--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:00:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpmA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -358.04 -362.91
2 -357.96 -360.98
--------------------------------------
TOTAL -358.00 -362.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894293 0.089871 0.344679 1.469878 0.850001 1483.32 1492.16 1.000
r(A<->C){all} 0.161735 0.019149 0.000009 0.435403 0.124345 205.02 279.66 1.000
r(A<->G){all} 0.178192 0.024099 0.000067 0.498251 0.137046 211.43 259.52 1.000
r(A<->T){all} 0.159791 0.019425 0.000036 0.439329 0.118023 152.82 216.65 1.000
r(C<->G){all} 0.158637 0.018846 0.000016 0.445549 0.122136 220.40 266.65 1.000
r(C<->T){all} 0.172427 0.021933 0.000144 0.478157 0.131582 132.20 175.98 1.001
r(G<->T){all} 0.169218 0.020173 0.000253 0.461382 0.131096 223.62 293.53 1.002
pi(A){all} 0.194991 0.000582 0.150514 0.243366 0.193972 1314.09 1407.54 1.000
pi(C){all} 0.298307 0.000799 0.243550 0.353424 0.297883 1122.03 1226.86 1.000
pi(G){all} 0.331283 0.000835 0.273732 0.386094 0.330701 1369.36 1405.65 1.000
pi(T){all} 0.175419 0.000551 0.129914 0.221356 0.174642 1201.67 1351.33 1.000
alpha{1,2} 0.416642 0.221459 0.000154 1.375027 0.247327 1248.96 1304.95 1.000
alpha{3} 0.462859 0.240775 0.000304 1.426065 0.301427 1248.74 1251.71 1.000
pinvar{all} 0.993520 0.000065 0.978283 0.999997 0.996114 1298.97 1399.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -340.976031
Model 2: PositiveSelection -340.976002
Model 0: one-ratio -340.976027
Model 7: beta -340.976063
Model 8: beta&w>1 -340.976009
Model 0 vs 1 7.999999979801942E-6
Model 2 vs 1 5.7999999967250915E-5
Model 8 vs 7 1.0800000006838673E-4
>C1
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C2
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C3
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C4
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C5
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C6
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=88
C1 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C2 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C3 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C4 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C5 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C6 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
**************************************************
C1 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C2 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C3 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C4 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C5 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C6 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 88 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 88 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2640]--->[2640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.610 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C2 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C3 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C4 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C5 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
C6 MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
**************************************************
C1 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C2 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C3 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C4 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C5 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
C6 VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C2 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C3 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C4 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C5 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
C6 ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
**************************************************
C1 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C2 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C3 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C4 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C5 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
C6 CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
**************************************************
C1 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C2 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C3 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C4 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C5 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
C6 GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
**************************************************
C1 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C2 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C3 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C4 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C5 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
C6 GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
**************************************************
C1 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C2 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C3 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C4 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C5 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
C6 CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
**************************************************
C1 GGCTAACCGCCGAC
C2 GGCTAACCGCCGAC
C3 GGCTAACCGCCGAC
C4 GGCTAACCGCCGAC
C5 GGCTAACCGCCGAC
C6 GGCTAACCGCCGAC
**************
>C1
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C2
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C3
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C4
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C5
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C6
ATGGCACACAAGAAGGGAGCTTCTAGCTCGCGTAACGGTCGCGATTCCGC
CGCTCAGCGGCTGGGAGTCAAGCGGTTCGGTGGCCAGGTCGTCAAGGCTG
GCGAGATTCTGGTCCGCCAGCGTGGCACCAAGTTTCATCCCGGTGTGAAC
GTCGGGCGCGGCGGCGACGACACACTATTCGCCACATCGGCAGGAGCCGT
CGAATTCGGCGTCAAGCGTGGACGCAAGACCGTCAACATTGTCGCTGTCG
GGCTAACCGCCGAC
>C1
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C2
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C3
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C4
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C5
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
>C6
MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFATSAGAVEFGVKRGRKTVNIVAVGLTAD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 264 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791528
