.112) [-357.117] -- 0:00:15
762500 -- (-360.139) (-363.729) (-358.897) [-356.696] * (-357.960) [-357.428] (-358.348) (-357.282) -- 0:00:15
763000 -- [-357.998] (-358.738) (-359.330) (-357.775) * (-357.709) (-370.294) (-360.023) [-357.626] -- 0:00:15
763500 -- (-359.339) [-358.131] (-356.715) (-356.911) * (-359.923) (-358.602) (-359.125) [-357.474] -- 0:00:15
764000 -- (-358.015) (-356.799) (-356.761) [-359.444] * (-361.796) (-357.007) (-357.673) [-356.746] -- 0:00:15
764500 -- (-358.926) [-360.923] (-357.660) (-357.767) * (-357.862) (-358.528) [-357.116] (-356.836) -- 0:00:15
765000 -- (-358.705) (-358.657) (-362.850) [-356.692] * (-360.211) (-358.649) [-356.557] (-357.513) -- 0:00:15
Average standard deviation of split frequencies: 0.009774
765500 -- (-361.741) (-358.990) (-357.854) [-356.677] * (-363.417) (-359.829) [-357.044] (-360.704) -- 0:00:15
766000 -- (-358.862) (-359.081) [-360.249] (-359.917) * [-357.403] (-359.193) (-357.601) (-358.185) -- 0:00:15
766500 -- (-359.614) (-361.200) (-361.007) [-359.459] * (-358.113) [-357.422] (-359.374) (-359.058) -- 0:00:15
767000 -- [-357.917] (-364.153) (-360.477) (-358.167) * (-360.974) (-358.030) [-362.179] (-358.502) -- 0:00:15
767500 -- (-360.074) (-359.279) (-361.441) [-357.720] * (-358.664) [-359.480] (-359.972) (-358.266) -- 0:00:15
768000 -- (-359.257) (-358.103) [-357.953] (-360.230) * (-358.175) (-359.122) [-360.674] (-358.130) -- 0:00:15
768500 -- (-359.370) (-358.113) [-358.116] (-358.630) * (-363.101) [-358.637] (-360.587) (-358.725) -- 0:00:15
769000 -- [-357.687] (-359.571) (-357.487) (-361.230) * (-360.292) [-358.562] (-356.581) (-357.049) -- 0:00:15
769500 -- [-356.780] (-361.720) (-362.082) (-359.485) * (-358.805) (-358.900) [-356.745] (-357.173) -- 0:00:14
770000 -- (-356.635) (-359.945) (-358.761) [-357.479] * [-357.068] (-358.406) (-357.079) (-358.167) -- 0:00:14
Average standard deviation of split frequencies: 0.009535
770500 -- (-359.062) [-357.326] (-359.154) (-357.680) * [-357.931] (-360.785) (-359.932) (-358.715) -- 0:00:14
771000 -- (-361.615) (-357.559) [-357.258] (-362.365) * (-356.343) (-357.707) [-357.084] (-357.194) -- 0:00:14
771500 -- [-361.780] (-359.145) (-360.438) (-357.798) * (-360.863) (-365.818) [-357.045] (-358.047) -- 0:00:14
772000 -- [-358.259] (-359.888) (-358.498) (-357.162) * (-358.086) [-361.487] (-358.400) (-358.863) -- 0:00:14
772500 -- (-358.522) (-358.505) (-359.203) [-360.964] * (-358.338) [-358.684] (-362.083) (-359.419) -- 0:00:14
773000 -- [-358.065] (-360.520) (-357.875) (-358.354) * (-358.547) [-356.689] (-360.010) (-358.944) -- 0:00:14
773500 -- (-359.643) (-357.733) (-356.300) [-356.823] * [-356.710] (-360.550) (-358.345) (-360.283) -- 0:00:14
774000 -- (-361.700) (-360.550) (-358.702) [-360.265] * (-356.771) (-362.581) [-356.850] (-360.113) -- 0:00:14
774500 -- (-360.207) [-361.640] (-357.846) (-358.620) * (-358.222) [-360.715] (-357.319) (-359.422) -- 0:00:14
775000 -- [-359.396] (-361.083) (-357.296) (-360.647) * (-359.606) (-357.762) (-358.337) [-358.062] -- 0:00:14
Average standard deviation of split frequencies: 0.009219
775500 -- [-358.987] (-359.192) (-357.570) (-360.729) * (-357.453) [-358.629] (-361.034) (-357.849) -- 0:00:14
776000 -- (-360.452) (-358.438) [-358.879] (-359.682) * (-359.701) (-358.132) [-359.605] (-357.420) -- 0:00:14
776500 -- (-363.423) (-361.874) (-358.762) [-360.418] * (-364.238) [-357.253] (-358.175) (-357.574) -- 0:00:14
777000 -- (-359.344) (-362.473) [-359.580] (-359.189) * (-357.871) (-357.840) [-358.384] (-357.271) -- 0:00:14
777500 -- [-359.184] (-358.406) (-357.996) (-360.819) * [-360.786] (-357.950) (-364.165) (-359.312) -- 0:00:14
778000 -- (-359.275) (-361.433) [-357.950] (-358.043) * [-356.588] (-363.897) (-363.433) (-360.309) -- 0:00:14
778500 -- [-356.791] (-357.221) (-357.808) (-359.245) * (-360.139) [-362.415] (-362.537) (-360.125) -- 0:00:14
779000 -- (-357.120) [-357.692] (-357.804) (-361.953) * [-357.415] (-359.818) (-356.475) (-358.373) -- 0:00:14
779500 -- (-359.325) [-359.197] (-362.983) (-358.779) * (-358.904) (-358.084) (-359.049) [-359.905] -- 0:00:14
780000 -- (-358.169) (-358.905) [-358.166] (-361.855) * (-359.498) (-363.358) (-360.747) [-361.052] -- 0:00:14
Average standard deviation of split frequencies: 0.009306
780500 -- (-359.532) (-360.230) [-358.424] (-357.992) * (-360.870) (-358.311) (-357.575) [-358.303] -- 0:00:14
781000 -- [-357.353] (-357.509) (-358.033) (-359.503) * (-356.791) (-358.837) [-358.463] (-356.692) -- 0:00:14
781500 -- (-356.998) (-357.365) (-362.181) [-359.025] * (-356.418) [-360.564] (-361.455) (-356.543) -- 0:00:14
782000 -- (-357.121) [-358.485] (-362.030) (-357.406) * [-362.052] (-360.460) (-360.303) (-358.189) -- 0:00:14
782500 -- (-358.161) (-358.689) [-359.852] (-360.525) * (-357.981) (-359.188) [-360.009] (-357.975) -- 0:00:14
783000 -- [-358.721] (-359.678) (-357.069) (-357.950) * (-363.167) (-359.748) [-358.877] (-356.733) -- 0:00:14
783500 -- (-363.847) [-356.839] (-357.634) (-361.128) * (-362.687) (-358.786) [-358.378] (-359.811) -- 0:00:14
784000 -- (-359.635) (-358.666) [-357.722] (-358.671) * (-357.813) (-357.165) (-362.889) [-361.218] -- 0:00:14
784500 -- (-360.050) [-357.687] (-357.703) (-357.987) * [-358.100] (-356.980) (-359.127) (-358.579) -- 0:00:14
785000 -- (-356.793) [-357.585] (-357.261) (-357.345) * [-362.711] (-357.523) (-359.838) (-357.785) -- 0:00:13
Average standard deviation of split frequencies: 0.009173
785500 -- (-360.611) (-357.051) [-357.433] (-360.822) * (-357.250) (-361.336) [-359.999] (-358.112) -- 0:00:13
786000 -- (-365.494) [-359.848] (-357.242) (-359.275) * (-358.410) (-359.075) (-360.276) [-357.106] -- 0:00:13
786500 -- (-356.689) (-357.282) [-356.997] (-358.752) * [-357.760] (-360.322) (-359.714) (-357.878) -- 0:00:13
787000 -- [-357.959] (-356.698) (-357.592) (-357.412) * (-359.517) (-358.619) [-359.399] (-361.629) -- 0:00:13
787500 -- (-358.878) [-356.993] (-358.008) (-359.380) * [-359.793] (-359.228) (-359.401) (-359.353) -- 0:00:13
788000 -- (-363.091) [-358.138] (-358.828) (-362.429) * [-360.686] (-357.714) (-357.485) (-358.024) -- 0:00:13
788500 -- [-362.345] (-361.906) (-361.818) (-359.753) * [-357.411] (-365.875) (-357.933) (-359.384) -- 0:00:13
789000 -- (-357.144) (-360.053) [-359.235] (-361.057) * (-357.574) (-360.248) (-357.132) [-358.445] -- 0:00:13
789500 -- (-358.687) [-359.333] (-359.258) (-357.772) * [-358.979] (-359.566) (-358.749) (-358.822) -- 0:00:13
790000 -- (-358.827) [-356.944] (-358.299) (-359.608) * (-360.460) (-356.894) (-358.261) [-357.498] -- 0:00:13
Average standard deviation of split frequencies: 0.008978
790500 -- (-357.527) (-360.925) [-357.811] (-362.119) * (-363.073) (-359.313) [-359.429] (-360.724) -- 0:00:13
791000 -- (-357.763) [-356.733] (-357.753) (-362.355) * (-361.778) (-359.159) (-358.224) [-358.943] -- 0:00:13
791500 -- (-358.684) (-358.007) (-358.143) [-358.056] * (-363.028) (-359.774) [-358.414] (-358.532) -- 0:00:13
792000 -- (-359.227) (-361.123) [-358.649] (-359.061) * (-361.087) (-356.699) [-358.187] (-360.177) -- 0:00:13
792500 -- (-358.527) [-358.428] (-360.658) (-360.880) * (-358.503) [-356.733] (-357.013) (-357.943) -- 0:00:13
793000 -- (-359.177) (-361.430) (-359.642) [-358.115] * (-356.793) (-358.091) [-360.011] (-358.562) -- 0:00:13
793500 -- [-358.285] (-364.343) (-359.772) (-359.649) * (-356.989) (-358.138) [-362.602] (-358.610) -- 0:00:13
794000 -- (-358.815) (-359.903) (-361.044) [-359.474] * (-359.620) [-357.172] (-361.440) (-357.619) -- 0:00:13
794500 -- [-361.660] (-358.735) (-360.999) (-357.671) * (-357.335) (-357.400) (-356.952) [-356.843] -- 0:00:13
795000 -- (-357.746) (-361.990) (-359.842) [-358.746] * [-357.994] (-361.563) (-358.882) (-358.309) -- 0:00:13
Average standard deviation of split frequencies: 0.009232
795500 -- [-358.862] (-358.473) (-360.706) (-357.413) * (-358.902) [-357.735] (-358.093) (-359.156) -- 0:00:13
796000 -- (-358.791) [-360.113] (-360.121) (-356.697) * (-358.503) [-361.446] (-357.221) (-358.115) -- 0:00:13
796500 -- (-359.853) (-362.148) [-359.342] (-357.332) * (-360.827) [-358.798] (-358.867) (-358.597) -- 0:00:13
797000 -- (-359.971) (-369.429) (-358.428) [-358.530] * (-362.704) (-359.021) (-358.387) [-358.419] -- 0:00:13
797500 -- [-359.298] (-361.404) (-358.854) (-357.946) * (-358.119) (-360.801) [-358.485] (-357.615) -- 0:00:13
798000 -- (-358.910) (-359.218) (-359.083) [-357.009] * (-359.678) (-371.412) (-358.866) [-359.895] -- 0:00:13
798500 -- (-359.632) (-361.595) [-358.855] (-361.620) * (-359.332) (-361.068) [-360.507] (-357.113) -- 0:00:13
799000 -- (-360.825) [-359.258] (-357.546) (-360.098) * (-357.940) (-360.871) (-363.170) [-356.836] -- 0:00:13
799500 -- [-362.178] (-361.700) (-357.476) (-361.303) * (-357.743) (-357.042) (-358.972) [-358.824] -- 0:00:13
800000 -- (-361.984) (-362.738) [-357.050] (-359.681) * [-357.360] (-359.285) (-356.956) (-359.012) -- 0:00:12
Average standard deviation of split frequencies: 0.008970
800500 -- (-358.341) (-363.868) (-359.382) [-356.506] * (-358.381) (-358.333) (-357.177) [-357.463] -- 0:00:12
801000 -- (-358.671) (-362.508) (-359.712) [-362.954] * (-357.812) (-359.323) (-364.716) [-358.031] -- 0:00:12
801500 -- (-357.667) (-361.467) (-358.065) [-356.828] * (-362.245) (-358.360) (-362.555) [-358.350] -- 0:00:12
802000 -- (-361.694) [-357.065] (-357.101) (-357.131) * [-359.966] (-358.909) (-358.991) (-361.270) -- 0:00:12
802500 -- (-358.558) (-359.224) (-356.863) [-360.307] * (-359.021) (-357.236) (-357.712) [-357.747] -- 0:00:12
803000 -- (-357.108) (-359.246) (-357.681) [-357.514] * [-357.415] (-362.007) (-357.858) (-358.732) -- 0:00:12
803500 -- [-359.396] (-360.403) (-365.373) (-359.914) * [-358.513] (-357.913) (-358.663) (-358.488) -- 0:00:12
804000 -- [-358.117] (-359.355) (-357.547) (-358.680) * (-360.977) (-358.503) [-357.733] (-357.836) -- 0:00:12
804500 -- (-359.153) [-359.481] (-357.322) (-361.900) * (-359.491) (-358.307) (-358.078) [-357.656] -- 0:00:12
805000 -- (-358.081) [-362.453] (-359.816) (-357.646) * (-360.071) (-359.965) (-359.009) [-356.577] -- 0:00:12
Average standard deviation of split frequencies: 0.008635
805500 -- (-359.055) [-359.249] (-358.830) (-357.135) * [-359.577] (-358.590) (-357.690) (-359.243) -- 0:00:12
806000 -- [-358.861] (-357.314) (-358.850) (-357.792) * (-357.415) (-357.768) [-359.933] (-357.006) -- 0:00:12
806500 -- (-358.863) (-357.438) [-359.012] (-358.308) * (-359.221) (-356.917) [-358.221] (-360.906) -- 0:00:12
807000 -- (-358.400) (-359.018) [-358.282] (-359.744) * (-360.990) (-358.845) [-360.747] (-358.624) -- 0:00:12
807500 -- (-360.242) [-359.369] (-358.596) (-359.382) * [-359.077] (-357.613) (-360.205) (-358.898) -- 0:00:12
808000 -- (-359.895) (-358.672) (-360.287) [-359.920] * (-358.414) (-357.836) [-356.467] (-359.367) -- 0:00:12
808500 -- (-356.859) (-361.197) [-356.954] (-359.552) * (-359.536) (-357.726) [-357.336] (-359.585) -- 0:00:12
809000 -- [-357.794] (-364.589) (-357.522) (-357.392) * (-359.192) [-358.384] (-359.377) (-364.539) -- 0:00:12
809500 -- (-359.170) (-357.558) (-359.966) [-358.898] * (-357.571) (-358.716) (-359.059) [-357.349] -- 0:00:12
810000 -- (-356.833) [-359.393] (-358.726) (-359.858) * [-356.717] (-360.461) (-356.888) (-358.093) -- 0:00:12
Average standard deviation of split frequencies: 0.008686
810500 -- (-356.946) (-357.805) [-360.509] (-357.450) * [-356.701] (-363.821) (-358.098) (-361.985) -- 0:00:12
811000 -- (-357.869) (-358.382) [-359.274] (-359.793) * (-357.404) [-357.246] (-359.953) (-361.714) -- 0:00:12
811500 -- (-361.568) (-358.484) (-367.595) [-361.240] * (-357.718) (-357.311) [-357.750] (-361.141) -- 0:00:12
812000 -- [-359.777] (-358.723) (-364.703) (-362.078) * (-358.066) [-359.584] (-358.130) (-357.211) -- 0:00:12
812500 -- (-358.588) [-358.809] (-362.671) (-358.043) * (-359.736) (-359.169) [-358.042] (-358.817) -- 0:00:12
813000 -- (-357.609) [-361.942] (-358.166) (-359.037) * (-358.590) [-357.928] (-359.609) (-359.451) -- 0:00:12
813500 -- (-358.111) (-361.095) [-356.771] (-357.450) * [-358.060] (-361.094) (-360.718) (-356.646) -- 0:00:12
814000 -- (-362.018) (-358.006) [-357.709] (-356.785) * (-361.418) (-360.857) (-359.916) [-359.116] -- 0:00:12
814500 -- (-362.639) [-357.211] (-361.009) (-358.675) * (-361.952) (-357.551) [-356.772] (-361.972) -- 0:00:12
815000 -- (-361.575) (-359.633) (-358.544) [-359.259] * (-362.979) (-358.610) [-357.236] (-359.086) -- 0:00:12
Average standard deviation of split frequencies: 0.008846
815500 -- [-359.042] (-359.337) (-363.103) (-359.017) * (-359.170) (-358.834) [-357.135] (-357.154) -- 0:00:11
816000 -- (-358.610) [-357.705] (-363.270) (-361.430) * (-360.736) [-357.481] (-357.669) (-359.392) -- 0:00:11
816500 -- [-356.573] (-360.290) (-363.150) (-358.684) * (-357.542) (-360.793) (-357.408) [-359.076] -- 0:00:11
817000 -- (-359.804) (-357.633) (-362.893) [-358.839] * (-359.326) [-358.614] (-360.792) (-357.757) -- 0:00:11
817500 -- (-357.229) [-358.415] (-362.194) (-356.889) * (-359.418) (-357.110) [-357.407] (-357.859) -- 0:00:11
818000 -- (-356.570) [-359.495] (-362.713) (-357.688) * (-357.782) (-360.033) [-359.198] (-358.565) -- 0:00:11
818500 -- [-356.886] (-359.300) (-365.283) (-359.491) * (-358.039) (-359.223) [-356.587] (-357.228) -- 0:00:11
819000 -- (-359.857) (-358.824) (-359.688) [-360.817] * (-359.964) (-357.229) (-357.379) [-357.136] -- 0:00:11
819500 -- (-363.056) (-358.903) [-357.112] (-358.822) * (-357.426) [-360.066] (-358.680) (-360.251) -- 0:00:11
820000 -- (-359.556) [-359.124] (-360.285) (-356.903) * [-357.283] (-360.035) (-358.424) (-362.126) -- 0:00:11
Average standard deviation of split frequencies: 0.008473
820500 -- (-356.574) (-361.898) (-360.839) [-360.025] * (-358.827) (-358.762) (-356.948) [-357.993] -- 0:00:11
821000 -- [-356.817] (-358.933) (-359.644) (-361.538) * (-359.191) [-359.719] (-361.381) (-364.020) -- 0:00:11
821500 -- [-356.974] (-357.892) (-359.457) (-360.019) * [-360.042] (-363.087) (-360.165) (-360.803) -- 0:00:11
822000 -- (-357.642) (-358.527) [-359.112] (-357.970) * (-358.950) (-357.916) [-359.225] (-360.496) -- 0:00:11
822500 -- (-358.320) [-358.843] (-359.370) (-358.583) * [-356.959] (-359.940) (-357.713) (-356.717) -- 0:00:11
823000 -- [-356.935] (-356.861) (-359.377) (-357.946) * (-358.749) [-361.030] (-357.166) (-358.445) -- 0:00:11
823500 -- (-357.090) (-357.404) (-359.143) [-358.312] * (-357.597) [-357.746] (-360.591) (-357.000) -- 0:00:11
824000 -- (-358.127) [-357.522] (-360.506) (-357.831) * [-358.411] (-358.712) (-359.284) (-362.837) -- 0:00:11
824500 -- (-360.482) (-358.140) (-359.555) [-358.019] * [-358.969] (-362.639) (-360.074) (-359.731) -- 0:00:11
825000 -- (-359.063) (-357.192) (-356.665) [-358.263] * (-358.909) (-361.812) [-359.019] (-358.551) -- 0:00:11
Average standard deviation of split frequencies: 0.008382
825500 -- (-357.718) (-358.135) (-357.324) [-358.034] * (-358.307) (-360.008) [-359.608] (-359.715) -- 0:00:11
826000 -- (-359.457) (-362.522) [-360.188] (-359.698) * (-361.655) [-362.821] (-358.774) (-358.801) -- 0:00:11
826500 -- [-358.366] (-359.617) (-358.614) (-358.680) * (-357.867) (-362.751) [-362.561] (-357.940) -- 0:00:11
827000 -- [-365.091] (-359.240) (-358.779) (-356.883) * [-356.456] (-359.022) (-357.327) (-357.890) -- 0:00:11
827500 -- (-357.794) (-359.611) (-364.602) [-358.218] * [-358.468] (-357.186) (-356.350) (-358.014) -- 0:00:11
828000 -- (-360.082) (-358.188) [-358.120] (-357.274) * (-356.943) (-358.571) (-357.839) [-360.709] -- 0:00:11
828500 -- (-359.944) [-358.894] (-359.296) (-365.025) * (-359.483) (-357.715) [-358.167] (-357.902) -- 0:00:11
829000 -- (-357.618) (-357.407) [-362.162] (-357.983) * (-358.843) (-357.570) [-358.228] (-358.123) -- 0:00:11
829500 -- (-359.176) [-357.648] (-359.785) (-358.028) * [-359.119] (-359.637) (-356.956) (-357.238) -- 0:00:11
830000 -- (-358.095) (-359.854) (-357.915) [-358.663] * (-357.234) (-357.642) (-357.260) [-358.894] -- 0:00:11
Average standard deviation of split frequencies: 0.008442
830500 -- (-360.800) (-361.828) [-361.744] (-357.429) * (-357.239) [-358.186] (-357.284) (-358.123) -- 0:00:11
831000 -- (-360.008) (-360.822) (-360.054) [-357.438] * (-359.539) (-359.147) (-357.026) [-357.343] -- 0:00:10
831500 -- (-357.835) [-357.896] (-358.786) (-361.379) * (-359.994) [-357.746] (-356.935) (-356.665) -- 0:00:10
832000 -- (-359.790) (-358.528) [-357.512] (-360.219) * (-359.393) (-360.213) (-360.063) [-361.850] -- 0:00:10
832500 -- [-358.596] (-358.608) (-357.745) (-358.160) * (-358.609) (-357.891) [-357.632] (-358.737) -- 0:00:10
833000 -- [-358.359] (-360.428) (-359.420) (-358.268) * (-364.332) (-357.931) (-358.756) [-358.696] -- 0:00:10
833500 -- (-359.020) (-359.810) (-356.990) [-358.692] * (-359.542) (-361.959) [-359.023] (-361.368) -- 0:00:10
834000 -- [-356.796] (-361.164) (-357.946) (-358.182) * (-357.440) (-359.149) (-359.399) [-360.291] -- 0:00:10
834500 -- (-358.547) (-360.700) (-357.817) [-358.403] * (-358.531) (-360.223) [-359.671] (-357.313) -- 0:00:10
835000 -- [-358.058] (-361.371) (-358.311) (-358.338) * [-361.372] (-359.114) (-362.602) (-360.613) -- 0:00:10
Average standard deviation of split frequencies: 0.008141
835500 -- (-357.979) (-360.296) (-363.218) [-358.444] * [-359.015] (-360.674) (-361.427) (-358.387) -- 0:00:10
836000 -- [-359.678] (-360.320) (-357.683) (-365.640) * (-359.766) (-362.823) [-357.026] (-357.452) -- 0:00:10
836500 -- (-357.982) (-358.295) [-362.345] (-359.389) * (-357.546) (-358.327) [-358.916] (-359.649) -- 0:00:10
837000 -- [-360.589] (-358.062) (-363.254) (-360.903) * (-359.972) [-357.395] (-358.162) (-359.224) -- 0:00:10
837500 -- (-358.039) [-360.886] (-361.164) (-357.304) * (-359.946) (-357.401) [-357.324] (-357.513) -- 0:00:10
838000 -- (-357.618) (-357.892) [-360.964] (-359.346) * (-360.452) [-359.137] (-359.363) (-357.151) -- 0:00:10
838500 -- (-360.230) (-360.366) [-362.143] (-357.385) * (-362.584) (-357.249) (-359.327) [-362.456] -- 0:00:10
839000 -- [-365.214] (-362.059) (-359.868) (-357.843) * (-357.093) (-356.810) (-358.718) [-360.267] -- 0:00:10
839500 -- (-364.692) [-360.534] (-359.584) (-358.346) * (-357.355) [-359.856] (-365.547) (-359.225) -- 0:00:10
840000 -- (-361.852) (-361.222) [-358.112] (-356.700) * (-360.746) (-356.910) (-360.659) [-357.306] -- 0:00:10
Average standard deviation of split frequencies: 0.008061
840500 -- [-359.274] (-360.685) (-358.248) (-357.317) * (-359.425) (-357.440) [-359.361] (-359.658) -- 0:00:10
841000 -- (-357.835) [-358.717] (-357.044) (-357.347) * [-360.098] (-360.509) (-358.322) (-358.632) -- 0:00:10
841500 -- [-357.257] (-359.103) (-357.386) (-357.584) * (-360.931) (-358.666) (-359.383) [-357.761] -- 0:00:10
842000 -- (-360.875) [-356.700] (-356.918) (-358.105) * [-356.449] (-358.893) (-360.140) (-361.033) -- 0:00:10
842500 -- [-357.724] (-358.840) (-357.845) (-357.375) * (-358.971) [-357.081] (-358.983) (-361.859) -- 0:00:10
843000 -- (-364.074) (-357.140) [-357.675] (-363.273) * (-359.663) (-359.119) [-357.862] (-359.813) -- 0:00:10
843500 -- (-357.289) (-358.860) (-359.497) [-359.862] * (-357.817) (-358.455) (-359.046) [-360.082] -- 0:00:10
844000 -- (-356.526) (-357.973) [-357.670] (-357.567) * (-360.531) [-357.837] (-363.806) (-364.257) -- 0:00:10
844500 -- (-357.135) (-359.235) [-358.015] (-356.980) * [-357.328] (-358.792) (-362.146) (-361.681) -- 0:00:10
845000 -- (-357.946) [-357.081] (-358.734) (-357.064) * (-361.417) [-358.296] (-364.602) (-358.992) -- 0:00:10
Average standard deviation of split frequencies: 0.008114
845500 -- (-357.867) [-358.751] (-361.265) (-358.489) * (-358.392) (-358.915) [-361.781] (-361.362) -- 0:00:10