Setting output file names to "/data/11res/rpmA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1531220819
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0357051392
Seed = 1086987701
Swapseed = 1579791528
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -590.844566 -- -24.965149
Chain 2 -- -590.844622 -- -24.965149
Chain 3 -- -590.844656 -- -24.965149
Chain 4 -- -590.844622 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -590.844622 -- -24.965149
Chain 2 -- -590.844656 -- -24.965149
Chain 3 -- -590.844656 -- -24.965149
Chain 4 -- -590.844622 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-590.845] (-590.845) (-590.845) (-590.845) * [-590.845] (-590.845) (-590.845) (-590.845)
500 -- (-370.399) (-379.456) [-372.718] (-362.647) * (-365.606) [-371.451] (-366.179) (-376.047) -- 0:00:00
1000 -- (-361.912) [-373.913] (-375.654) (-366.408) * (-373.354) [-367.868] (-368.527) (-369.022) -- 0:00:00
1500 -- (-367.464) (-365.987) (-367.878) [-366.323] * (-374.638) [-361.600] (-364.570) (-370.949) -- 0:00:00
2000 -- [-361.905] (-361.572) (-364.834) (-366.314) * (-366.954) [-366.173] (-367.362) (-365.065) -- 0:08:19
2500 -- (-367.251) (-371.295) (-372.776) [-369.125] * [-368.712] (-370.755) (-369.812) (-372.679) -- 0:06:39
3000 -- (-367.734) (-365.334) (-373.281) [-367.401] * (-372.051) (-367.827) [-362.905] (-371.332) -- 0:05:32
3500 -- [-367.931] (-364.316) (-366.988) (-366.519) * (-365.452) [-365.081] (-373.941) (-368.924) -- 0:04:44
4000 -- (-362.560) (-371.346) (-378.581) [-367.075] * (-373.841) [-363.652] (-361.853) (-364.172) -- 0:04:09
4500 -- (-371.078) [-362.372] (-367.243) (-372.080) * (-364.814) [-367.988] (-369.909) (-369.464) -- 0:03:41
5000 -- [-364.898] (-369.701) (-370.242) (-371.830) * (-375.206) (-365.621) (-364.954) [-365.926] -- 0:03:19
Average standard deviation of split frequencies: 0.049997
5500 -- (-369.386) (-369.464) (-371.702) [-366.889] * (-367.844) [-366.550] (-359.444) (-367.514) -- 0:03:00
6000 -- (-367.582) (-367.751) [-368.696] (-369.651) * (-367.840) (-369.944) (-367.422) [-367.481] -- 0:02:45
6500 -- (-373.383) [-365.556] (-370.203) (-365.669) * (-374.911) (-376.371) (-365.772) [-364.925] -- 0:02:32
7000 -- [-368.883] (-367.472) (-374.988) (-370.585) * (-369.539) (-378.018) [-368.111] (-371.352) -- 0:02:21
7500 -- (-364.280) (-370.260) [-377.943] (-373.677) * (-369.304) [-363.799] (-366.101) (-367.232) -- 0:02:12
8000 -- [-365.584] (-364.559) (-379.236) (-367.926) * (-364.738) [-371.002] (-373.774) (-375.091) -- 0:02:04
8500 -- (-362.438) (-368.659) (-359.585) [-365.406] * [-364.146] (-369.903) (-369.295) (-367.106) -- 0:01:56
9000 -- [-374.579] (-370.308) (-360.221) (-367.701) * (-374.169) (-371.030) [-371.952] (-371.605) -- 0:01:50
9500 -- (-374.097) (-367.408) [-358.782] (-367.226) * (-365.076) (-371.716) [-362.228] (-374.509) -- 0:01:44
10000 -- (-368.241) (-363.980) [-358.613] (-381.235) * (-367.046) (-383.052) [-365.053] (-373.163) -- 0:01:39
Average standard deviation of split frequencies: 0.064082
10500 -- (-375.188) [-368.428] (-358.741) (-372.367) * (-364.727) (-377.535) [-374.655] (-368.065) -- 0:01:34
11000 -- (-377.632) [-364.229] (-359.836) (-368.850) * (-372.182) [-357.059] (-364.897) (-371.074) -- 0:01:29
11500 -- [-358.032] (-368.008) (-357.496) (-378.378) * (-362.880) (-360.479) (-373.668) [-371.671] -- 0:01:25
12000 -- (-359.301) (-372.806) (-357.328) [-359.340] * (-363.154) (-359.183) (-367.662) [-365.111] -- 0:01:22
12500 -- (-358.389) [-367.711] (-357.369) (-358.209) * (-368.906) [-362.999] (-363.567) (-371.160) -- 0:01:19
13000 -- (-358.792) (-366.174) [-357.440] (-358.445) * (-368.125) [-357.699] (-369.388) (-369.252) -- 0:01:15
13500 -- (-358.796) (-365.632) (-359.659) [-359.314] * (-371.377) [-359.020] (-377.050) (-364.265) -- 0:01:13
14000 -- [-357.254] (-370.346) (-359.114) (-359.023) * (-367.615) [-358.018] (-369.726) (-368.531) -- 0:01:10
14500 -- (-361.500) [-370.344] (-359.293) (-357.272) * (-363.758) [-358.443] (-366.075) (-379.276) -- 0:01:07
15000 -- (-358.610) (-367.427) (-359.455) [-362.454] * (-374.800) [-357.095] (-370.636) (-372.615) -- 0:01:05
Average standard deviation of split frequencies: 0.050087
15500 -- (-358.702) [-365.419] (-359.743) (-357.521) * (-367.957) [-358.187] (-381.094) (-380.386) -- 0:01:03
16000 -- (-357.653) (-364.109) [-359.081] (-358.247) * (-369.099) (-357.644) [-368.936] (-372.310) -- 0:01:01
16500 -- (-356.744) [-367.762] (-358.515) (-360.014) * (-369.966) [-357.142] (-375.536) (-360.933) -- 0:00:59
17000 -- (-359.370) (-367.956) [-360.125] (-356.962) * (-365.770) (-358.499) (-364.411) [-360.917] -- 0:00:57
17500 -- (-359.304) (-364.863) [-360.500] (-356.800) * (-368.184) [-359.084] (-368.916) (-358.275) -- 0:00:56
18000 -- (-358.696) [-366.128] (-357.818) (-357.134) * (-369.312) (-358.008) [-366.369] (-357.957) -- 0:00:54
18500 -- (-360.994) (-366.356) [-357.886] (-357.347) * (-372.054) (-359.304) (-370.855) [-360.418] -- 0:01:46
19000 -- (-359.318) [-368.570] (-362.892) (-357.583) * (-365.839) (-359.608) (-368.486) [-357.535] -- 0:01:43
19500 -- (-358.361) (-367.344) (-356.596) [-362.371] * [-367.584] (-359.925) (-368.826) (-360.719) -- 0:01:40
20000 -- [-357.534] (-369.505) (-356.754) (-359.075) * (-387.454) (-357.724) (-366.803) [-359.340] -- 0:01:38
Average standard deviation of split frequencies: 0.029146
20500 -- (-361.726) [-362.366] (-358.090) (-360.820) * [-368.405] (-356.872) (-369.288) (-359.075) -- 0:01:35
21000 -- (-358.882) (-373.340) [-361.865] (-359.666) * (-378.690) (-357.063) [-365.064] (-359.529) -- 0:01:33
21500 -- [-356.502] (-372.223) (-360.520) (-356.693) * (-372.394) (-357.010) [-366.655] (-360.896) -- 0:01:31
22000 -- (-358.225) (-369.483) (-360.428) [-357.024] * (-362.199) [-357.156] (-374.670) (-357.615) -- 0:01:28
22500 -- (-357.517) (-371.893) [-360.356] (-357.992) * (-362.568) (-357.920) [-371.452] (-358.592) -- 0:01:26
23000 -- (-361.118) [-363.994] (-358.201) (-357.199) * (-358.437) (-360.251) [-366.353] (-358.553) -- 0:01:24
23500 -- (-357.363) [-367.186] (-357.027) (-356.442) * (-361.138) (-358.572) [-369.849] (-360.369) -- 0:01:23
24000 -- (-357.938) (-371.391) [-357.127] (-358.985) * (-357.982) [-358.754] (-382.681) (-358.938) -- 0:01:21
24500 -- (-359.638) (-364.411) [-358.872] (-356.915) * (-357.791) (-357.470) [-364.365] (-359.121) -- 0:01:19
25000 -- [-358.032] (-373.358) (-358.858) (-358.794) * (-368.495) (-357.680) (-371.721) [-358.892] -- 0:01:18
Average standard deviation of split frequencies: 0.032808
25500 -- (-359.155) [-363.461] (-359.636) (-358.560) * (-361.288) (-358.143) [-371.604] (-361.350) -- 0:01:16
26000 -- (-361.074) [-366.285] (-362.135) (-357.853) * (-357.583) (-357.993) [-363.223] (-359.012) -- 0:01:14
26500 -- (-357.925) (-369.279) [-358.041] (-362.789) * (-357.966) (-361.571) (-362.891) [-364.242] -- 0:01:13