846000 -- [-358.038] (-358.453) (-361.250) (-359.982) * [-357.605] (-358.871) (-361.659) (-358.196) -- 0:00:10
846500 -- [-363.792] (-357.680) (-360.003) (-356.323) * (-360.216) (-356.925) (-358.319) [-358.850] -- 0:00:09
847000 -- (-360.981) [-358.113] (-357.739) (-357.316) * (-362.296) (-358.007) (-360.256) [-358.823] -- 0:00:09
847500 -- (-357.434) [-358.176] (-357.569) (-356.792) * (-360.781) (-357.738) (-357.988) [-358.951] -- 0:00:09
848000 -- (-361.071) [-359.214] (-357.949) (-357.280) * (-359.577) (-357.735) (-359.080) [-357.518] -- 0:00:09
848500 -- (-363.835) (-358.826) [-358.356] (-367.968) * (-359.647) [-358.457] (-358.577) (-357.329) -- 0:00:09
849000 -- (-361.746) [-360.378] (-357.372) (-359.215) * [-357.777] (-358.959) (-359.866) (-359.956) -- 0:00:09
849500 -- (-363.370) (-356.738) [-357.749] (-359.477) * (-363.290) [-359.595] (-361.358) (-359.355) -- 0:00:09
850000 -- [-363.079] (-356.670) (-357.429) (-358.085) * (-359.388) [-358.588] (-357.992) (-359.533) -- 0:00:09
Average standard deviation of split frequencies: 0.007758
850500 -- (-360.938) (-358.012) (-359.964) [-358.006] * (-358.735) (-359.057) (-357.993) [-358.669] -- 0:00:09
851000 -- (-358.918) (-358.530) (-357.631) [-358.135] * (-358.226) (-358.885) (-360.071) [-357.491] -- 0:00:09
851500 -- (-359.978) (-360.710) [-360.873] (-358.914) * (-356.914) (-360.665) (-360.265) [-357.053] -- 0:00:09
852000 -- (-358.782) (-358.265) [-361.660] (-357.505) * [-358.565] (-357.178) (-358.951) (-357.252) -- 0:00:09
852500 -- [-359.496] (-357.959) (-362.042) (-361.670) * (-357.610) (-358.247) (-359.222) [-356.763] -- 0:00:09
853000 -- [-358.785] (-361.382) (-364.680) (-358.707) * (-356.801) [-356.615] (-358.014) (-359.170) -- 0:00:09
853500 -- (-358.516) (-358.803) (-358.184) [-358.145] * [-358.111] (-358.075) (-361.922) (-358.159) -- 0:00:09
854000 -- (-360.934) [-361.111] (-362.014) (-360.451) * (-359.015) (-359.980) [-360.843] (-359.849) -- 0:00:09
854500 -- [-357.978] (-360.782) (-357.510) (-358.999) * (-357.545) (-364.140) [-358.946] (-359.787) -- 0:00:09
855000 -- (-360.401) (-360.094) (-356.644) [-357.637] * (-360.399) (-358.464) (-363.088) [-360.926] -- 0:00:09
Average standard deviation of split frequencies: 0.007985
855500 -- (-357.595) (-357.432) [-358.011] (-357.142) * (-358.628) (-362.071) (-359.972) [-358.251] -- 0:00:09
856000 -- (-360.909) (-360.012) [-358.039] (-358.531) * [-358.823] (-358.800) (-368.736) (-359.163) -- 0:00:09
856500 -- [-362.490] (-358.363) (-356.598) (-358.584) * (-357.674) [-358.019] (-359.169) (-359.762) -- 0:00:09
857000 -- (-361.257) [-359.917] (-357.658) (-362.109) * (-358.811) (-359.731) [-356.987] (-358.093) -- 0:00:09
857500 -- [-362.618] (-357.474) (-357.214) (-358.978) * (-357.989) (-357.688) [-356.991] (-358.184) -- 0:00:09
858000 -- [-360.955] (-360.068) (-356.946) (-359.398) * [-357.860] (-357.965) (-360.214) (-359.815) -- 0:00:09
858500 -- (-358.298) [-358.423] (-358.519) (-360.075) * [-357.058] (-356.570) (-362.188) (-360.196) -- 0:00:09
859000 -- (-359.153) [-360.438] (-357.634) (-357.984) * (-358.311) (-357.605) (-358.569) [-357.999] -- 0:00:09
859500 -- (-358.978) (-361.380) [-357.133] (-357.602) * [-358.175] (-357.078) (-357.447) (-360.583) -- 0:00:08
860000 -- [-357.704] (-357.403) (-362.451) (-357.940) * (-359.506) (-358.301) (-358.106) [-359.014] -- 0:00:08
Average standard deviation of split frequencies: 0.007360
860500 -- (-358.552) (-357.469) [-357.796] (-358.440) * (-361.354) (-356.886) (-360.558) [-359.370] -- 0:00:09
861000 -- (-360.949) (-356.963) (-356.814) [-357.446] * (-358.012) (-358.785) [-358.072] (-361.496) -- 0:00:09
861500 -- (-358.321) (-357.207) (-359.285) [-357.382] * (-356.985) (-360.929) (-358.767) [-359.333] -- 0:00:09
862000 -- [-360.277] (-359.092) (-357.338) (-357.462) * (-357.957) (-360.795) [-360.796] (-358.100) -- 0:00:08
862500 -- (-360.222) [-358.082] (-358.663) (-357.638) * (-358.104) (-360.743) (-360.410) [-364.336] -- 0:00:08
863000 -- (-358.611) [-356.976] (-357.111) (-358.990) * (-357.261) [-357.726] (-360.136) (-364.953) -- 0:00:08
863500 -- (-357.326) (-358.383) [-357.276] (-364.875) * (-358.578) (-363.980) [-360.455] (-362.320) -- 0:00:08
864000 -- (-359.362) [-361.501] (-358.098) (-357.531) * (-359.509) (-360.966) (-358.915) [-359.507] -- 0:00:08
864500 -- (-358.927) (-362.992) [-356.735] (-357.960) * (-360.237) [-357.929] (-359.780) (-357.242) -- 0:00:08
865000 -- (-361.000) (-359.607) (-356.929) [-358.928] * (-361.212) (-365.736) [-359.086] (-358.382) -- 0:00:08
Average standard deviation of split frequencies: 0.006906
865500 -- (-359.076) [-358.571] (-359.344) (-362.260) * (-363.236) [-360.192] (-359.046) (-357.148) -- 0:00:08
866000 -- (-359.111) (-357.018) (-359.926) [-362.373] * [-359.629] (-366.099) (-359.884) (-357.258) -- 0:00:08
866500 -- (-358.063) (-360.493) (-362.287) [-359.253] * (-358.219) [-356.914] (-356.995) (-356.639) -- 0:00:08
867000 -- (-359.859) [-361.980] (-360.068) (-358.275) * [-358.156] (-358.056) (-359.174) (-357.443) -- 0:00:08
867500 -- (-360.057) (-357.493) (-361.167) [-359.640] * (-358.138) (-357.469) (-364.353) [-358.956] -- 0:00:08
868000 -- (-362.433) (-359.188) [-358.241] (-360.714) * (-357.255) (-358.126) [-360.160] (-357.601) -- 0:00:08
868500 -- (-362.717) (-357.675) (-363.320) [-360.945] * [-357.248] (-361.743) (-360.058) (-360.056) -- 0:00:08
869000 -- (-360.658) [-357.584] (-358.911) (-362.402) * [-358.562] (-360.783) (-360.353) (-365.691) -- 0:00:08
869500 -- (-359.605) (-357.468) [-356.723] (-358.581) * [-357.511] (-358.051) (-358.692) (-358.598) -- 0:00:08
870000 -- (-359.496) (-359.640) (-360.935) [-359.241] * (-358.543) [-359.317] (-357.259) (-360.352) -- 0:00:08
Average standard deviation of split frequencies: 0.006531
870500 -- [-358.051] (-358.061) (-361.186) (-362.497) * (-360.130) [-358.605] (-357.931) (-358.232) -- 0:00:08
871000 -- (-360.898) [-358.234] (-360.925) (-359.752) * (-359.406) (-358.120) [-360.105] (-356.489) -- 0:00:08
871500 -- (-357.630) (-357.640) [-364.472] (-360.421) * [-359.767] (-357.431) (-358.337) (-356.796) -- 0:00:08
872000 -- [-360.180] (-358.626) (-358.138) (-357.898) * (-358.430) (-357.725) (-358.585) [-357.195] -- 0:00:08
872500 -- (-358.703) (-358.186) (-356.824) [-358.518] * [-359.517] (-360.273) (-361.393) (-359.717) -- 0:00:08
873000 -- (-356.919) (-358.541) [-357.909] (-357.343) * (-361.775) (-361.212) (-365.115) [-358.935] -- 0:00:08
873500 -- [-356.751] (-357.965) (-359.015) (-358.128) * [-360.694] (-362.276) (-359.467) (-361.921) -- 0:00:08
874000 -- (-359.673) (-358.498) [-358.448] (-361.378) * (-361.168) [-358.284] (-358.254) (-361.469) -- 0:00:08
874500 -- (-359.810) [-357.657] (-357.137) (-362.594) * (-356.759) [-357.348] (-359.461) (-358.473) -- 0:00:08
875000 -- (-361.295) [-357.441] (-358.385) (-356.777) * (-359.247) (-358.440) (-359.094) [-358.556] -- 0:00:08
Average standard deviation of split frequencies: 0.006626
875500 -- (-357.903) (-357.625) [-357.182] (-359.141) * (-358.640) (-357.498) [-356.630] (-357.899) -- 0:00:07
876000 -- (-358.703) (-358.732) (-361.823) [-358.820] * [-359.195] (-357.444) (-357.026) (-357.992) -- 0:00:07
876500 -- [-357.502] (-360.234) (-358.320) (-356.858) * (-361.247) (-358.074) [-356.717] (-359.514) -- 0:00:07
877000 -- (-360.475) (-357.050) (-359.884) [-357.939] * (-362.777) (-362.992) (-357.361) [-359.437] -- 0:00:07
877500 -- (-360.013) [-358.646] (-363.378) (-359.439) * (-359.745) (-360.261) [-357.745] (-363.922) -- 0:00:07
878000 -- [-358.355] (-359.396) (-357.252) (-357.953) * (-359.090) (-358.819) [-360.477] (-361.490) -- 0:00:07
878500 -- [-357.419] (-360.969) (-359.742) (-357.434) * (-357.739) (-358.774) [-361.629] (-360.067) -- 0:00:07
879000 -- (-357.595) (-358.795) [-357.017] (-359.337) * [-358.303] (-359.234) (-357.612) (-362.700) -- 0:00:07
879500 -- (-363.390) [-361.169] (-358.394) (-360.588) * (-358.903) [-359.033] (-358.125) (-360.781) -- 0:00:07
880000 -- [-359.074] (-359.429) (-358.925) (-358.918) * [-357.348] (-360.103) (-363.648) (-358.166) -- 0:00:07
Average standard deviation of split frequencies: 0.006925
880500 -- [-359.119] (-358.339) (-358.385) (-358.987) * (-359.975) (-357.761) (-358.637) [-359.751] -- 0:00:07
881000 -- (-360.025) [-359.170] (-363.006) (-359.880) * (-356.900) [-358.360] (-357.892) (-363.200) -- 0:00:07
881500 -- (-358.495) [-356.859] (-360.779) (-359.432) * [-357.447] (-362.426) (-356.821) (-359.021) -- 0:00:07
882000 -- (-356.917) [-357.195] (-360.157) (-359.420) * (-358.771) (-359.189) (-357.903) [-357.641] -- 0:00:07
882500 -- [-357.601] (-360.534) (-357.614) (-359.074) * [-357.498] (-359.318) (-361.255) (-361.632) -- 0:00:07
883000 -- (-357.308) (-361.993) (-359.784) [-358.003] * [-358.202] (-363.839) (-358.372) (-357.242) -- 0:00:07
883500 -- (-357.130) (-367.156) [-359.589] (-358.465) * (-359.229) (-360.037) (-357.410) [-357.369] -- 0:00:07
884000 -- (-358.473) [-357.639] (-357.910) (-356.919) * (-358.799) [-358.073] (-360.728) (-359.558) -- 0:00:07
884500 -- [-358.669] (-363.034) (-358.901) (-357.986) * (-362.321) (-361.209) (-362.835) [-359.955] -- 0:00:07
885000 -- (-362.312) (-360.894) (-358.918) [-362.582] * [-363.517] (-361.535) (-362.291) (-362.317) -- 0:00:07
Average standard deviation of split frequencies: 0.006817
885500 -- [-357.992] (-362.198) (-358.948) (-359.337) * (-364.883) (-359.353) (-358.877) [-358.372] -- 0:00:07
886000 -- (-358.872) [-359.462] (-358.101) (-363.421) * (-357.732) (-361.066) (-358.510) [-360.305] -- 0:00:07
886500 -- [-356.511] (-356.596) (-359.416) (-360.335) * [-358.475] (-360.461) (-358.405) (-359.373) -- 0:00:07
887000 -- [-357.413] (-357.818) (-360.511) (-357.085) * (-357.639) [-359.650] (-357.515) (-357.645) -- 0:00:07
887500 -- [-357.403] (-357.520) (-357.734) (-358.390) * [-357.982] (-357.183) (-358.253) (-357.395) -- 0:00:07
888000 -- (-359.407) [-357.245] (-357.118) (-361.482) * (-358.952) [-358.937] (-361.075) (-358.328) -- 0:00:07
888500 -- (-359.988) (-360.109) [-358.451] (-357.340) * (-358.682) [-356.743] (-359.962) (-358.208) -- 0:00:07
889000 -- (-359.520) [-357.519] (-357.401) (-360.533) * (-359.559) (-359.467) (-357.206) [-356.520] -- 0:00:07
889500 -- (-361.985) [-356.425] (-358.833) (-359.355) * (-357.829) (-358.587) (-362.549) [-357.278] -- 0:00:07
890000 -- [-357.923] (-360.917) (-358.489) (-356.449) * [-357.780] (-359.139) (-358.950) (-359.023) -- 0:00:07
Average standard deviation of split frequencies: 0.007013
890500 -- (-358.815) (-360.795) (-359.476) [-357.462] * (-358.184) (-356.789) (-357.694) [-360.318] -- 0:00:07
891000 -- (-358.806) [-363.882] (-364.570) (-357.317) * [-356.626] (-357.652) (-357.581) (-360.205) -- 0:00:06
891500 -- (-358.455) (-363.947) [-360.333] (-358.342) * [-358.382] (-364.913) (-358.923) (-360.192) -- 0:00:06
892000 -- (-357.898) [-359.979] (-357.279) (-359.464) * (-358.788) (-361.938) [-361.211] (-360.477) -- 0:00:06
892500 -- (-361.075) (-356.991) (-356.768) [-359.423] * (-359.565) (-357.764) [-359.135] (-357.467) -- 0:00:06
893000 -- (-360.414) (-356.670) (-357.931) [-356.851] * (-357.576) (-357.981) [-358.593] (-358.763) -- 0:00:06
893500 -- (-358.554) [-356.765] (-358.926) (-357.711) * (-358.409) (-357.852) [-357.106] (-358.425) -- 0:00:06
894000 -- (-359.252) (-358.732) [-357.864] (-356.994) * (-364.638) (-359.974) (-357.106) [-358.851] -- 0:00:06
894500 -- [-359.494] (-357.960) (-356.391) (-359.777) * (-360.742) (-359.397) [-357.553] (-358.044) -- 0:00:06
895000 -- [-357.969] (-358.963) (-359.636) (-359.154) * (-357.645) [-359.045] (-357.381) (-358.490) -- 0:00:06
Average standard deviation of split frequencies: 0.006872
895500 -- (-358.324) (-359.692) (-359.008) [-356.903] * (-356.785) (-360.585) [-359.536] (-356.964) -- 0:00:06
896000 -- (-357.468) [-363.031] (-358.467) (-358.854) * [-358.786] (-364.865) (-359.777) (-357.471) -- 0:00:06
896500 -- (-357.426) [-361.304] (-359.113) (-365.008) * (-357.721) (-361.341) [-361.681] (-358.159) -- 0:00:06
897000 -- [-357.299] (-359.583) (-362.275) (-358.484) * [-361.801] (-358.352) (-358.274) (-358.531) -- 0:00:06
897500 -- (-358.659) (-358.571) (-356.785) [-359.153] * (-358.206) [-358.388] (-359.637) (-363.126) -- 0:00:06
898000 -- (-358.686) [-359.847] (-360.494) (-359.233) * [-360.243] (-357.013) (-357.365) (-359.702) -- 0:00:06
898500 -- [-358.882] (-358.078) (-359.217) (-360.171) * (-361.876) (-356.843) [-364.654] (-359.013) -- 0:00:06
899000 -- [-357.550] (-361.500) (-358.730) (-358.247) * (-357.288) (-358.101) [-364.422] (-357.294) -- 0:00:06
899500 -- (-358.194) [-360.079] (-360.915) (-357.372) * [-358.372] (-357.274) (-357.928) (-360.750) -- 0:00:06
900000 -- (-359.299) [-356.712] (-358.753) (-360.274) * (-359.484) [-359.280] (-358.656) (-359.469) -- 0:00:06
Average standard deviation of split frequencies: 0.006935
900500 -- (-357.536) (-358.042) (-358.139) [-358.916] * (-358.170) (-357.754) (-357.654) [-358.678] -- 0:00:06
901000 -- (-360.444) (-359.579) (-358.632) [-360.122] * [-359.162] (-357.656) (-358.866) (-356.859) -- 0:00:06
901500 -- (-357.257) [-359.334] (-358.680) (-359.502) * (-357.666) (-361.537) [-358.709] (-356.876) -- 0:00:06
902000 -- (-358.394) (-359.458) [-360.741] (-360.006) * [-358.036] (-367.206) (-358.170) (-358.531) -- 0:00:06
902500 -- (-360.046) (-358.087) (-361.650) [-357.492] * (-357.878) (-360.716) (-361.607) [-357.802] -- 0:00:06
903000 -- [-361.115] (-356.556) (-357.776) (-359.317) * (-359.749) [-358.125] (-358.928) (-357.464) -- 0:00:06
903500 -- (-359.176) [-357.300] (-358.834) (-357.607) * (-360.353) [-359.221] (-360.245) (-357.041) -- 0:00:06
904000 -- (-360.987) (-360.680) [-359.945] (-357.312) * (-360.836) [-358.410] (-360.135) (-356.819) -- 0:00:06
904500 -- [-357.941] (-357.779) (-357.492) (-359.150) * (-360.015) [-356.643] (-362.135) (-356.777) -- 0:00:06
905000 -- (-356.612) (-357.822) [-359.094] (-362.447) * (-361.712) (-364.053) [-359.794] (-357.646) -- 0:00:06
Average standard deviation of split frequencies: 0.006732
905500 -- (-357.633) [-359.865] (-357.818) (-360.360) * (-362.792) [-361.922] (-357.971) (-360.205) -- 0:00:06
906000 -- (-361.053) (-357.834) (-358.740) [-357.211] * [-360.692] (-362.532) (-359.965) (-357.685) -- 0:00:06
906500 -- (-359.729) (-357.714) (-360.916) [-358.972] * (-357.486) [-359.743] (-360.391) (-361.685) -- 0:00:05
907000 -- [-358.316] (-361.241) (-361.926) (-361.920) * (-357.254) (-359.098) [-358.644] (-359.711) -- 0:00:05
907500 -- (-359.053) [-357.914] (-359.265) (-357.853) * (-358.148) [-363.381] (-359.296) (-359.236) -- 0:00:05
908000 -- (-361.280) (-358.318) (-357.431) [-356.943] * (-361.722) (-360.449) [-358.932] (-358.284) -- 0:00:05
908500 -- (-361.780) (-358.826) (-357.044) [-358.368] * [-358.986] (-360.347) (-358.983) (-358.727) -- 0:00:05
909000 -- (-357.350) (-358.172) (-358.535) [-358.552] * (-361.415) [-361.077] (-359.097) (-358.830) -- 0:00:05
909500 -- [-356.841] (-360.005) (-357.487) (-359.011) * (-362.688) (-361.266) (-357.607) [-358.255] -- 0:00:05
910000 -- (-358.428) (-359.918) (-358.538) [-358.420] * (-361.144) [-358.908] (-359.736) (-359.972) -- 0:00:05
Average standard deviation of split frequencies: 0.006924
910500 -- (-357.285) (-357.009) (-358.541) [-359.940] * (-359.070) [-360.787] (-358.701) (-359.899) -- 0:00:05
911000 -- (-357.059) (-359.054) [-358.441] (-358.843) * (-361.276) [-357.303] (-357.729) (-360.133) -- 0:00:05
911500 -- (-358.419) (-356.962) (-359.217) [-357.363] * (-359.779) (-358.546) (-364.097) [-358.021] -- 0:00:05
912000 -- (-359.251) (-365.781) (-357.231) [-356.892] * (-357.733) [-356.767] (-360.192) (-360.876) -- 0:00:05
912500 -- (-359.087) (-359.230) (-356.933) [-357.059] * (-359.933) [-358.462] (-361.799) (-363.185) -- 0:00:05
913000 -- (-358.499) (-356.979) [-358.724] (-356.644) * (-359.372) [-357.755] (-360.842) (-362.119) -- 0:00:05
913500 -- (-358.978) (-359.619) (-360.613) [-356.516] * (-359.703) [-357.474] (-360.327) (-357.388) -- 0:00:05
914000 -- (-358.814) [-360.592] (-357.277) (-357.490) * (-360.773) (-358.392) (-359.271) [-357.739] -- 0:00:05
914500 -- [-358.344] (-358.684) (-357.666) (-360.819) * (-365.548) (-359.310) (-358.435) [-357.518] -- 0:00:05
915000 -- (-358.984) [-357.486] (-361.742) (-360.389) * (-361.381) [-362.089] (-360.298) (-358.527) -- 0:00:05
Average standard deviation of split frequencies: 0.007108
915500 -- [-360.313] (-357.020) (-357.080) (-372.516) * (-361.333) (-360.114) [-357.188] (-358.315) -- 0:00:05
916000 -- [-359.348] (-359.705) (-363.041) (-362.912) * [-359.327] (-360.364) (-357.085) (-357.983) -- 0:00:05
916500 -- (-359.146) [-360.221] (-361.297) (-359.563) * (-358.797) (-358.701) (-357.999) [-358.505] -- 0:00:05
917000 -- (-358.734) [-357.779] (-360.457) (-357.901) * (-359.685) (-358.400) [-360.183] (-359.684) -- 0:00:05
917500 -- [-357.301] (-360.362) (-358.914) (-358.656) * (-359.378) [-359.774] (-358.574) (-359.689) -- 0:00:05
918000 -- (-360.137) [-358.341] (-360.462) (-357.018) * (-357.819) (-361.061) [-358.925] (-362.483) -- 0:00:05
918500 -- [-358.894] (-362.014) (-362.095) (-358.947) * (-356.556) (-358.939) (-360.050) [-357.306] -- 0:00:05
919000 -- [-357.334] (-361.043) (-362.925) (-357.416) * (-357.032) (-358.039) (-360.444) [-358.247] -- 0:00:05
919500 -- (-359.166) (-360.530) [-359.519] (-358.058) * [-358.341] (-359.267) (-363.858) (-357.585) -- 0:00:05
920000 -- (-362.580) (-356.810) (-359.086) [-356.458] * (-360.561) [-359.382] (-357.019) (-357.744) -- 0:00:05
Average standard deviation of split frequencies: 0.007360
920500 -- (-357.771) (-360.471) (-359.163) [-358.272] * (-363.295) (-357.869) [-358.827] (-359.091) -- 0:00:05
921000 -- (-362.107) (-357.756) (-358.607) [-359.475] * (-358.961) (-357.200) (-358.620) [-359.032] -- 0:00:05
921500 -- [-358.910] (-358.258) (-358.401) (-361.131) * [-358.339] (-358.575) (-358.702) (-363.422) -- 0:00:05
922000 -- (-359.151) (-358.185) [-358.350] (-363.243) * (-359.237) (-357.523) [-360.042] (-358.242) -- 0:00:04
922500 -- (-359.663) (-359.862) [-359.933] (-359.678) * (-358.088) (-358.668) (-360.997) [-357.469] -- 0:00:04
923000 -- (-358.617) (-358.198) (-357.633) [-358.942] * (-358.078) [-358.542] (-357.648) (-360.442) -- 0:00:04
923500 -- (-359.935) [-358.573] (-357.377) (-358.663) * (-358.246) (-356.530) [-359.310] (-357.921) -- 0:00:04
924000 -- (-358.639) (-357.892) (-358.739) [-359.580] * [-357.766] (-363.657) (-359.258) (-362.100) -- 0:00:04
924500 -- (-359.333) [-358.988] (-357.692) (-358.753) * [-357.710] (-359.866) (-356.834) (-360.620) -- 0:00:04
925000 -- (-358.638) (-359.389) [-362.458] (-359.152) * (-358.181) (-360.166) (-360.349) [-358.111] -- 0:00:04
Average standard deviation of split frequencies: 0.007318
925500 -- (-357.310) [-357.457] (-360.118) (-362.900) * (-362.837) (-358.449) (-358.430) [-357.015] -- 0:00:04
926000 -- (-357.918) (-357.802) (-358.131) [-358.684] * (-360.447) (-359.217) (-361.526) [-357.145] -- 0:00:04
926500 -- (-361.309) [-356.594] (-359.668) (-358.237) * (-363.315) (-362.754) [-360.077] (-357.521) -- 0:00:04
927000 -- (-358.440) (-357.458) (-364.615) [-357.284] * (-358.284) [-361.816] (-362.035) (-358.464) -- 0:00:04
927500 -- (-356.897) [-357.038] (-362.368) (-356.854) * (-358.015) (-360.481) (-358.599) [-357.283] -- 0:00:04
928000 -- (-365.126) [-357.313] (-359.597) (-356.840) * (-357.921) (-356.938) (-357.155) [-358.840] -- 0:00:04
928500 -- [-358.957] (-358.142) (-361.534) (-357.565) * (-357.107) [-357.232] (-357.173) (-362.473) -- 0:00:04
929000 -- (-359.099) (-359.200) (-358.931) [-359.110] * (-358.224) [-356.746] (-357.630) (-357.813) -- 0:00:04