27000 -- (-364.200) (-366.522) [-358.029] (-357.773) * (-358.254) [-358.562] (-365.937) (-357.216) -- 0:01:12
27500 -- (-362.447) (-365.458) [-360.028] (-357.623) * (-357.261) (-362.670) (-371.074) [-357.887] -- 0:01:10
28000 -- (-360.379) (-367.504) [-358.478] (-359.996) * (-359.648) (-357.662) [-367.177] (-357.650) -- 0:01:09
28500 -- [-360.994] (-365.178) (-358.416) (-356.877) * (-358.521) (-358.236) [-363.528] (-358.186) -- 0:01:08
29000 -- (-361.596) (-371.535) (-357.922) [-363.677] * (-358.433) [-359.585] (-373.013) (-359.626) -- 0:01:06
29500 -- [-358.380] (-369.557) (-357.462) (-362.346) * [-357.467] (-359.127) (-369.565) (-357.432) -- 0:01:05
30000 -- [-358.169] (-361.385) (-357.047) (-360.139) * [-358.986] (-356.641) (-372.040) (-356.617) -- 0:01:04
Average standard deviation of split frequencies: 0.033818
30500 -- (-357.907) (-357.328) (-357.691) [-358.568] * (-356.594) [-358.942] (-366.363) (-361.883) -- 0:01:03
31000 -- (-358.615) [-359.168] (-358.391) (-362.677) * (-357.768) [-359.612] (-370.668) (-358.266) -- 0:01:02
31500 -- [-358.134] (-359.609) (-357.069) (-358.005) * [-362.612] (-357.828) (-372.891) (-357.464) -- 0:01:01
32000 -- (-357.606) (-359.718) (-360.372) [-357.725] * (-356.809) (-358.684) [-368.292] (-358.630) -- 0:01:00
32500 -- (-359.128) [-360.390] (-358.805) (-358.531) * (-357.612) (-361.825) (-368.002) [-359.993] -- 0:00:59
33000 -- (-361.966) (-357.536) [-359.057] (-359.680) * [-357.401] (-358.791) (-370.324) (-359.182) -- 0:00:58
33500 -- (-360.637) (-359.098) (-358.183) [-359.091] * [-357.406] (-357.778) (-377.000) (-361.013) -- 0:00:57
34000 -- (-358.697) [-357.001] (-357.956) (-358.311) * (-358.685) [-357.694] (-376.615) (-358.923) -- 0:00:56
34500 -- [-359.172] (-358.453) (-357.144) (-358.004) * (-363.743) (-360.165) [-368.115] (-357.551) -- 0:00:55
35000 -- (-357.337) (-361.947) (-358.354) [-358.247] * (-361.261) (-357.591) (-368.613) [-358.613] -- 0:01:22
Average standard deviation of split frequencies: 0.036527
35500 -- [-358.405] (-360.986) (-359.722) (-362.163) * (-359.064) (-362.494) (-383.357) [-360.550] -- 0:01:21
36000 -- (-359.015) [-359.076] (-357.065) (-358.885) * (-356.563) (-358.927) (-374.796) [-357.820] -- 0:01:20
36500 -- [-357.467] (-358.749) (-357.395) (-360.364) * (-361.689) [-358.105] (-378.454) (-359.441) -- 0:01:19
37000 -- (-358.656) [-357.517] (-357.383) (-359.163) * (-363.814) (-358.246) (-369.396) [-357.494] -- 0:01:18
37500 -- (-361.418) (-357.594) [-358.770] (-356.849) * (-358.562) [-357.474] (-366.889) (-361.173) -- 0:01:17
38000 -- (-358.122) (-358.478) [-361.936] (-361.198) * (-359.280) (-359.021) (-359.214) [-360.082] -- 0:01:15
38500 -- (-358.613) (-357.451) [-357.896] (-357.966) * (-365.459) (-357.097) [-357.357] (-357.891) -- 0:01:14
39000 -- (-357.231) [-358.614] (-358.896) (-361.688) * (-360.692) (-357.862) [-357.568] (-356.641) -- 0:01:13
39500 -- (-357.920) (-356.844) (-359.302) [-357.784] * (-358.455) (-359.187) [-358.016] (-360.516) -- 0:01:12
40000 -- (-358.380) (-356.407) (-357.395) [-358.855] * (-357.033) (-360.994) [-359.137] (-365.113) -- 0:01:12
Average standard deviation of split frequencies: 0.040267
40500 -- (-357.310) (-356.311) (-359.708) [-358.136] * (-359.094) (-359.678) (-358.134) [-358.121] -- 0:01:11
41000 -- (-359.077) [-357.137] (-360.621) (-359.806) * [-359.582] (-360.307) (-357.553) (-358.468) -- 0:01:10
41500 -- (-359.164) [-361.995] (-362.574) (-358.856) * (-359.147) (-359.246) (-358.614) [-356.647] -- 0:01:09
42000 -- (-362.039) [-358.461] (-362.757) (-358.737) * (-358.277) (-363.115) [-358.268] (-361.936) -- 0:01:08
42500 -- (-361.481) (-358.106) (-357.329) [-358.017] * (-357.894) (-358.650) [-358.232] (-358.044) -- 0:01:07
43000 -- (-358.939) [-357.040] (-357.847) (-356.843) * [-356.769] (-357.458) (-360.813) (-359.305) -- 0:01:06
43500 -- (-362.402) (-358.395) [-359.824] (-357.776) * (-358.205) (-359.735) [-360.509] (-357.711) -- 0:01:05
44000 -- [-357.955] (-359.430) (-360.503) (-357.306) * [-357.287] (-358.207) (-360.458) (-357.622) -- 0:01:05
44500 -- (-363.938) [-357.334] (-361.503) (-363.384) * (-356.973) (-357.286) (-357.778) [-358.987] -- 0:01:04
45000 -- [-358.726] (-359.031) (-360.189) (-365.669) * (-362.009) [-357.444] (-359.020) (-358.200) -- 0:01:03
Average standard deviation of split frequencies: 0.029853
45500 -- (-359.388) [-358.613] (-359.729) (-369.201) * (-358.910) (-358.553) [-357.358] (-359.915) -- 0:01:02
46000 -- (-358.305) [-358.645] (-356.701) (-362.468) * (-359.655) (-358.950) (-357.258) [-358.187] -- 0:01:02
46500 -- (-358.439) (-357.432) (-359.910) [-357.805] * (-361.042) [-358.882] (-359.947) (-356.658) -- 0:01:01
47000 -- (-360.955) [-357.139] (-360.892) (-357.652) * [-360.204] (-359.652) (-361.953) (-359.061) -- 0:01:00
47500 -- (-358.769) (-358.713) (-362.080) [-360.516] * [-358.713] (-358.348) (-362.644) (-361.843) -- 0:01:00
48000 -- (-357.766) (-357.820) [-358.470] (-360.387) * [-356.800] (-359.229) (-361.137) (-359.449) -- 0:00:59
48500 -- (-359.776) [-360.402] (-357.819) (-359.828) * [-358.859] (-363.779) (-360.100) (-358.038) -- 0:00:58
49000 -- (-358.829) (-358.116) [-358.962] (-363.454) * (-360.997) (-358.323) (-361.580) [-360.450] -- 0:00:58
49500 -- (-359.533) (-359.500) [-358.769] (-359.474) * [-358.790] (-359.023) (-359.738) (-357.844) -- 0:01:16
50000 -- [-358.782] (-356.422) (-359.749) (-359.461) * (-358.583) (-358.886) [-359.831] (-361.145) -- 0:01:16
Average standard deviation of split frequencies: 0.035947
50500 -- (-359.811) [-359.562] (-357.826) (-359.026) * (-360.563) (-359.264) [-359.717] (-361.184) -- 0:01:15
51000 -- [-358.584] (-357.408) (-357.453) (-359.762) * [-359.265] (-360.233) (-360.044) (-358.267) -- 0:01:14
51500 -- [-358.851] (-358.683) (-357.123) (-357.882) * (-358.442) (-358.100) [-359.596] (-358.064) -- 0:01:13
52000 -- [-357.730] (-360.517) (-360.126) (-359.324) * (-356.900) [-361.718] (-359.387) (-357.645) -- 0:01:12
52500 -- (-359.628) [-360.744] (-359.563) (-357.959) * [-362.323] (-362.106) (-360.585) (-359.137) -- 0:01:12
53000 -- (-359.594) (-359.319) [-357.030] (-359.857) * (-359.295) (-365.017) (-357.831) [-356.783] -- 0:01:11
53500 -- [-356.663] (-357.065) (-358.433) (-367.562) * [-357.927] (-356.914) (-356.585) (-360.638) -- 0:01:10
54000 -- (-358.082) [-358.194] (-357.394) (-357.830) * [-357.015] (-359.192) (-357.954) (-357.682) -- 0:01:10
54500 -- (-359.581) (-360.801) [-363.128] (-357.176) * [-357.294] (-357.522) (-359.779) (-358.455) -- 0:01:09
55000 -- (-360.702) (-358.094) (-361.678) [-356.989] * (-358.647) [-359.857] (-359.998) (-363.198) -- 0:01:08
Average standard deviation of split frequencies: 0.033271
55500 -- [-358.343] (-357.976) (-359.218) (-357.580) * (-356.452) [-358.973] (-357.092) (-357.109) -- 0:01:08