929500 -- [-359.028] (-361.215) (-358.298) (-357.682) * (-358.617) (-357.575) (-359.725) [-358.014] -- 0:00:04
930000 -- [-358.533] (-357.226) (-358.795) (-361.622) * (-358.229) [-357.001] (-361.887) (-358.885) -- 0:00:04
Average standard deviation of split frequencies: 0.007250
930500 -- [-358.017] (-361.872) (-359.825) (-359.268) * (-360.888) [-356.389] (-357.997) (-358.504) -- 0:00:04
931000 -- (-359.937) (-356.564) (-360.450) [-356.889] * [-358.673] (-359.405) (-359.337) (-362.744) -- 0:00:04
931500 -- [-359.795] (-358.763) (-357.091) (-357.703) * [-358.869] (-356.676) (-357.159) (-358.208) -- 0:00:04
932000 -- (-358.426) [-357.996] (-356.696) (-358.759) * (-357.363) [-362.352] (-361.871) (-362.080) -- 0:00:04
932500 -- (-359.835) (-360.386) [-358.458] (-357.542) * [-357.468] (-358.375) (-360.270) (-358.680) -- 0:00:04
933000 -- (-357.767) [-357.053] (-358.982) (-359.677) * (-359.150) [-358.100] (-358.926) (-360.221) -- 0:00:04
933500 -- (-361.118) (-356.880) (-358.759) [-365.459] * (-358.103) (-361.554) [-358.211] (-357.207) -- 0:00:04
934000 -- (-358.618) [-357.920] (-358.947) (-358.813) * [-359.458] (-358.779) (-359.587) (-357.853) -- 0:00:04
934500 -- (-357.151) [-358.966] (-356.538) (-359.880) * (-359.159) [-357.483] (-360.047) (-357.932) -- 0:00:04
935000 -- (-359.343) (-362.451) (-356.820) [-359.650] * (-358.769) (-356.789) [-358.468] (-359.563) -- 0:00:04
Average standard deviation of split frequencies: 0.007460
935500 -- (-361.054) (-358.938) [-359.183] (-358.478) * (-360.326) [-357.782] (-360.503) (-358.096) -- 0:00:04
936000 -- (-359.052) [-357.104] (-360.467) (-357.388) * (-358.204) (-362.182) [-360.145] (-358.175) -- 0:00:04
936500 -- (-359.075) [-357.571] (-356.502) (-361.789) * (-361.390) [-357.189] (-358.507) (-357.992) -- 0:00:04
937000 -- (-358.861) (-358.427) [-360.489] (-356.546) * [-360.788] (-357.979) (-358.950) (-357.370) -- 0:00:04
937500 -- (-358.974) (-359.818) (-358.057) [-360.239] * (-357.618) [-358.047] (-358.565) (-357.414) -- 0:00:04
938000 -- (-360.400) [-364.747] (-357.562) (-358.664) * (-359.484) (-359.775) [-357.190] (-363.522) -- 0:00:03
938500 -- (-358.440) (-358.061) [-359.485] (-357.694) * (-361.591) (-358.863) [-357.658] (-357.341) -- 0:00:03
939000 -- (-358.854) (-356.707) [-358.967] (-358.643) * (-360.974) (-358.985) (-359.892) [-359.226] -- 0:00:03
939500 -- (-359.006) (-361.748) (-359.369) [-359.295] * (-357.718) (-358.606) [-359.098] (-357.887) -- 0:00:03
940000 -- (-356.765) (-358.360) (-358.482) [-357.414] * (-361.410) (-357.945) (-357.803) [-357.535] -- 0:00:03
Average standard deviation of split frequencies: 0.007423
940500 -- (-359.332) [-359.754] (-358.644) (-358.780) * (-358.749) (-358.416) [-357.901] (-359.820) -- 0:00:03
941000 -- [-358.283] (-357.809) (-357.890) (-360.123) * [-358.186] (-358.852) (-361.618) (-359.304) -- 0:00:03
941500 -- (-358.683) [-359.368] (-358.870) (-360.117) * [-358.668] (-356.718) (-358.629) (-360.111) -- 0:00:03
942000 -- (-357.021) [-358.881] (-357.112) (-356.833) * [-356.982] (-357.537) (-365.023) (-358.663) -- 0:00:03
942500 -- (-356.858) (-357.882) [-367.398] (-357.472) * (-358.146) [-360.103] (-360.060) (-358.402) -- 0:00:03
943000 -- (-360.355) (-361.216) (-363.003) [-360.447] * [-359.323] (-358.773) (-361.194) (-356.832) -- 0:00:03
943500 -- [-356.809] (-358.062) (-360.079) (-360.059) * [-358.935] (-357.993) (-361.525) (-359.762) -- 0:00:03
944000 -- [-361.147] (-357.320) (-356.564) (-360.790) * (-360.595) (-357.634) (-364.551) [-360.614] -- 0:00:03
944500 -- (-357.020) (-357.357) [-361.458] (-359.729) * (-358.831) [-357.527] (-356.957) (-359.557) -- 0:00:03
945000 -- [-358.527] (-358.724) (-359.065) (-358.512) * [-358.149] (-359.369) (-359.418) (-358.682) -- 0:00:03
Average standard deviation of split frequencies: 0.007444
945500 -- (-359.739) (-362.544) [-362.040] (-357.460) * (-359.806) [-357.311] (-359.242) (-356.966) -- 0:00:03
946000 -- (-359.325) [-365.565] (-362.719) (-358.934) * (-357.222) (-358.474) [-361.275] (-358.511) -- 0:00:03
946500 -- (-357.540) (-358.520) [-358.425] (-358.740) * [-356.791] (-358.155) (-360.589) (-360.874) -- 0:00:03
947000 -- (-360.030) (-357.464) [-357.832] (-357.765) * (-358.648) (-357.032) [-358.287] (-359.036) -- 0:00:03
947500 -- (-359.072) (-359.826) (-358.162) [-361.338] * (-358.020) (-360.906) (-357.192) [-361.653] -- 0:00:03
948000 -- [-359.180] (-363.565) (-358.469) (-364.403) * (-357.515) (-361.168) [-357.202] (-364.767) -- 0:00:03
948500 -- (-358.565) (-357.786) [-357.330] (-357.862) * (-358.526) (-363.266) (-359.675) [-357.055] -- 0:00:03
949000 -- (-357.689) (-358.202) [-357.961] (-357.549) * [-360.817] (-361.350) (-362.572) (-357.255) -- 0:00:03
949500 -- (-357.736) (-358.759) (-358.860) [-358.046] * [-358.462] (-358.242) (-359.610) (-357.512) -- 0:00:03
950000 -- (-359.022) (-358.093) (-357.453) [-357.945] * (-357.400) (-357.745) [-356.769] (-362.630) -- 0:00:03
Average standard deviation of split frequencies: 0.007221
950500 -- (-357.752) (-358.622) [-358.320] (-357.730) * (-361.103) (-359.104) [-357.201] (-360.487) -- 0:00:03
951000 -- [-356.948] (-358.500) (-357.675) (-357.059) * (-366.282) (-359.640) [-358.942] (-360.757) -- 0:00:03
951500 -- (-357.046) (-362.012) (-359.202) [-363.890] * (-358.436) (-357.502) [-360.650] (-361.190) -- 0:00:03
952000 -- [-357.748] (-359.055) (-365.632) (-358.716) * [-357.945] (-357.968) (-357.970) (-358.381) -- 0:00:03
952500 -- (-356.975) (-358.851) (-358.643) [-356.371] * (-359.003) (-360.589) [-358.321] (-360.974) -- 0:00:03
953000 -- [-361.858] (-356.633) (-359.072) (-359.918) * (-360.737) (-360.006) [-357.645] (-359.065) -- 0:00:03
953500 -- (-357.368) (-356.513) (-357.248) [-357.709] * (-357.101) (-360.203) [-357.491] (-358.221) -- 0:00:02
954000 -- (-357.680) (-358.409) (-356.907) [-359.823] * (-359.776) [-357.906] (-360.827) (-358.165) -- 0:00:02
954500 -- (-356.740) (-358.906) [-357.336] (-357.253) * (-358.438) [-357.667] (-358.537) (-357.096) -- 0:00:02
955000 -- (-360.323) [-358.340] (-356.621) (-358.733) * (-361.068) [-359.248] (-358.284) (-357.214) -- 0:00:02
Average standard deviation of split frequencies: 0.006934
955500 -- (-358.458) (-358.896) (-359.423) [-357.687] * (-364.648) [-359.109] (-360.608) (-357.097) -- 0:00:02
956000 -- (-361.476) [-357.854] (-360.508) (-359.741) * (-357.371) [-357.654] (-361.174) (-357.089) -- 0:00:02
956500 -- (-358.193) [-361.631] (-359.453) (-359.854) * [-356.410] (-356.503) (-358.100) (-359.124) -- 0:00:02
957000 -- (-358.058) [-357.640] (-357.220) (-361.276) * (-356.610) [-358.823] (-359.555) (-359.842) -- 0:00:02
957500 -- (-361.679) (-359.304) [-358.434] (-360.692) * (-361.696) (-358.813) [-357.701] (-360.515) -- 0:00:02
958000 -- (-359.806) (-356.711) (-358.909) [-358.061] * [-359.550] (-359.329) (-359.038) (-359.350) -- 0:00:02
958500 -- (-358.769) (-357.162) [-356.536] (-361.801) * (-359.350) (-358.668) [-358.560] (-359.245) -- 0:00:02
959000 -- [-357.118] (-357.557) (-359.213) (-361.242) * [-359.699] (-359.273) (-358.487) (-357.283) -- 0:00:02
959500 -- (-358.849) (-356.893) [-359.429] (-358.233) * (-360.608) [-358.341] (-358.165) (-357.741) -- 0:00:02
960000 -- [-357.846] (-358.909) (-357.692) (-357.500) * (-356.347) (-357.156) [-357.499] (-357.077) -- 0:00:02
Average standard deviation of split frequencies: 0.006563
960500 -- (-360.617) (-357.944) (-357.794) [-359.050] * (-357.338) (-360.365) [-357.688] (-358.719) -- 0:00:02
961000 -- [-359.337] (-364.870) (-357.820) (-357.118) * (-357.619) (-358.940) (-357.858) [-360.492] -- 0:00:02
961500 -- [-357.617] (-360.661) (-360.635) (-360.158) * [-358.758] (-357.261) (-360.933) (-363.092) -- 0:00:02
962000 -- [-361.184] (-360.132) (-359.174) (-360.128) * (-359.281) (-358.678) [-361.107] (-361.832) -- 0:00:02
962500 -- (-360.097) (-359.998) [-364.478] (-356.736) * (-358.212) (-357.971) (-358.068) [-361.118] -- 0:00:02
963000 -- (-359.318) (-356.704) (-356.969) [-359.807] * (-358.465) [-357.434] (-358.059) (-360.175) -- 0:00:02
963500 -- (-358.628) [-357.038] (-357.617) (-357.405) * (-357.061) [-358.519] (-360.338) (-358.353) -- 0:00:02
964000 -- (-361.365) [-357.402] (-358.987) (-357.831) * (-359.110) (-366.397) (-359.726) [-358.277] -- 0:00:02
964500 -- (-361.117) (-356.650) [-358.667] (-358.536) * (-358.210) (-357.919) [-358.076] (-359.439) -- 0:00:02
965000 -- [-356.744] (-360.365) (-361.846) (-358.661) * [-357.603] (-362.191) (-360.738) (-361.727) -- 0:00:02
Average standard deviation of split frequencies: 0.006710
965500 -- [-360.325] (-358.128) (-358.848) (-356.571) * (-359.183) [-358.866] (-357.827) (-358.869) -- 0:00:02
966000 -- (-359.243) [-359.373] (-358.763) (-357.447) * (-357.462) [-357.805] (-356.689) (-357.930) -- 0:00:02
966500 -- (-357.452) [-358.579] (-358.102) (-358.159) * [-359.765] (-359.721) (-357.181) (-356.437) -- 0:00:02
967000 -- (-363.122) (-360.634) [-359.064] (-359.613) * (-359.537) (-358.994) [-356.949] (-361.061) -- 0:00:02
967500 -- (-358.781) [-358.239] (-359.063) (-360.264) * (-359.785) [-356.946] (-356.413) (-356.876) -- 0:00:02
968000 -- [-359.006] (-360.062) (-361.965) (-357.497) * (-358.089) [-357.266] (-358.520) (-356.663) -- 0:00:02
968500 -- (-359.689) [-357.581] (-359.891) (-360.485) * (-358.980) (-357.718) [-356.952] (-356.521) -- 0:00:02
969000 -- (-358.486) [-357.541] (-358.521) (-359.851) * (-357.452) (-357.677) (-356.956) [-358.060] -- 0:00:01
969500 -- (-365.714) (-359.574) [-356.761] (-356.734) * (-358.130) (-362.985) [-359.245] (-356.941) -- 0:00:01
970000 -- (-361.052) (-361.800) (-357.809) [-356.815] * (-358.547) [-358.897] (-360.069) (-359.039) -- 0:00:01
Average standard deviation of split frequencies: 0.006890
970500 -- (-360.820) (-360.292) [-359.943] (-358.199) * (-359.397) (-359.679) [-358.980] (-359.155) -- 0:00:01
971000 -- (-362.418) [-361.792] (-357.556) (-357.402) * [-359.208] (-358.333) (-357.809) (-358.822) -- 0:00:01
971500 -- (-359.232) [-359.073] (-358.948) (-358.057) * (-360.808) [-360.842] (-364.034) (-358.812) -- 0:00:01
972000 -- (-358.726) [-358.218] (-359.511) (-358.073) * (-359.530) (-360.417) (-360.125) [-359.172] -- 0:00:01
972500 -- [-356.820] (-358.701) (-357.997) (-357.103) * (-359.423) (-362.284) (-359.733) [-358.070] -- 0:00:01
973000 -- (-357.135) [-357.319] (-357.571) (-359.042) * (-357.384) [-364.958] (-357.100) (-359.897) -- 0:00:01
973500 -- (-358.111) (-359.041) [-356.702] (-357.500) * [-359.217] (-358.494) (-357.306) (-362.242) -- 0:00:01
974000 -- (-361.503) [-357.788] (-360.577) (-357.239) * (-359.005) (-357.690) (-359.365) [-357.592] -- 0:00:01
974500 -- [-361.426] (-359.466) (-361.213) (-357.927) * (-359.993) (-357.690) [-357.031] (-362.867) -- 0:00:01
975000 -- (-359.437) (-356.390) (-356.631) [-356.944] * (-358.782) [-361.116] (-359.159) (-365.729) -- 0:00:01
Average standard deviation of split frequencies: 0.006822
975500 -- (-356.755) (-358.325) [-356.618] (-359.177) * (-357.010) (-363.207) (-357.744) [-357.156] -- 0:00:01
976000 -- (-356.757) (-356.631) [-364.669] (-358.071) * [-356.927] (-357.199) (-358.369) (-360.975) -- 0:00:01
976500 -- [-358.210] (-356.822) (-360.398) (-361.687) * [-357.965] (-358.899) (-360.493) (-363.448) -- 0:00:01
977000 -- (-362.229) (-356.938) (-358.908) [-364.967] * [-363.976] (-358.250) (-358.111) (-360.533) -- 0:00:01
977500 -- (-358.403) [-358.708] (-358.509) (-358.782) * (-359.375) (-356.780) [-356.670] (-357.790) -- 0:00:01
978000 -- (-358.404) (-359.022) (-362.066) [-361.322] * (-358.805) (-358.561) (-362.214) [-356.678] -- 0:00:01
978500 -- (-359.074) (-359.557) [-358.703] (-358.515) * (-357.615) [-359.461] (-357.906) (-356.556) -- 0:00:01
979000 -- (-358.105) [-357.252] (-356.977) (-358.301) * [-357.600] (-357.647) (-360.280) (-357.776) -- 0:00:01
979500 -- (-360.146) [-357.185] (-359.439) (-361.478) * [-356.905] (-356.989) (-357.797) (-362.128) -- 0:00:01
980000 -- [-359.598] (-357.071) (-359.182) (-357.516) * (-361.033) (-360.666) (-361.760) [-357.897] -- 0:00:01
Average standard deviation of split frequencies: 0.006820
980500 -- (-359.446) (-360.419) (-357.499) [-357.267] * (-357.503) (-360.345) [-362.017] (-357.814) -- 0:00:01
981000 -- (-358.566) (-361.894) (-359.733) [-359.950] * (-357.250) [-358.194] (-359.248) (-358.230) -- 0:00:01
981500 -- (-357.842) [-359.004] (-358.821) (-361.986) * (-358.212) [-359.128] (-356.693) (-357.487) -- 0:00:01
982000 -- [-358.629] (-357.598) (-358.750) (-359.062) * [-360.099] (-360.002) (-357.746) (-362.343) -- 0:00:01
982500 -- [-356.893] (-356.914) (-361.205) (-359.887) * (-360.809) [-357.503] (-359.415) (-358.527) -- 0:00:01
983000 -- (-357.330) [-356.690] (-357.950) (-358.605) * [-357.380] (-363.783) (-358.435) (-357.855) -- 0:00:01
983500 -- (-360.076) (-356.942) [-357.372] (-364.567) * (-358.232) (-356.722) (-357.441) [-358.456] -- 0:00:01
984000 -- (-357.914) (-357.911) [-358.935] (-359.241) * (-358.142) (-358.221) (-358.773) [-361.355] -- 0:00:01
984500 -- [-363.175] (-358.422) (-358.868) (-360.764) * (-358.287) [-359.424] (-359.035) (-362.427) -- 0:00:00
985000 -- (-357.050) (-357.905) (-359.102) [-360.891] * (-357.824) [-358.062] (-360.940) (-360.878) -- 0:00:00
Average standard deviation of split frequencies: 0.006753
985500 -- (-359.587) (-359.361) (-357.435) [-361.913] * [-357.927] (-363.176) (-357.461) (-358.522) -- 0:00:00
986000 -- (-362.545) (-360.470) (-357.072) [-360.220] * [-358.029] (-360.128) (-360.204) (-357.206) -- 0:00:00
986500 -- (-359.281) (-361.485) [-359.710] (-357.014) * [-358.448] (-357.647) (-359.499) (-357.509) -- 0:00:00
987000 -- (-356.657) [-358.249] (-357.517) (-360.131) * (-359.114) (-358.056) [-359.716] (-357.197) -- 0:00:00
987500 -- (-357.171) (-359.826) [-357.793] (-357.451) * (-357.834) (-358.783) (-356.413) [-358.076] -- 0:00:00
988000 -- [-359.277] (-359.075) (-360.201) (-357.841) * (-361.305) [-361.016] (-362.029) (-358.621) -- 0:00:00
988500 -- (-361.593) [-358.452] (-358.332) (-357.757) * (-358.806) [-360.360] (-360.469) (-361.175) -- 0:00:00
989000 -- [-357.873] (-357.982) (-358.006) (-357.134) * [-359.467] (-360.087) (-362.957) (-359.577) -- 0:00:00
989500 -- [-357.141] (-359.224) (-365.627) (-357.499) * [-358.974] (-361.426) (-359.655) (-364.914) -- 0:00:00
990000 -- (-358.520) (-363.756) (-360.832) [-357.830] * [-360.206] (-357.103) (-359.968) (-359.048) -- 0:00:00
Average standard deviation of split frequencies: 0.006602
990500 -- [-357.353] (-360.777) (-360.607) (-358.667) * (-361.094) (-358.829) [-360.350] (-359.860) -- 0:00:00
991000 -- (-357.303) [-359.825] (-357.627) (-356.957) * (-359.084) (-359.336) (-356.399) [-360.363] -- 0:00:00
991500 -- (-358.254) (-361.779) [-357.113] (-356.778) * (-357.950) (-357.009) (-357.369) [-358.202] -- 0:00:00
992000 -- (-358.795) (-359.888) [-360.556] (-358.716) * (-361.118) (-357.831) [-356.908] (-358.674) -- 0:00:00
992500 -- (-356.745) (-360.910) (-362.026) [-359.740] * (-358.290) (-359.230) [-360.473] (-359.388) -- 0:00:00
993000 -- [-357.325] (-360.057) (-358.927) (-358.288) * (-357.705) [-357.814] (-358.731) (-356.572) -- 0:00:00
993500 -- (-360.291) (-360.996) [-357.571] (-359.304) * (-359.760) (-357.328) (-358.478) [-358.131] -- 0:00:00
994000 -- (-357.717) (-357.646) [-359.365] (-356.644) * [-359.165] (-357.448) (-359.872) (-359.348) -- 0:00:00
994500 -- (-358.109) [-358.785] (-360.778) (-357.593) * (-362.573) (-358.364) (-360.022) [-359.969] -- 0:00:00
995000 -- (-360.679) (-359.005) (-358.870) [-360.727] * (-358.702) [-357.923] (-363.479) (-360.308) -- 0:00:00
Average standard deviation of split frequencies: 0.006892
995500 -- (-359.326) [-358.754] (-360.423) (-358.668) * (-360.556) (-360.183) [-361.472] (-360.575) -- 0:00:00
996000 -- (-357.743) [-358.419] (-358.122) (-357.999) * (-360.273) (-358.075) [-361.674] (-361.128) -- 0:00:00
996500 -- [-359.745] (-358.465) (-360.361) (-357.793) * (-361.290) (-358.983) [-357.849] (-360.903) -- 0:00:00
997000 -- (-362.176) [-356.889] (-362.210) (-358.272) * (-360.623) [-358.056] (-359.634) (-357.761) -- 0:00:00
997500 -- [-363.187] (-360.903) (-359.760) (-358.040) * (-361.033) [-358.350] (-357.922) (-359.809) -- 0:00:00
998000 -- (-362.504) (-358.605) (-361.193) [-358.557] * (-357.844) [-358.534] (-358.180) (-359.606) -- 0:00:00
998500 -- (-359.909) (-359.322) (-358.910) [-358.811] * (-358.012) [-356.665] (-359.101) (-360.677) -- 0:00:00
999000 -- (-363.157) (-358.444) [-357.873] (-358.377) * [-362.726] (-359.867) (-363.183) (-361.602) -- 0:00:00
999500 -- (-364.150) (-360.246) [-360.439] (-359.048) * [-360.718] (-358.508) (-358.481) (-360.762) -- 0:00:00
1000000 -- (-359.037) (-358.837) [-357.769] (-357.133) * (-361.568) [-359.387] (-359.944) (-360.452) -- 0:00:00
Average standard deviation of split frequencies: 0.006890
Analysis completed in 1 mins 4 seconds
Analysis used 62.64 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -356.23
Likelihood of best state for "cold" chain of run 2 was -356.23
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.2 % ( 32 %) Dirichlet(Pi{all})
40.8 % ( 34 %) Slider(Pi{all})
78.6 % ( 47 %) Multiplier(Alpha{1,2})
78.0 % ( 53 %) Multiplier(Alpha{3})
26.3 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.5 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.8 % ( 18 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.0 % ( 24 %) Dirichlet(Pi{all})
40.5 % ( 17 %) Slider(Pi{all})
78.2 % ( 48 %) Multiplier(Alpha{1,2})
77.4 % ( 47 %) Multiplier(Alpha{3})
26.3 % ( 31 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.8 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 165583 0.83 0.67
3 | 166266 167166 0.84
4 | 166516 167247 167222
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167443 0.82 0.67
3 | 166316 166427 0.84
4 | 166791 166193 166830
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -358.05
| 2 2 2 2 |
|2 2 1 1 2 |
| 11 2 222 1 1 1 2 1 2 |
|1 1 1 * 11 1* 1 1 22 |
| 2 1 1 2 22 2 21 *1 1* |
| 2 2 12 2 1 22 2 2 2 2 21 21|
| 2 1 1 2 1 21 1 * 1 |
| 12 12 2* 22 1 1 21 1 * |
| 1 1 * 1 2 *1 22 |
| 2 1 2 2 1 2 1 12|
| 2 1 1 1 1 |
| |
| |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -360.00
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -358.04 -362.91
2 -357.96 -360.98
--------------------------------------
TOTAL -358.00 -362.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894293 0.089871 0.344679 1.469878 0.850001 1483.32 1492.16 1.000
r(A<->C){all} 0.161735 0.019149 0.000009 0.435403 0.124345 205.02 279.66 1.000
r(A<->G){all} 0.178192 0.024099 0.000067 0.498251 0.137046 211.43 259.52 1.000
r(A<->T){all} 0.159791 0.019425 0.000036 0.439329 0.118023 152.82 216.65 1.000
r(C<->G){all} 0.158637 0.018846 0.000016 0.445549 0.122136 220.40 266.65 1.000
r(C<->T){all} 0.172427 0.021933 0.000144 0.478157 0.131582 132.20 175.98 1.001
r(G<->T){all} 0.169218 0.020173 0.000253 0.461382 0.131096 223.62 293.53 1.002
pi(A){all} 0.194991 0.000582 0.150514 0.243366 0.193972 1314.09 1407.54 1.000
pi(C){all} 0.298307 0.000799 0.243550 0.353424 0.297883 1122.03 1226.86 1.000
pi(G){all} 0.331283 0.000835 0.273732 0.386094 0.330701 1369.36 1405.65 1.000
pi(T){all} 0.175419 0.000551 0.129914 0.221356 0.174642 1201.67 1351.33 1.000
alpha{1,2} 0.416642 0.221459 0.000154 1.375027 0.247327 1248.96 1304.95 1.000
alpha{3} 0.462859 0.240775 0.000304 1.426065 0.301427 1248.74 1251.71 1.000
pinvar{all} 0.993520 0.000065 0.978283 0.999997 0.996114 1298.97 1399.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ..*..*
9 -- .**...
10 -- .**.**
11 -- ....**
12 -- ..*.*.
13 -- .*.*..
14 -- .*..*.
15 -- ...**.
16 -- ...*.*
17 -- .*...*
18 -- .****.
19 -- .*.***
20 -- ..****
21 -- ..**..