56000 -- (-358.489) [-357.827] (-357.319) (-356.908) * (-357.810) [-358.323] (-356.800) (-357.164) -- 0:01:07
56500 -- (-357.957) (-359.134) (-357.762) [-356.774] * (-357.065) (-361.509) (-359.607) [-358.386] -- 0:01:06
57000 -- [-357.301] (-357.333) (-357.816) (-358.011) * (-358.422) (-359.551) (-360.716) [-358.730] -- 0:01:06
57500 -- [-360.863] (-359.608) (-358.880) (-360.458) * (-360.952) (-362.083) [-358.373] (-356.782) -- 0:01:05
58000 -- (-358.155) [-360.429] (-363.513) (-359.890) * (-361.233) (-357.128) [-357.770] (-358.143) -- 0:01:04
58500 -- (-361.868) (-359.346) [-359.677] (-357.601) * (-363.113) (-359.458) (-358.753) [-357.779] -- 0:01:04
59000 -- (-358.670) (-358.920) [-360.160] (-358.675) * (-361.725) (-358.231) [-358.175] (-357.287) -- 0:01:03
59500 -- (-361.551) (-357.528) [-357.791] (-357.668) * [-357.443] (-359.826) (-363.226) (-361.004) -- 0:01:03
60000 -- (-360.680) [-357.265] (-363.319) (-356.633) * (-358.093) (-361.753) [-358.667] (-358.951) -- 0:01:02
Average standard deviation of split frequencies: 0.031452
60500 -- (-360.375) (-357.249) (-359.860) [-356.541] * (-362.511) (-360.238) (-356.970) [-357.887] -- 0:01:02
61000 -- (-359.112) (-357.543) (-361.898) [-358.094] * (-363.337) [-357.364] (-359.141) (-358.534) -- 0:01:01
61500 -- [-358.126] (-361.762) (-361.560) (-357.908) * (-360.602) (-367.768) (-359.288) [-358.155] -- 0:01:01
62000 -- [-363.261] (-360.551) (-359.241) (-361.483) * (-363.883) (-358.927) (-358.614) [-357.928] -- 0:01:00
62500 -- (-358.664) [-357.248] (-356.931) (-361.141) * (-359.616) (-358.780) [-360.792] (-358.435) -- 0:01:15
63000 -- (-357.662) [-359.230] (-360.161) (-359.448) * [-358.642] (-359.277) (-356.791) (-360.739) -- 0:01:14
63500 -- (-357.281) (-358.929) [-360.113] (-357.638) * [-358.590] (-358.731) (-358.121) (-362.694) -- 0:01:13
64000 -- (-358.762) (-358.513) (-357.114) [-357.517] * (-356.973) (-360.345) [-360.623] (-358.236) -- 0:01:13
64500 -- (-359.598) [-357.813] (-357.794) (-360.582) * [-357.790] (-358.949) (-358.461) (-357.329) -- 0:01:12
65000 -- (-358.471) (-359.836) (-357.081) [-356.989] * (-358.548) (-357.491) (-359.302) [-356.893] -- 0:01:11
Average standard deviation of split frequencies: 0.027890
65500 -- (-358.838) (-356.799) (-358.850) [-357.086] * (-357.428) [-360.188] (-362.817) (-358.430) -- 0:01:11
66000 -- (-361.012) (-361.239) [-361.870] (-360.368) * (-358.746) (-361.222) (-359.894) [-360.535] -- 0:01:10
66500 -- (-358.384) (-358.647) (-359.004) [-358.219] * (-358.460) [-361.390] (-361.603) (-357.795) -- 0:01:10
67000 -- [-357.681] (-357.821) (-357.360) (-360.904) * (-358.204) [-360.391] (-361.878) (-359.366) -- 0:01:09
67500 -- [-356.442] (-359.852) (-358.945) (-358.600) * [-358.653] (-359.439) (-358.594) (-359.980) -- 0:01:09
68000 -- [-357.859] (-357.276) (-362.185) (-358.533) * (-358.885) (-360.565) (-357.737) [-356.403] -- 0:01:08
68500 -- [-358.905] (-358.554) (-362.388) (-358.824) * [-360.853] (-359.689) (-358.221) (-359.597) -- 0:01:07
69000 -- (-359.404) [-359.127] (-360.355) (-359.130) * (-360.955) (-359.923) (-358.205) [-359.638] -- 0:01:07
69500 -- (-357.323) [-358.470] (-359.663) (-359.310) * [-357.669] (-360.178) (-357.053) (-359.177) -- 0:01:06
70000 -- (-358.738) [-357.632] (-362.666) (-359.680) * (-357.086) (-357.214) (-356.529) [-357.813] -- 0:01:06
Average standard deviation of split frequencies: 0.028351
70500 -- [-358.257] (-360.445) (-356.866) (-363.443) * [-357.827] (-357.338) (-357.145) (-357.520) -- 0:01:05
71000 -- (-367.383) (-361.673) (-358.446) [-359.189] * (-361.585) (-356.834) [-357.609] (-357.985) -- 0:01:05
71500 -- (-360.259) [-362.477] (-357.729) (-366.261) * [-359.656] (-357.581) (-363.224) (-359.687) -- 0:01:04
72000 -- (-363.115) [-362.037] (-357.612) (-361.292) * (-361.408) [-360.587] (-363.294) (-357.583) -- 0:01:04
72500 -- (-361.013) [-356.760] (-357.400) (-358.770) * (-364.018) (-360.151) [-357.517] (-356.997) -- 0:01:03
73000 -- [-358.001] (-362.972) (-360.204) (-361.984) * (-357.667) [-359.022] (-356.842) (-360.622) -- 0:01:03
73500 -- [-357.173] (-360.391) (-356.856) (-357.417) * (-359.855) [-357.014] (-359.338) (-363.768) -- 0:01:03
74000 -- (-359.454) (-358.750) [-357.308] (-356.738) * (-365.185) (-359.638) [-357.769] (-357.890) -- 0:01:02
74500 -- (-360.726) [-358.526] (-366.692) (-357.097) * (-356.743) (-357.994) (-359.724) [-360.979] -- 0:01:02
75000 -- (-358.713) [-358.360] (-358.293) (-356.786) * (-356.968) [-358.281] (-359.011) (-360.713) -- 0:01:01
Average standard deviation of split frequencies: 0.025121
75500 -- (-364.541) [-359.892] (-357.219) (-358.080) * (-358.699) (-358.015) (-358.659) [-357.214] -- 0:01:13
76000 -- [-356.630] (-358.005) (-359.324) (-357.928) * (-358.342) (-360.005) (-358.956) [-357.042] -- 0:01:12
76500 -- (-356.537) (-362.555) [-358.041] (-357.062) * [-359.075] (-361.231) (-359.688) (-360.606) -- 0:01:12
77000 -- (-358.675) [-358.751] (-361.487) (-358.670) * [-358.686] (-356.304) (-357.210) (-357.596) -- 0:01:11
77500 -- [-356.895] (-358.040) (-358.669) (-362.345) * (-359.597) (-362.077) [-357.268] (-357.889) -- 0:01:11
78000 -- (-357.064) (-359.779) [-358.521] (-359.649) * (-358.012) (-361.659) [-357.090] (-360.877) -- 0:01:10
78500 -- (-358.824) (-357.730) (-356.965) [-357.014] * [-356.409] (-359.405) (-356.751) (-358.322) -- 0:01:10
79000 -- (-358.039) (-360.664) (-362.291) [-357.951] * [-357.866] (-357.909) (-356.702) (-358.519) -- 0:01:09
79500 -- (-358.005) (-360.901) [-356.504] (-357.634) * (-359.371) [-358.591] (-359.543) (-357.975) -- 0:01:09
80000 -- (-357.828) (-360.155) (-363.007) [-357.260] * [-359.206] (-357.942) (-357.068) (-357.237) -- 0:01:09
Average standard deviation of split frequencies: 0.027921
80500 -- (-358.966) (-358.704) [-357.318] (-361.739) * [-359.248] (-358.929) (-356.844) (-360.360) -- 0:01:08
81000 -- (-358.338) (-357.800) [-356.987] (-359.825) * (-357.217) (-357.863) (-357.214) [-359.994] -- 0:01:08
81500 -- (-361.241) (-358.544) (-357.350) [-358.261] * (-358.419) (-361.420) [-357.887] (-358.159) -- 0:01:07
82000 -- [-359.284] (-359.481) (-358.441) (-360.743) * (-363.515) (-359.224) [-358.990] (-357.619) -- 0:01:07
82500 -- [-358.985] (-356.910) (-359.310) (-357.963) * (-358.513) (-358.873) [-357.719] (-357.504) -- 0:01:06
83000 -- (-360.019) (-359.315) [-359.863] (-357.096) * (-359.001) [-358.423] (-364.881) (-358.887) -- 0:01:06
83500 -- (-359.773) (-358.154) (-357.433) [-357.587] * (-358.449) (-358.270) [-358.673] (-359.394) -- 0:01:05
84000 -- [-361.315] (-361.597) (-357.065) (-356.448) * [-359.019] (-360.496) (-359.123) (-358.362) -- 0:01:05
84500 -- (-358.345) (-359.940) (-357.107) [-356.695] * (-363.422) (-359.203) [-362.183] (-358.711) -- 0:01:05
85000 -- (-357.708) [-358.260] (-357.760) (-357.064) * [-360.938] (-361.137) (-359.320) (-358.673) -- 0:01:04
Average standard deviation of split frequencies: 0.029138
85500 -- (-357.407) [-358.522] (-357.378) (-357.763) * (-358.932) [-358.278] (-360.074) (-358.949) -- 0:01:04
86000 -- [-362.998] (-360.460) (-360.208) (-360.758) * (-358.677) (-357.723) [-358.888] (-359.928) -- 0:01:03
86500 -- (-357.783) (-360.030) (-358.893) [-357.861] * (-358.765) [-359.095] (-359.187) (-357.204) -- 0:01:03
87000 -- (-357.414) (-361.257) [-361.038] (-360.665) * [-360.760] (-357.892) (-358.499) (-357.174) -- 0:01:02
87500 -- [-359.755] (-357.858) (-358.531) (-356.860) * (-358.834) (-358.281) [-357.071] (-360.922) -- 0:01:02
88000 -- (-359.095) (-360.302) [-360.213] (-358.903) * (-358.160) (-360.469) (-358.188) [-359.077] -- 0:01:12
88500 -- (-357.724) (-356.557) [-361.062] (-358.735) * [-358.939] (-359.334) (-356.924) (-363.907) -- 0:01:12
89000 -- (-356.544) (-360.956) (-358.513) [-359.355] * (-362.981) [-360.591] (-359.330) (-360.134) -- 0:01:11
89500 -- (-357.509) (-357.566) (-363.380) [-357.696] * [-358.744] (-361.923) (-357.535) (-364.336) -- 0:01:11
90000 -- (-356.590) (-360.598) (-362.104) [-358.304] * (-358.154) (-363.988) [-358.119] (-360.093) -- 0:01:10
Average standard deviation of split frequencies: 0.028307
90500 -- (-359.731) [-358.066] (-358.980) (-356.563) * (-357.058) (-362.680) [-360.023] (-358.797) -- 0:01:10
91000 -- (-356.828) (-357.076) (-358.242) [-356.786] * (-359.026) (-361.200) (-357.597) [-357.852] -- 0:01:09
91500 -- (-356.878) (-356.941) [-356.880] (-360.272) * (-357.904) (-359.769) (-359.067) [-357.925] -- 0:01:09
92000 -- [-358.517] (-358.046) (-358.496) (-359.688) * (-357.883) [-359.009] (-356.969) (-358.396) -- 0:01:09
92500 -- (-358.413) (-363.825) (-365.876) [-358.354] * (-357.500) (-358.962) (-359.851) [-358.065] -- 0:01:08
93000 -- (-359.393) (-357.347) (-362.482) [-357.697] * (-358.456) (-361.326) [-360.978] (-357.949) -- 0:01:08
93500 -- [-357.344] (-356.984) (-357.497) (-359.081) * (-359.554) (-357.671) (-359.047) [-357.092] -- 0:01:07
94000 -- (-356.586) [-359.411] (-358.554) (-358.497) * (-358.929) (-358.705) [-357.473] (-367.871) -- 0:01:07
94500 -- (-356.983) (-358.421) [-359.467] (-360.372) * (-361.959) (-360.353) [-359.091] (-358.112) -- 0:01:07
95000 -- (-362.077) (-358.666) (-357.445) [-361.171] * (-356.855) (-357.972) [-358.774] (-357.614) -- 0:01:06
Average standard deviation of split frequencies: 0.025098
95500 -- (-360.268) (-356.831) (-357.422) [-361.436] * (-356.317) (-360.126) (-360.917) [-358.299] -- 0:01:06
96000 -- (-358.088) (-357.357) (-358.095) [-358.516] * [-356.765] (-358.441) (-358.032) (-360.142) -- 0:01:05
96500 -- (-358.174) [-358.786] (-359.186) (-357.282) * (-358.535) [-357.003] (-360.468) (-359.596) -- 0:01:05
97000 -- (-356.308) (-357.650) (-357.543) [-361.441] * (-356.569) [-357.063] (-360.155) (-358.444) -- 0:01:05
97500 -- (-358.927) (-359.245) (-358.295) [-358.147] * [-356.914] (-356.956) (-357.951) (-357.439) -- 0:01:04
98000 -- [-358.167] (-358.894) (-357.464) (-357.374) * (-356.477) (-357.220) [-358.992] (-358.005) -- 0:01:04
98500 -- (-359.570) [-357.638] (-358.660) (-356.817) * (-358.944) [-357.054] (-357.434) (-356.724) -- 0:01:04
99000 -- [-358.980] (-359.772) (-358.565) (-361.488) * (-357.064) (-359.229) (-357.828) [-356.384] -- 0:01:03
99500 -- (-359.102) (-362.820) (-362.651) [-361.574] * (-357.487) (-358.365) (-359.411) [-358.005] -- 0:01:03
100000 -- (-358.162) (-359.979) (-359.524) [-357.873] * (-360.836) (-358.718) [-357.936] (-361.547) -- 0:01:02
Average standard deviation of split frequencies: 0.027577
100500 -- [-358.497] (-357.719) (-357.597) (-360.644) * [-357.295] (-360.175) (-360.154) (-359.067) -- 0:01:02
101000 -- (-359.203) [-357.949] (-357.751) (-359.565) * (-361.602) (-362.000) (-359.794) [-359.327] -- 0:01:11
101500 -- (-358.028) (-357.865) [-358.607] (-359.447) * (-359.299) [-358.350] (-361.822) (-358.531) -- 0:01:10
102000 -- (-357.268) (-358.607) [-357.437] (-358.428) * (-359.241) (-359.964) [-359.469] (-359.491) -- 0:01:10
102500 -- (-358.062) [-360.881] (-358.322) (-362.094) * (-359.000) [-357.358] (-359.442) (-361.577) -- 0:01:10
103000 -- (-357.188) (-356.971) (-360.807) [-359.909] * (-357.287) (-360.100) [-357.867] (-359.221) -- 0:01:09
103500 -- (-359.083) (-358.254) [-357.355] (-361.651) * (-358.527) [-357.817] (-360.109) (-358.962) -- 0:01:09
104000 -- [-356.968] (-358.651) (-357.966) (-360.927) * (-359.627) (-361.605) [-357.910] (-360.785) -- 0:01:08
104500 -- (-358.246) [-358.728] (-356.856) (-360.424) * (-358.018) [-358.183] (-357.597) (-362.111) -- 0:01:08
105000 -- [-357.196] (-357.661) (-356.868) (-357.245) * (-360.656) [-358.617] (-360.072) (-357.627) -- 0:01:08
Average standard deviation of split frequencies: 0.024460
105500 -- (-359.224) (-359.463) (-357.215) [-358.662] * (-358.235) (-359.964) (-357.520) [-357.000] -- 0:01:07
106000 -- [-357.547] (-361.277) (-358.998) (-358.692) * [-356.456] (-359.103) (-360.348) (-358.730) -- 0:01:07
106500 -- [-358.162] (-358.516) (-358.987) (-356.372) * [-358.223] (-357.460) (-360.954) (-357.655) -- 0:01:07
107000 -- (-360.567) (-358.122) [-358.101] (-360.522) * (-357.499) (-358.436) [-361.093] (-358.521) -- 0:01:06
107500 -- (-363.938) (-356.780) [-358.883] (-358.003) * (-356.331) [-359.925] (-361.862) (-359.328) -- 0:01:06
108000 -- (-356.789) [-357.647] (-358.846) (-360.706) * (-358.456) (-361.588) [-362.239] (-361.576) -- 0:01:06
108500 -- (-357.269) (-358.211) (-358.018) [-360.847] * (-358.412) (-358.682) (-362.165) [-358.971] -- 0:01:05
109000 -- (-358.373) [-357.666] (-358.592) (-360.610) * (-361.624) [-356.952] (-360.331) (-358.105) -- 0:01:05
109500 -- [-357.151] (-358.840) (-362.178) (-357.070) * (-359.957) (-364.021) [-356.376] (-357.971) -- 0:01:05
110000 -- (-361.561) (-359.647) (-359.749) [-358.875] * (-358.513) (-359.403) [-357.569] (-359.010) -- 0:01:04
Average standard deviation of split frequencies: 0.023192
110500 -- (-358.910) (-360.977) [-356.970] (-362.833) * (-359.534) [-357.484] (-358.239) (-358.190) -- 0:01:04
111000 -- (-360.216) [-360.010] (-357.943) (-359.216) * [-356.910] (-362.254) (-357.617) (-357.964) -- 0:01:04
111500 -- (-359.692) (-357.469) (-358.744) [-356.941] * [-358.549] (-356.654) (-360.932) (-360.545) -- 0:01:03
112000 -- [-357.757] (-362.487) (-356.961) (-356.787) * (-358.371) [-357.587] (-361.529) (-358.642) -- 0:01:03
112500 -- (-361.862) (-356.996) (-357.022) [-358.427] * (-359.131) (-360.042) [-356.628] (-359.826) -- 0:01:03
113000 -- [-358.410] (-357.089) (-358.365) (-360.119) * (-358.319) (-361.435) (-356.362) [-359.909] -- 0:01:02
113500 -- (-366.014) (-358.089) (-356.292) [-361.244] * (-359.896) (-360.116) [-364.181] (-362.660) -- 0:01:10
114000 -- (-361.426) [-357.186] (-357.319) (-358.219) * (-357.648) [-357.628] (-360.795) (-365.686) -- 0:01:09