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.013191 0.143238 0.161892 2
8 441 0.146902 0.005182 0.143238 0.150566 2
9 441 0.146902 0.004240 0.143904 0.149900 2
10 437 0.145570 0.008009 0.139907 0.151233 2
11 437 0.145570 0.000471 0.145237 0.145903 2
12 436 0.145237 0.009422 0.138574 0.151899 2
13 429 0.142905 0.013662 0.133245 0.152565 2
14 425 0.141572 0.008009 0.135909 0.147235 2
15 422 0.140573 0.002827 0.138574 0.142572 2
16 421 0.140240 0.000471 0.139907 0.140573 2
17 419 0.139574 0.007066 0.134577 0.144570 2
18 415 0.138241 0.003298 0.135909 0.140573 2
19 415 0.138241 0.000471 0.137908 0.138574 2
20 412 0.137242 0.013191 0.127915 0.146569 2
21 400 0.133245 0.008480 0.127249 0.139241 2
22 290 0.096602 0.012248 0.087941 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096713 0.009555 0.000022 0.294255 0.068859 1.000 2
length{all}[2] 0.099035 0.009606 0.000012 0.296768 0.067275 1.000 2
length{all}[3] 0.103556 0.010399 0.000050 0.299235 0.073245 1.000 2
length{all}[4] 0.098718 0.009717 0.000019 0.295841 0.068980 1.000 2
length{all}[5] 0.101103 0.010276 0.000073 0.296694 0.070071 1.000 2
length{all}[6] 0.094872 0.009364 0.000006 0.279379 0.064916 1.000 2
length{all}[7] 0.105130 0.012314 0.000117 0.311183 0.073001 1.005 2
length{all}[8] 0.095671 0.008454 0.000024 0.285227 0.069027 0.998 2
length{all}[9] 0.095748 0.007697 0.000130 0.276729 0.066465 0.998 2
length{all}[10] 0.102132 0.010184 0.000063 0.331831 0.072615 0.998 2
length{all}[11] 0.103906 0.009424 0.000107 0.294249 0.074920 1.000 2
length{all}[12] 0.098414 0.011504 0.000169 0.309026 0.061685 0.998 2
length{all}[13] 0.099494 0.009642 0.000023 0.273823 0.067439 0.999 2
length{all}[14] 0.099552 0.009652 0.000082 0.299262 0.072417 0.998 2
length{all}[15] 0.098632 0.008368 0.000270 0.278385 0.068957 0.998 2
length{all}[16] 0.102071 0.009801 0.000733 0.313044 0.067859 0.998 2
length{all}[17] 0.102659 0.012578 0.000086 0.320973 0.068291 0.998 2
length{all}[18] 0.092210 0.007926 0.000030 0.262837 0.064918 1.001 2
length{all}[19] 0.097910 0.008634 0.000233 0.278651 0.073854 1.000 2
length{all}[20] 0.101681 0.009850 0.000205 0.294700 0.074335 0.998 2
length{all}[21] 0.099569 0.010288 0.000119 0.288253 0.071760 0.999 2
length{all}[22] 0.106904 0.010821 0.000179 0.302647 0.075026 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006890
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 264
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 34 patterns at 88 / 88 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 34 patterns at 88 / 88 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
33184 bytes for conP
2992 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068829 0.094007 0.087262 0.091276 0.071161 0.062810 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -382.072958
Iterating by ming2
Initial: fx= 382.072958
x= 0.06883 0.09401 0.08726 0.09128 0.07116 0.06281 0.30000 1.30000
1 h-m-p 0.0000 0.0007 209.9927 ++++ 349.661805 m 0.0007 15 | 1/8
2 h-m-p 0.0031 0.0153 28.0362 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 194.2007 ++ 347.017786 m 0.0001 47 | 2/8
4 h-m-p 0.0006 0.0340 19.0604 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 173.7964 ++ 346.197305 m 0.0000 78 | 3/8
6 h-m-p 0.0003 0.0434 15.4636 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 150.4265 +++ 341.932144 m 0.0002 109 | 4/8
8 h-m-p 0.0020 0.0660 11.6191 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 123.2067 ++ 341.218983 m 0.0000 141 | 5/8
10 h-m-p 0.0005 0.1373 7.5989 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 87.1706 ++ 340.976027 m 0.0000 172 | 6/8
12 h-m-p 0.0942 8.0000 0.0000 Y 340.976027 0 0.0942 183 | 6/8
13 h-m-p 0.8748 8.0000 0.0000 -Y 340.976027 0 0.0547 197
Out..
lnL = -340.976027
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036136 0.064950 0.072089 0.027804 0.015148 0.048953 0.299775 0.723066 0.322249
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.132195
np = 9
lnL0 = -363.721668
Iterating by ming2
Initial: fx= 363.721668
x= 0.03614 0.06495 0.07209 0.02780 0.01515 0.04895 0.29977 0.72307 0.32225
1 h-m-p 0.0000 0.0002 205.1650 +++ 356.104837 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0012 74.7176 ++ 350.521959 m 0.0012 27 | 2/9
3 h-m-p 0.0000 0.0000 1102.7849 ++ 347.831159 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0003 417.1207 ++ 344.321747 m 0.0003 51 | 4/9
5 h-m-p 0.0000 0.0000 9485.6720 ++ 342.682489 m 0.0000 63 | 5/9
6 h-m-p 0.0125 0.1823 2.1672 -------------.. | 5/9
7 h-m-p 0.0000 0.0001 123.4076 ++ 341.564969 m 0.0001 98 | 6/9
8 h-m-p 0.0024 0.2450 2.6709 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 88.0450 ++ 340.976061 m 0.0001 132 | 7/9
10 h-m-p 0.6710 8.0000 0.0000 ++ 340.976061 m 8.0000 144 | 6/9
11 h-m-p 0.0864 8.0000 0.0002 ++++ 340.976061 m 8.0000 160 | 6/9
12 h-m-p 0.0046 0.7368 0.3856 ++++ 340.976059 m 0.7368 177 | 7/9
13 h-m-p 0.0017 0.0086 7.5008 ------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 340.976059 m 8.0000 217 | 7/9
15 h-m-p 0.0081 4.0282 0.1952 +++++ 340.976031 m 4.0282 234 | 8/9
16 h-m-p 1.6000 8.0000 0.0000 N 340.976031 0 1.6000 248 | 8/9
17 h-m-p 0.0160 8.0000 0.0000 Y 340.976031 0 0.0160 261
Out..
lnL = -340.976031
262 lfun, 786 eigenQcodon, 3144 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.019903 0.022346 0.036682 0.030318 0.034239 0.057598 0.000100 1.241577 0.230874 0.391502 1.406361
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.429463
np = 11
lnL0 = -358.183649
Iterating by ming2
Initial: fx= 358.183649
x= 0.01990 0.02235 0.03668 0.03032 0.03424 0.05760 0.00011 1.24158 0.23087 0.39150 1.40636
1 h-m-p 0.0000 0.0000 204.7851 ++ 357.041447 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0050 49.3969 +++ 347.245427 m 0.0050 31 | 2/11
3 h-m-p 0.0000 0.0000 532.6269 ++ 346.339765 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0014 111.4145 ++ 343.881005 m 0.0014 59 | 4/11
5 h-m-p 0.0006 0.0031 4.0323 -----------.. | 4/11
6 h-m-p 0.0000 0.0000 171.2670 ++ 343.254045 m 0.0000 96 | 5/11
7 h-m-p 0.0160 8.0000 1.8220 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 149.1231 ++ 342.546477 m 0.0000 135 | 6/11
9 h-m-p 0.0160 8.0000 1.4376 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 122.5052 ++ 342.251203 m 0.0000 174 | 7/11
11 h-m-p 0.0160 8.0000 1.1484 -------------.. | 7/11
12 h-m-p 0.0000 0.0002 86.5927 +++ 340.976052 m 0.0002 214 | 8/11
13 h-m-p 0.1746 8.0000 0.0000 +++ 340.976052 m 8.0000 229 | 8/11
14 h-m-p 0.0160 8.0000 0.0238 -------Y 340.976052 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 ----C 340.976052 0 0.0000 274 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 340.976052 m 8.0000 294 | 8/11
17 h-m-p 0.0004 0.2124 9.6462 +++++ 340.976036 m 0.2124 314 | 8/11
18 h-m-p -0.0000 -0.0000 1.5268
h-m-p: -0.00000000e+00 -0.00000000e+00 1.52676663e+00 340.976036
.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 340.976036 m 8.0000 342 | 8/11
20 h-m-p 0.0160 8.0000 0.0039 +++++ 340.976036 m 8.0000 362 | 8/11
21 h-m-p 0.0355 8.0000 0.8747 +++Y 340.976031 0 5.0292 382 | 8/11
22 h-m-p 1.6000 8.0000 0.0862 ++ 340.976031 m 8.0000 399 | 8/11
23 h-m-p 0.1561 0.8467 4.4175 Y 340.976031 0 0.1561 416 | 8/11
24 h-m-p 1.6000 8.0000 0.3346 Y 340.976031 0 0.3196 430 | 8/11
25 h-m-p 1.6000 8.0000 0.0084 Y 340.976031 0 1.1825 447 | 8/11
26 h-m-p 1.6000 8.0000 0.0002 ++ 340.976031 m 8.0000 464 | 8/11
27 h-m-p 1.0002 8.0000 0.0017 ++ 340.976031 m 8.0000 481 | 8/11
28 h-m-p 0.2627 8.0000 0.0503 +C 340.976031 0 1.6462 499 | 8/11
29 h-m-p 1.6000 8.0000 0.0029 ++ 340.976031 m 8.0000 516 | 8/11
30 h-m-p 0.0098 2.2520 2.3346 ++Y 340.976031 0 0.3351 535 | 8/11
31 h-m-p 0.8352 8.0000 0.9367 Y 340.976031 0 0.8352 549 | 8/11
32 h-m-p 0.2748 8.0000 2.8469 C 340.976030 0 0.2900 566 | 8/11
33 h-m-p 0.0091 1.1957 90.8178 Y 340.976030 0 0.0061 580 | 8/11
34 h-m-p 0.8800 8.0000 0.6329 +Y 340.976029 0 2.6222 595 | 8/11
35 h-m-p 0.8133 8.0000 2.0406 +C 340.976024 0 2.9427 613 | 8/11
36 h-m-p 1.6000 8.0000 0.6566 ++ 340.976005 m 8.0000 627 | 8/11
37 h-m-p 1.6000 8.0000 0.6431 ++ 340.976004 m 8.0000 644 | 8/11
38 h-m-p 1.2253 8.0000 4.1986 ++ 340.976002 m 8.0000 661 | 8/11
39 h-m-p 1.6000 8.0000 0.8891 ++ 340.976002 m 8.0000 675 | 8/11
40 h-m-p 0.7038 5.7388 10.1060 ---------Y 340.976002 0 0.0000 701 | 8/11
41 h-m-p 0.0160 8.0000 0.0320 +++++ 340.976002 m 8.0000 718 | 8/11
42 h-m-p 0.0260 8.0000 9.8543 -----------Y 340.976002 0 0.0000 746 | 8/11
43 h-m-p 0.1246 8.0000 0.0000 Y 340.976002 0 0.1246 760 | 8/11
44 h-m-p 0.1092 8.0000 0.0000 ---Y 340.976002 0 0.0004 780
Out..
lnL = -340.976002
781 lfun, 3124 eigenQcodon, 14058 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -340.974076 S = -340.973952 -0.000047
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:05
did 20 / 34 patterns 0:05
did 30 / 34 patterns 0:05
did 34 / 34 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034330 0.025570 0.100775 0.050246 0.036799 0.086349 0.000100 0.838794 1.842220
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.283446
np = 9
lnL0 = -369.389693
Iterating by ming2
Initial: fx= 369.389693
x= 0.03433 0.02557 0.10078 0.05025 0.03680 0.08635 0.00011 0.83879 1.84222
1 h-m-p 0.0000 0.0000 200.6972 ++ 369.058367 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0795 11.3133 ----------.. | 1/9
3 h-m-p 0.0000 0.0003 200.8880 +++ 356.752136 m 0.0003 47 | 2/9
4 h-m-p 0.0067 0.1145 8.2193 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 189.4992 ++ 353.022727 m 0.0001 81 | 3/9
6 h-m-p 0.0039 0.2580 4.4791 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 170.9144 ++ 352.176697 m 0.0000 115 | 4/9
8 h-m-p 0.0012 0.3698 3.5243 -----------.. | 4/9
9 h-m-p 0.0000 0.0002 147.7470 ++ 348.702931 m 0.0002 148 | 5/9
10 h-m-p 0.0070 0.5717 2.7150 -------------.. | 5/9
11 h-m-p 0.0000 0.0004 121.4186 +++ 342.299910 m 0.0004 184 | 6/9
12 h-m-p 0.0192 1.4344 1.9065 -------------.. | 6/9
13 h-m-p 0.0000 0.0002 88.0688 +++ 340.976067 m 0.0002 220 | 7/9
14 h-m-p 1.5167 8.0000 0.0000 ++ 340.976067 m 8.0000 232 | 7/9
15 h-m-p 0.1005 8.0000 0.0001 ++++ 340.976067 m 8.0000 248 | 7/9
16 h-m-p 0.0149 7.4672 14.7079 +++++ 340.976063 m 7.4672 265 | 7/9
17 h-m-p 1.6000 8.0000 0.0108 ---N 340.976063 0 0.0031 280 | 7/9
18 h-m-p 0.2590 1.2948 0.0000 Y 340.976063 0 0.0647 294 | 7/9
19 h-m-p 0.0667 1.2677 0.0000 C 340.976063 0 0.0167 308
Out..
lnL = -340.976063
309 lfun, 3399 eigenQcodon, 18540 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038136 0.032547 0.080927 0.044105 0.099427 0.050079 0.000100 0.900000 0.510279 1.635395 1.300249
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.431299
np = 11
lnL0 = -369.156328
Iterating by ming2
Initial: fx= 369.156328
x= 0.03814 0.03255 0.08093 0.04410 0.09943 0.05008 0.00011 0.90000 0.51028 1.63540 1.30025
1 h-m-p 0.0000 0.0000 185.9782 ++ 368.941826 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0020 101.6672 ++++ 353.348919 m 0.0020 32 | 2/11
3 h-m-p 0.0000 0.0000 904.3469 ++ 351.041319 m 0.0000 46 | 3/11
4 h-m-p 0.0012 0.0058 18.8199 ++ 350.079175 m 0.0058 60 | 4/11
5 h-m-p 0.0001 0.0003 70.7491 ++ 349.041895 m 0.0003 74 | 5/11
6 h-m-p 0.0004 0.0053 37.8461 ++ 347.338699 m 0.0053 88 | 6/11
7 h-m-p 0.0015 0.0074 35.9589 -----------.. | 6/11
8 h-m-p 0.0000 0.0009 80.0658 ++++ 340.976051 m 0.0009 127 | 7/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 340.976051 m 8.0000 141 | 7/11
10 h-m-p 0.0050 2.5195 0.3176 +++++ 340.976019 m 2.5195 162 | 8/11
11 h-m-p 0.8261 6.9412 0.3922 ++ 340.976009 m 6.9412 180 | 8/11
12 h-m-p 0.0000 0.0000 0.6536
h-m-p: 1.81360447e-17 9.06802234e-17 6.53553815e-01 340.976009
.. | 8/11
13 h-m-p 0.0160 8.0000 0.0000 C 340.976009 0 0.0060 211 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 -C 340.976009 0 0.0010 229
Out..