114500 -- [-361.989] (-360.267) (-357.411) (-356.746) * (-358.323) [-356.811] (-358.543) (-359.992) -- 0:01:09
115000 -- (-359.340) (-360.321) [-361.173] (-358.609) * (-360.545) (-359.730) [-357.039] (-359.406) -- 0:01:09
Average standard deviation of split frequencies: 0.023254
115500 -- (-357.653) (-359.574) [-359.162] (-358.698) * (-357.991) (-357.698) (-357.792) [-358.908] -- 0:01:08
116000 -- [-357.407] (-363.163) (-360.947) (-357.733) * [-357.484] (-358.968) (-360.996) (-358.147) -- 0:01:08
116500 -- [-358.816] (-359.814) (-361.271) (-360.323) * [-357.558] (-358.412) (-363.812) (-362.190) -- 0:01:08
117000 -- [-357.200] (-359.916) (-359.577) (-359.819) * (-357.550) (-357.410) (-361.367) [-360.046] -- 0:01:07
117500 -- [-357.177] (-357.678) (-357.211) (-358.713) * [-358.206] (-359.255) (-362.026) (-356.349) -- 0:01:07
118000 -- (-358.518) (-358.150) [-357.765] (-358.679) * (-358.305) [-358.345] (-359.603) (-359.825) -- 0:01:07
118500 -- (-362.634) (-357.491) [-359.363] (-358.947) * (-359.048) [-357.488] (-358.362) (-356.794) -- 0:01:06
119000 -- [-362.111] (-358.278) (-358.248) (-356.901) * (-357.743) (-361.884) (-358.578) [-358.496] -- 0:01:06
119500 -- (-358.004) (-357.383) [-357.431] (-358.115) * (-359.044) (-360.057) (-359.824) [-358.259] -- 0:01:06
120000 -- [-358.662] (-356.898) (-361.056) (-359.838) * (-359.543) [-357.977] (-357.022) (-357.571) -- 0:01:06
Average standard deviation of split frequencies: 0.021921
120500 -- (-358.246) [-356.984] (-360.219) (-362.221) * [-356.910] (-358.543) (-359.842) (-359.257) -- 0:01:05
121000 -- (-358.222) (-360.447) [-360.866] (-363.777) * (-356.391) [-357.812] (-358.070) (-358.465) -- 0:01:05
121500 -- [-356.933] (-358.594) (-357.038) (-362.514) * (-358.340) (-358.080) (-359.965) [-361.828] -- 0:01:05
122000 -- (-358.396) (-359.263) [-360.001] (-359.849) * (-361.780) (-356.927) [-358.153] (-358.516) -- 0:01:04
122500 -- (-357.614) [-361.283] (-357.721) (-358.886) * (-360.070) (-358.678) (-361.925) [-363.419] -- 0:01:04
123000 -- (-359.206) (-361.174) (-363.114) [-356.721] * (-360.171) [-358.222] (-356.636) (-361.969) -- 0:01:04
123500 -- (-359.167) [-359.791] (-359.909) (-358.105) * (-358.930) [-358.673] (-356.673) (-361.506) -- 0:01:03
124000 -- (-358.137) (-360.279) [-357.858] (-360.827) * (-357.100) (-357.226) (-362.965) [-357.433] -- 0:01:03
124500 -- (-358.164) [-356.953] (-362.851) (-357.145) * (-357.032) (-358.819) (-359.616) [-358.738] -- 0:01:03
125000 -- [-359.447] (-358.385) (-360.303) (-357.938) * (-357.270) [-361.435] (-360.985) (-360.795) -- 0:01:03
Average standard deviation of split frequencies: 0.019494
125500 -- (-359.909) (-356.985) [-360.148] (-359.568) * (-358.798) (-358.814) [-361.148] (-363.753) -- 0:01:02
126000 -- (-361.129) [-358.486] (-357.380) (-357.734) * (-357.945) (-360.088) (-362.483) [-360.705] -- 0:01:09
126500 -- [-360.212] (-358.298) (-358.269) (-360.033) * (-357.942) [-361.783] (-358.765) (-362.298) -- 0:01:09
127000 -- (-359.587) (-358.569) [-357.104] (-358.422) * (-357.660) (-359.484) (-362.340) [-361.220] -- 0:01:08
127500 -- (-360.419) (-359.252) (-356.825) [-359.135] * [-357.599] (-359.137) (-360.941) (-357.128) -- 0:01:08
128000 -- [-359.911] (-365.138) (-358.633) (-360.291) * (-357.122) (-363.222) (-359.763) [-359.903] -- 0:01:08
128500 -- (-358.955) (-358.801) (-359.155) [-359.866] * [-357.885] (-359.680) (-358.833) (-358.001) -- 0:01:07
129000 -- [-358.075] (-358.382) (-361.591) (-357.283) * [-360.500] (-358.467) (-359.395) (-361.259) -- 0:01:07
129500 -- (-357.894) [-357.226] (-362.327) (-358.218) * (-360.535) (-357.515) (-357.061) [-358.204] -- 0:01:07
130000 -- (-358.128) (-362.616) (-359.208) [-358.633] * (-359.459) (-358.670) (-359.178) [-357.248] -- 0:01:06
Average standard deviation of split frequencies: 0.020697
130500 -- (-357.855) (-358.418) [-357.892] (-358.967) * (-357.924) [-358.204] (-359.758) (-358.792) -- 0:01:06
131000 -- [-358.232] (-360.450) (-357.696) (-359.288) * (-358.695) [-359.281] (-356.866) (-361.284) -- 0:01:06
131500 -- (-358.978) (-357.438) [-357.998] (-357.609) * (-357.813) [-360.455] (-357.798) (-358.287) -- 0:01:06
132000 -- [-357.990] (-357.557) (-360.815) (-362.668) * (-362.345) (-359.120) (-357.066) [-359.327] -- 0:01:05
132500 -- (-357.312) (-356.680) [-359.010] (-357.039) * [-360.576] (-357.908) (-356.683) (-357.477) -- 0:01:05
133000 -- (-359.125) (-358.869) [-358.386] (-358.594) * (-357.271) [-360.283] (-358.981) (-357.283) -- 0:01:05
133500 -- (-361.174) (-358.587) [-357.840] (-361.536) * (-357.753) (-358.909) [-359.778] (-359.289) -- 0:01:04
134000 -- (-369.804) [-356.867] (-357.837) (-356.980) * (-357.853) (-357.411) [-358.217] (-356.684) -- 0:01:04
134500 -- (-359.376) [-357.736] (-357.162) (-358.927) * (-358.721) (-358.555) [-358.016] (-358.774) -- 0:01:04
135000 -- (-361.670) (-360.134) [-356.404] (-361.080) * (-356.770) (-357.076) [-357.869] (-360.326) -- 0:01:04
Average standard deviation of split frequencies: 0.021182
135500 -- [-357.825] (-358.561) (-358.032) (-360.497) * (-358.667) [-359.657] (-358.530) (-356.685) -- 0:01:03
136000 -- (-360.266) [-361.487] (-357.709) (-358.289) * (-361.023) (-358.768) (-359.895) [-360.293] -- 0:01:03
136500 -- (-359.565) (-358.805) (-356.495) [-359.063] * [-360.561] (-359.192) (-358.817) (-360.235) -- 0:01:03
137000 -- (-358.521) (-359.448) [-358.126] (-356.840) * (-357.789) (-362.278) [-359.351] (-356.905) -- 0:01:02
137500 -- (-357.562) (-360.760) [-357.804] (-356.941) * (-358.038) (-357.026) [-359.079] (-358.609) -- 0:01:02
138000 -- (-358.029) [-361.534] (-356.599) (-357.608) * (-358.009) (-358.061) (-356.446) [-357.369] -- 0:01:02
138500 -- (-361.435) (-357.826) (-359.180) [-357.330] * (-357.532) (-357.847) [-357.815] (-362.954) -- 0:01:08
139000 -- (-360.774) [-362.297] (-366.546) (-358.579) * (-358.691) (-358.121) [-358.478] (-358.347) -- 0:01:08
139500 -- (-360.189) (-358.443) [-357.361] (-356.854) * (-357.365) (-360.203) [-357.925] (-357.806) -- 0:01:07
140000 -- (-359.887) [-356.351] (-359.738) (-359.651) * [-357.657] (-358.069) (-357.692) (-358.161) -- 0:01:07
Average standard deviation of split frequencies: 0.023086
140500 -- (-358.384) (-356.900) (-357.447) [-356.480] * [-359.038] (-358.126) (-357.479) (-357.285) -- 0:01:07
141000 -- (-360.187) [-357.149] (-357.154) (-356.776) * (-358.021) (-357.282) [-357.099] (-357.046) -- 0:01:07
141500 -- [-357.961] (-358.840) (-359.281) (-358.420) * (-356.896) [-357.282] (-358.550) (-358.117) -- 0:01:06
142000 -- (-357.483) (-359.564) [-357.245] (-357.408) * (-359.568) (-358.711) [-357.759] (-358.706) -- 0:01:06
142500 -- [-356.583] (-356.675) (-358.198) (-358.797) * (-360.516) [-357.452] (-358.898) (-356.902) -- 0:01:06
143000 -- [-358.016] (-357.464) (-360.950) (-360.392) * (-360.252) (-359.532) [-359.117] (-359.262) -- 0:01:05
143500 -- (-358.462) (-357.620) [-359.347] (-360.978) * (-359.550) [-359.780] (-357.422) (-358.035) -- 0:01:05
144000 -- (-362.802) [-358.992] (-359.631) (-362.813) * (-358.060) [-359.289] (-358.013) (-358.166) -- 0:01:05
144500 -- [-357.137] (-361.181) (-358.427) (-358.914) * (-359.081) (-356.794) [-357.003] (-357.378) -- 0:01:05
145000 -- [-356.631] (-359.297) (-360.630) (-357.405) * (-359.241) (-358.614) (-357.704) [-356.657] -- 0:01:04
Average standard deviation of split frequencies: 0.022092
145500 -- (-361.770) (-357.879) (-360.996) [-360.487] * (-359.399) (-361.068) [-359.079] (-357.395) -- 0:01:04
146000 -- [-362.528] (-357.600) (-359.940) (-359.876) * [-358.159] (-360.564) (-363.336) (-357.300) -- 0:01:04
146500 -- (-363.438) [-359.109] (-359.655) (-361.047) * (-357.256) (-362.937) (-361.862) [-358.769] -- 0:01:04
147000 -- (-359.520) (-357.186) [-359.507] (-361.498) * (-356.631) (-359.014) (-357.323) [-359.948] -- 0:01:03
147500 -- [-360.277] (-362.642) (-359.606) (-358.095) * (-360.359) (-361.113) (-359.967) [-357.622] -- 0:01:03
148000 -- (-362.860) [-357.536] (-359.133) (-359.039) * (-357.378) (-360.097) [-359.529] (-358.168) -- 0:01:03
148500 -- (-358.217) (-357.302) [-359.077] (-359.441) * (-358.481) [-359.639] (-358.023) (-357.187) -- 0:01:03
149000 -- (-357.267) [-358.444] (-362.329) (-357.613) * (-358.417) [-360.119] (-360.503) (-358.061) -- 0:01:02
149500 -- (-357.037) (-361.028) (-359.481) [-356.824] * (-360.323) (-357.368) (-358.533) [-358.470] -- 0:01:02
150000 -- (-361.523) (-363.578) (-357.908) [-359.211] * (-361.839) (-357.813) (-361.966) [-358.535] -- 0:01:02
Average standard deviation of split frequencies: 0.022771
150500 -- (-357.756) [-360.738] (-358.290) (-356.769) * (-362.626) [-357.914] (-361.224) (-359.041) -- 0:01:02
151000 -- (-359.808) (-359.749) (-360.939) [-359.215] * (-359.903) [-358.159] (-359.305) (-362.204) -- 0:01:01
151500 -- (-361.085) (-362.716) [-357.474] (-359.999) * (-359.835) (-360.100) [-359.924] (-359.850) -- 0:01:01
152000 -- (-357.930) (-363.413) [-359.888] (-358.515) * [-359.666] (-357.871) (-359.635) (-357.795) -- 0:01:06
152500 -- (-358.215) [-357.635] (-358.736) (-357.987) * (-357.532) [-356.830] (-358.066) (-361.229) -- 0:01:06
153000 -- (-360.603) (-360.415) [-357.505] (-359.446) * (-358.852) [-357.604] (-359.178) (-359.032) -- 0:01:06
153500 -- (-359.251) (-359.479) (-359.116) [-356.540] * (-361.561) (-357.867) [-357.565] (-358.995) -- 0:01:06
154000 -- (-357.844) [-358.463] (-358.938) (-358.340) * [-358.765] (-365.235) (-359.072) (-360.671) -- 0:01:05
154500 -- (-358.253) [-357.730] (-360.527) (-357.380) * [-357.537] (-359.480) (-359.071) (-357.749) -- 0:01:05
155000 -- (-358.145) [-359.169] (-361.005) (-359.192) * (-365.463) [-361.462] (-359.147) (-358.467) -- 0:01:05
Average standard deviation of split frequencies: 0.022832
155500 -- (-359.938) (-358.909) [-361.515] (-360.239) * (-359.967) [-357.809] (-362.907) (-357.224) -- 0:01:05
156000 -- (-358.695) (-361.327) [-357.276] (-357.771) * (-358.235) (-357.388) (-363.585) [-357.441] -- 0:01:04
156500 -- (-358.999) (-358.063) (-360.246) [-360.589] * [-356.595] (-359.511) (-361.111) (-359.048) -- 0:01:04
157000 -- (-358.162) (-357.316) (-359.151) [-358.402] * [-356.786] (-357.228) (-360.428) (-357.780) -- 0:01:04
157500 -- (-359.247) (-360.257) [-357.053] (-357.285) * [-359.696] (-358.239) (-358.948) (-357.275) -- 0:01:04
158000 -- (-358.927) [-357.116] (-357.079) (-360.278) * (-358.398) (-358.250) [-357.406] (-357.311) -- 0:01:03
158500 -- (-358.590) (-358.429) (-362.194) [-357.573] * (-360.096) (-357.806) [-357.177] (-357.273) -- 0:01:03
159000 -- (-357.971) (-360.073) (-359.269) [-360.714] * (-358.765) (-359.810) (-361.907) [-358.215] -- 0:01:03
159500 -- (-357.578) [-357.658] (-359.082) (-356.809) * (-358.486) (-359.130) (-359.787) [-357.201] -- 0:01:03
160000 -- (-357.878) (-358.833) [-358.457] (-363.113) * (-357.918) (-358.736) [-359.142] (-357.364) -- 0:01:02
Average standard deviation of split frequencies: 0.021679
160500 -- (-356.930) (-358.514) [-360.410] (-358.353) * (-361.540) [-357.585] (-358.687) (-358.320) -- 0:01:02
161000 -- [-358.108] (-361.778) (-363.491) (-364.106) * (-361.066) [-357.231] (-357.002) (-363.346) -- 0:01:02
161500 -- (-359.297) [-360.753] (-360.476) (-357.752) * (-361.316) (-359.489) (-358.301) [-361.617] -- 0:01:02
162000 -- (-358.539) (-360.214) [-359.104] (-357.795) * [-358.935] (-360.055) (-359.715) (-361.108) -- 0:01:02
162500 -- (-360.150) [-359.043] (-356.624) (-356.676) * (-360.306) (-359.101) (-358.707) [-362.216] -- 0:01:01
163000 -- [-357.252] (-359.819) (-356.729) (-361.178) * (-357.513) [-359.929] (-361.908) (-360.051) -- 0:01:01
163500 -- (-359.949) (-363.391) (-360.341) [-358.863] * (-358.651) [-358.211] (-356.536) (-360.926) -- 0:01:01
164000 -- [-358.127] (-360.035) (-359.915) (-358.025) * (-358.411) [-357.880] (-359.935) (-360.131) -- 0:01:01
164500 -- [-357.718] (-358.228) (-358.542) (-357.388) * [-358.820] (-359.266) (-359.444) (-358.834) -- 0:01:00
165000 -- [-356.566] (-358.193) (-358.224) (-358.050) * (-360.592) (-363.276) [-358.770] (-361.160) -- 0:01:00
Average standard deviation of split frequencies: 0.022087
165500 -- (-358.182) [-361.517] (-359.087) (-360.824) * (-357.026) (-362.987) [-359.197] (-363.315) -- 0:01:00
166000 -- [-360.423] (-356.678) (-361.886) (-359.464) * (-356.578) (-358.686) (-358.773) [-359.994] -- 0:01:05
166500 -- (-360.729) (-358.452) (-364.823) [-356.904] * (-357.638) (-358.168) [-357.156] (-358.939) -- 0:01:05
167000 -- (-357.565) [-358.649] (-360.463) (-357.679) * (-356.610) (-357.222) [-358.053] (-360.007) -- 0:01:04
167500 -- [-359.098] (-359.434) (-358.333) (-361.242) * [-356.817] (-356.948) (-363.813) (-356.995) -- 0:01:04
168000 -- (-360.728) (-359.853) (-357.906) [-360.617] * (-359.280) [-358.021] (-363.073) (-357.698) -- 0:01:04
168500 -- [-359.443] (-357.925) (-357.692) (-363.354) * [-358.966] (-357.904) (-360.780) (-360.983) -- 0:01:04
169000 -- (-358.783) (-359.471) (-359.036) [-359.829] * [-357.646] (-360.265) (-360.740) (-360.376) -- 0:01:03
169500 -- (-358.177) (-357.013) (-359.087) [-357.991] * [-357.050] (-359.923) (-357.975) (-359.424) -- 0:01:03
170000 -- (-359.796) [-357.265] (-357.313) (-356.857) * (-357.591) (-357.443) (-356.612) [-356.424] -- 0:01:03
Average standard deviation of split frequencies: 0.021772
170500 -- (-358.788) (-358.171) (-358.520) [-358.065] * (-358.190) (-361.376) [-358.020] (-359.716) -- 0:01:03
171000 -- (-357.629) [-358.711] (-358.687) (-358.742) * (-360.553) (-362.158) (-357.755) [-361.156] -- 0:01:03
171500 -- [-357.357] (-356.796) (-359.594) (-358.018) * (-359.572) [-358.426] (-357.009) (-358.718) -- 0:01:02