lnL = -340.976009
230 lfun, 2760 eigenQcodon, 15180 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -340.975449 S = -340.974085 -0.000597
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:14
did 20 / 34 patterns 0:14
did 30 / 34 patterns 0:14
did 34 / 34 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=88
NC_011896_1_WP_010908352_1_1551_MLBR_RS07350 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
NC_002677_1_NP_302031_1_903_rpmA MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
**************************************************
NC_011896_1_WP_010908352_1_1551_MLBR_RS07350 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
NC_002677_1_NP_302031_1_903_rpmA VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
**************************************
>NC_011896_1_WP_010908352_1_1551_MLBR_RS07350 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC >NC_002677_1_NP_302031_1_903_rpmA ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC >NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC >NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC >NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC >NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG GGCTAACCGCCGAC
>NC_011896_1_WP_010908352_1_1551_MLBR_RS07350 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD >NC_002677_1_NP_302031_1_903_rpmA MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD >NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD >NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD >NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD >NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
#NEXUS
[ID: 0357051392]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908352_1_1551_MLBR_RS07350
NC_002677_1_NP_302031_1_903_rpmA
NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720
NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260
NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040
NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908352_1_1551_MLBR_RS07350,
2 NC_002677_1_NP_302031_1_903_rpmA,
3 NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720,
4 NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260,
5 NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040,
6 NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06885857,2:0.06727505,3:0.0732454,4:0.06897954,5:0.07007115,6:0.06491553);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06885857,2:0.06727505,3:0.0732454,4:0.06897954,5:0.07007115,6:0.06491553);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -358.04 -362.91
2 -357.96 -360.98
--------------------------------------
TOTAL -358.00 -362.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894293 0.089871 0.344679 1.469878 0.850001 1483.32 1492.16 1.000
r(A<->C){all} 0.161735 0.019149 0.000009 0.435403 0.124345 205.02 279.66 1.000
r(A<->G){all} 0.178192 0.024099 0.000067 0.498251 0.137046 211.43 259.52 1.000
r(A<->T){all} 0.159791 0.019425 0.000036 0.439329 0.118023 152.82 216.65 1.000
r(C<->G){all} 0.158637 0.018846 0.000016 0.445549 0.122136 220.40 266.65 1.000
r(C<->T){all} 0.172427 0.021933 0.000144 0.478157 0.131582 132.20 175.98 1.001
r(G<->T){all} 0.169218 0.020173 0.000253 0.461382 0.131096 223.62 293.53 1.002
pi(A){all} 0.194991 0.000582 0.150514 0.243366 0.193972 1314.09 1407.54 1.000
pi(C){all} 0.298307 0.000799 0.243550 0.353424 0.297883 1122.03 1226.86 1.000
pi(G){all} 0.331283 0.000835 0.273732 0.386094 0.330701 1369.36 1405.65 1.000
pi(T){all} 0.175419 0.000551 0.129914 0.221356 0.174642 1201.67 1351.33 1.000
alpha{1,2} 0.416642 0.221459 0.000154 1.375027 0.247327 1248.96 1304.95 1.000
alpha{3} 0.462859 0.240775 0.000304 1.426065 0.301427 1248.74 1251.71 1.000
pinvar{all} 0.993520 0.000065 0.978283 0.999997 0.996114 1298.97 1399.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpmA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 88
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 0 0 0 0 0 0 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 3 3 3 3 3 3 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 7 7 7 7 7 7 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 4 4 4 4 4 4 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 10 10 10 10 10 10 | GCC 4 4 4 4 4 4 | GAC 3 3 3 3 3 3 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 4 4 4 4 4 4
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908352_1_1551_MLBR_RS07350
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
#2: NC_002677_1_NP_302031_1_903_rpmA
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
#3: NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
#4: NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
#5: NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
#6: NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 0 | CCC 6 | CAC 6 | CGC 24
CTA 12 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 12 | CCG 0 | CAG 18 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 0 | ACC 18 | AAC 18 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 42 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 24 | Asp D GAT 6 | Gly G GGT 18
GTC 60 | GCC 24 | GAC 18 | GGC 36
GTA 0 | GCA 12 | Glu E GAA 6 | GGA 24
GTG 6 | GCG 0 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09091 C:0.21591 A:0.21591 G:0.47727
position 2: T:0.25000 C:0.22727 A:0.23864 G:0.28409
position 3: T:0.18182 C:0.45455 A:0.12500 G:0.23864
Average T:0.17424 C:0.29924 A:0.19318 G:0.33333
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -340.976027 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299775 1.300249
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908352_1_1551_MLBR_RS07350: 0.000004, NC_002677_1_NP_302031_1_903_rpmA: 0.000004, NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720: 0.000004, NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260: 0.000004, NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040: 0.000004, NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29977
omega (dN/dS) = 1.30025
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
7..2 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
7..3 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
7..4 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
7..5 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
7..6 0.000 202.8 61.2 1.3002 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -340.976031 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.512760
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908352_1_1551_MLBR_RS07350: 0.000004, NC_002677_1_NP_302031_1_903_rpmA: 0.000004, NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720: 0.000004, NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260: 0.000004, NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040: 0.000004, NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.51276 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 205.4 58.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -340.976002 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000021 0.000000 0.000001 40.556703
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908352_1_1551_MLBR_RS07350: 0.000004, NC_002677_1_NP_302031_1_903_rpmA: 0.000004, NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720: 0.000004, NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260: 0.000004, NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040: 0.000004, NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00002 0.00000 0.99998
w: 0.00000 1.00000 40.55670
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
7..2 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
7..3 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
7..4 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
7..5 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
7..6 0.000 205.4 58.6 40.5559 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908352_1_1551_MLBR_RS07350)
Pr(w>1) post mean +- SE for w
1 M 1.000** 40.556
2 A 1.000** 40.556
3 H 1.000** 40.556
4 K 1.000** 40.556
5 K 1.000** 40.556
6 G 1.000** 40.556
7 A 1.000** 40.556
8 S 1.000** 40.556
9 S 1.000** 40.556
10 S 1.000** 40.556
11 R 1.000** 40.556
12 N 1.000** 40.556
13 G 1.000** 40.556
14 R 1.000** 40.556
15 D 1.000** 40.556
16 S 1.000** 40.556
17 A 1.000** 40.556
18 A 1.000** 40.556
19 Q 1.000** 40.556
20 R 1.000** 40.556
21 L 1.000** 40.556
22 G 1.000** 40.556
23 V 1.000** 40.556
24 K 1.000** 40.556
25 R 1.000** 40.556
26 F 1.000** 40.556
27 G 1.000** 40.556
28 G 1.000** 40.556
29 Q 1.000** 40.556
30 V 1.000** 40.556
31 V 1.000** 40.556
32 K 1.000** 40.556
33 A 1.000** 40.556
34 G 1.000** 40.556
35 E 1.000** 40.556
36 I 1.000** 40.556
37 L 1.000** 40.556
38 V 1.000** 40.556
39 R 1.000** 40.556
40 Q 1.000** 40.556
41 R 1.000** 40.556
42 G 1.000** 40.556
43 T 1.000** 40.556
44 K 1.000** 40.556
45 F 1.000** 40.556
46 H 1.000** 40.556
47 P 1.000** 40.556
48 G 1.000** 40.556
49 V 1.000** 40.556
50 N 1.000** 40.556
51 V 1.000** 40.556
52 G 1.000** 40.556
53 R 1.000** 40.556
54 G 1.000** 40.556
55 G 1.000** 40.556
56 D 1.000** 40.556
57 D 1.000** 40.556
58 T 1.000** 40.556
59 L 1.000** 40.556
60 F 1.000** 40.556
61 A 1.000** 40.556
62 T 1.000** 40.556
63 S 1.000** 40.556
64 A 1.000** 40.556
65 G 1.000** 40.556
66 A 1.000** 40.556
67 V 1.000** 40.556
68 E 1.000** 40.556
69 F 1.000** 40.556
70 G 1.000** 40.556
71 V 1.000** 40.556
72 K 1.000** 40.556
73 R 1.000** 40.556
74 G 1.000** 40.556
75 R 1.000** 40.556
76 K 1.000** 40.556
77 T 1.000** 40.556
78 V 1.000** 40.556
79 N 1.000** 40.556
80 I 1.000** 40.556
81 V 1.000** 40.556
82 A 1.000** 40.556
83 V 1.000** 40.556
84 G 1.000** 40.556
85 L 1.000** 40.556
86 T 1.000** 40.556
87 A 1.000** 40.556
88 D 1.000** 40.556
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908352_1_1551_MLBR_RS07350)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -340.976063 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 52.048467 98.999972
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908352_1_1551_MLBR_RS07350: 0.000004, NC_002677_1_NP_302031_1_903_rpmA: 0.000004, NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720: 0.000004, NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260: 0.000004, NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040: 0.000004, NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 52.04847 q = 98.99997
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.28235 0.30458 0.31812 0.32908 0.33904 0.34877 0.35891 0.37030 0.38469 0.40916
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
7..2 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
7..3 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
7..4 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
7..5 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
7..6 0.000 205.4 58.6 0.3445 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -340.976009 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.663725 4.562840
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908352_1_1551_MLBR_RS07350: 0.000004, NC_002677_1_NP_302031_1_903_rpmA: 0.000004, NZ_LVXE01000004_1_WP_010908352_1_1715_A3216_RS02720: 0.000004, NZ_LYPH01000077_1_WP_010908352_1_2547_A8144_RS12260: 0.000004, NZ_CP029543_1_WP_010908352_1_1580_DIJ64_RS08040: 0.000004, NZ_AP014567_1_WP_010908352_1_1619_JK2ML_RS08235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.66373
(p1 = 0.99999) w = 4.56284
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 4.56284
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
7..2 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
7..3 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
7..4 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
7..5 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
7..6 0.000 205.4 58.6 4.5628 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908352_1_1551_MLBR_RS07350)
Pr(w>1) post mean +- SE for w
1 M 1.000** 4.563
2 A 1.000** 4.563
3 H 1.000** 4.563
4 K 1.000** 4.563
5 K 1.000** 4.563
6 G 1.000** 4.563
7 A 1.000** 4.563
8 S 1.000** 4.563
9 S 1.000** 4.563
10 S 1.000** 4.563
11 R 1.000** 4.563
12 N 1.000** 4.563
13 G 1.000** 4.563
14 R 1.000** 4.563
15 D 1.000** 4.563
16 S 1.000** 4.563
17 A 1.000** 4.563
18 A 1.000** 4.563
19 Q 1.000** 4.563
20 R 1.000** 4.563
21 L 1.000** 4.563
22 G 1.000** 4.563
23 V 1.000** 4.563
24 K 1.000** 4.563
25 R 1.000** 4.563
26 F 1.000** 4.563
27 G 1.000** 4.563
28 G 1.000** 4.563
29 Q 1.000** 4.563
30 V 1.000** 4.563
31 V 1.000** 4.563
32 K 1.000** 4.563
33 A 1.000** 4.563
34 G 1.000** 4.563
35 E 1.000** 4.563
36 I 1.000** 4.563
37 L 1.000** 4.563
38 V 1.000** 4.563
39 R 1.000** 4.563
40 Q 1.000** 4.563
41 R 1.000** 4.563
42 G 1.000** 4.563
43 T 1.000** 4.563
44 K 1.000** 4.563
45 F 1.000** 4.563
46 H 1.000** 4.563
47 P 1.000** 4.563
48 G 1.000** 4.563
49 V 1.000** 4.563
50 N 1.000** 4.563
51 V 1.000** 4.563
52 G 1.000** 4.563
53 R 1.000** 4.563
54 G 1.000** 4.563
55 G 1.000** 4.563
56 D 1.000** 4.563
57 D 1.000** 4.563
58 T 1.000** 4.563
59 L 1.000** 4.563
60 F 1.000** 4.563
61 A 1.000** 4.563
62 T 1.000** 4.563
63 S 1.000** 4.563
64 A 1.000** 4.563
65 G 1.000** 4.563
66 A 1.000** 4.563
67 V 1.000** 4.563
68 E 1.000** 4.563
69 F 1.000** 4.563
70 G 1.000** 4.563
71 V 1.000** 4.563
72 K 1.000** 4.563
73 R 1.000** 4.563
74 G 1.000** 4.563
75 R 1.000** 4.563
76 K 1.000** 4.563
77 T 1.000** 4.563
78 V 1.000** 4.563
79 N 1.000** 4.563
80 I 1.000** 4.563
81 V 1.000** 4.563
82 A 1.000** 4.563
83 V 1.000** 4.563
84 G 1.000** 4.563
85 L 1.000** 4.563
86 T 1.000** 4.563
87 A 1.000** 4.563
88 D 1.000** 4.563
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908352_1_1551_MLBR_RS07350)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -340.976031 Model 2: PositiveSelection -340.976002 Model 0: one-ratio -340.976027 Model 7: beta -340.976063 Model 8: beta&w>1 -340.976009 Model 0 vs 1 7.999999979801942E-6 Model 2 vs 1 5.7999999967250915E-5 Model 8 vs 7 1.0800000006838673E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