172000 -- (-361.692) (-360.537) [-359.319] (-357.599) * (-360.944) [-356.850] (-358.092) (-357.170) -- 0:01:02
172500 -- (-357.633) (-357.823) [-357.916] (-358.439) * (-358.184) [-356.549] (-357.578) (-365.519) -- 0:01:02
173000 -- (-360.531) (-357.750) [-357.438] (-361.757) * (-358.323) (-358.373) (-358.113) [-361.075] -- 0:01:02
173500 -- [-358.704] (-362.442) (-359.710) (-360.437) * (-358.166) [-357.324] (-357.072) (-357.986) -- 0:01:01
174000 -- (-362.413) (-364.868) (-358.169) [-356.519] * (-357.908) (-358.520) [-357.375] (-359.318) -- 0:01:01
174500 -- (-358.019) (-359.065) (-359.583) [-358.547] * (-359.277) (-357.534) (-359.808) [-358.090] -- 0:01:01
175000 -- (-358.427) (-358.618) (-358.249) [-358.188] * [-358.613] (-359.547) (-357.645) (-357.820) -- 0:01:01
Average standard deviation of split frequencies: 0.018326
175500 -- (-357.228) [-358.778] (-357.629) (-358.001) * (-357.639) (-359.302) (-359.004) [-361.441] -- 0:01:01
176000 -- (-358.321) [-358.498] (-360.634) (-361.392) * (-358.873) (-356.491) [-357.398] (-359.334) -- 0:01:00
176500 -- (-359.006) (-357.251) [-360.422] (-360.616) * (-359.508) (-356.966) [-357.849] (-359.393) -- 0:01:00
177000 -- (-359.307) (-357.390) (-358.711) [-359.513] * (-360.035) (-357.583) [-357.057] (-358.263) -- 0:01:00
177500 -- (-360.497) (-359.246) [-358.730] (-361.569) * (-358.128) (-357.452) (-359.122) [-359.538] -- 0:01:00
178000 -- (-359.058) (-357.153) (-357.851) [-357.368] * [-358.183] (-357.264) (-358.466) (-361.398) -- 0:01:00
178500 -- (-358.999) (-362.374) [-357.031] (-360.331) * [-362.625] (-357.702) (-358.497) (-359.995) -- 0:00:59
179000 -- [-357.386] (-357.886) (-361.848) (-357.728) * (-358.305) (-357.942) (-357.232) [-357.964] -- 0:00:59
179500 -- (-360.961) [-359.615] (-366.998) (-357.759) * (-356.860) [-358.501] (-361.788) (-358.776) -- 0:00:59
180000 -- (-361.245) [-359.138] (-364.015) (-361.570) * (-358.815) (-358.194) [-360.423] (-361.968) -- 0:00:59
Average standard deviation of split frequencies: 0.016670
180500 -- (-359.386) (-358.550) (-358.834) [-357.577] * (-357.778) (-362.282) [-361.898] (-358.019) -- 0:00:59
181000 -- [-357.588] (-359.489) (-357.659) (-358.168) * (-358.442) [-358.994] (-360.539) (-357.162) -- 0:01:03
181500 -- [-358.660] (-358.231) (-357.743) (-360.437) * (-357.883) [-358.010] (-360.764) (-360.403) -- 0:01:03
182000 -- (-358.197) (-358.105) [-357.021] (-357.877) * (-357.195) [-357.981] (-361.572) (-357.932) -- 0:01:02
182500 -- (-358.798) (-359.165) (-358.711) [-359.312] * [-356.473] (-357.902) (-358.256) (-360.908) -- 0:01:02
183000 -- (-358.429) (-358.379) [-359.073] (-359.073) * (-359.881) [-361.908] (-363.593) (-361.402) -- 0:01:02
183500 -- (-358.135) (-359.125) (-361.487) [-359.978] * [-358.343] (-357.751) (-358.068) (-359.068) -- 0:01:02
184000 -- (-358.718) (-359.194) (-361.702) [-358.138] * (-358.980) (-357.322) (-359.789) [-357.705] -- 0:01:02
184500 -- [-360.450] (-360.201) (-358.569) (-358.956) * (-359.954) [-360.842] (-361.612) (-362.234) -- 0:01:01
185000 -- [-360.593] (-361.248) (-359.092) (-360.041) * (-356.979) [-358.132] (-363.453) (-367.220) -- 0:01:01
Average standard deviation of split frequencies: 0.016220
185500 -- (-357.201) [-359.896] (-359.383) (-358.408) * (-356.722) (-356.311) [-360.534] (-361.402) -- 0:01:01
186000 -- (-359.060) (-358.255) (-360.624) [-357.536] * [-358.923] (-356.510) (-361.379) (-357.235) -- 0:01:01
186500 -- (-356.968) [-361.717] (-365.852) (-357.528) * (-358.061) (-360.846) (-358.171) [-359.294] -- 0:01:01
187000 -- (-356.580) (-358.187) [-358.197] (-358.584) * (-359.268) [-358.049] (-360.788) (-361.443) -- 0:01:00
187500 -- [-360.033] (-356.721) (-357.920) (-361.568) * (-356.714) [-357.983] (-359.511) (-358.685) -- 0:01:00
188000 -- (-358.290) (-367.650) [-357.715] (-360.340) * (-358.128) (-360.523) [-359.612] (-358.879) -- 0:01:00
188500 -- (-360.010) (-363.433) (-357.276) [-357.503] * (-359.452) [-359.008] (-361.171) (-359.146) -- 0:01:00
189000 -- [-356.985] (-358.337) (-359.024) (-356.821) * [-359.044] (-357.123) (-356.964) (-361.420) -- 0:01:00
189500 -- (-357.020) [-357.400] (-359.544) (-357.706) * [-360.696] (-357.632) (-358.458) (-362.358) -- 0:00:59
190000 -- (-357.209) (-357.478) [-358.911] (-359.014) * (-362.746) [-357.357] (-361.522) (-363.028) -- 0:00:59
Average standard deviation of split frequencies: 0.015933
190500 -- (-358.932) (-358.809) (-359.437) [-358.974] * (-356.525) (-356.633) [-358.341] (-358.011) -- 0:00:59
191000 -- (-360.761) [-358.528] (-359.248) (-357.243) * [-357.594] (-357.554) (-358.572) (-358.550) -- 0:00:59
191500 -- (-363.610) [-360.819] (-360.172) (-360.355) * (-357.643) [-358.148] (-358.199) (-357.587) -- 0:00:59
192000 -- [-357.452] (-359.380) (-358.044) (-359.274) * (-363.437) [-357.772] (-357.032) (-358.499) -- 0:00:58
192500 -- (-360.418) (-360.456) [-357.963] (-361.198) * (-364.105) (-359.066) (-357.147) [-358.587] -- 0:00:58
193000 -- (-357.068) [-360.213] (-359.501) (-359.985) * (-359.302) (-358.941) [-357.311] (-357.455) -- 0:00:58
193500 -- (-356.964) (-362.546) (-357.072) [-357.134] * (-360.802) (-357.943) (-359.463) [-356.616] -- 0:00:58
194000 -- [-357.848] (-360.304) (-358.938) (-357.830) * (-362.121) (-357.689) (-359.140) [-357.201] -- 0:00:58
194500 -- (-356.622) (-357.437) (-361.290) [-356.892] * (-361.516) (-359.601) (-356.933) [-360.112] -- 0:00:57
195000 -- [-359.253] (-357.051) (-358.462) (-357.214) * (-359.547) (-358.064) (-357.732) [-357.781] -- 0:00:57
Average standard deviation of split frequencies: 0.015366
195500 -- [-357.131] (-358.383) (-359.497) (-360.650) * (-358.762) (-358.362) [-357.014] (-359.996) -- 0:01:01
196000 -- (-358.724) (-358.582) (-358.797) [-357.857] * [-357.645] (-358.270) (-357.895) (-358.865) -- 0:01:01
196500 -- [-359.034] (-356.984) (-358.566) (-360.333) * [-357.312] (-359.333) (-361.958) (-364.312) -- 0:01:01
197000 -- (-357.306) [-357.137] (-358.523) (-362.823) * (-360.290) (-359.570) (-360.852) [-358.679] -- 0:01:01
197500 -- (-361.698) [-359.126] (-360.804) (-358.000) * [-360.654] (-359.182) (-358.869) (-358.313) -- 0:01:00
198000 -- (-359.413) [-358.193] (-358.582) (-358.181) * (-357.942) (-357.370) [-357.821] (-358.897) -- 0:01:00
198500 -- (-359.136) [-357.304] (-361.002) (-360.200) * (-356.563) (-360.497) (-362.561) [-359.497] -- 0:01:00
199000 -- [-361.010] (-356.766) (-360.987) (-359.483) * (-356.562) (-356.916) [-357.559] (-361.819) -- 0:01:00
199500 -- (-359.699) (-358.424) [-360.516] (-357.733) * (-356.605) (-356.993) (-357.341) [-357.076] -- 0:01:00
200000 -- [-359.325] (-363.316) (-359.152) (-358.046) * [-357.917] (-359.892) (-358.973) (-356.552) -- 0:00:59
Average standard deviation of split frequencies: 0.014617
200500 -- (-360.454) (-363.750) (-361.515) [-357.792] * [-361.510] (-361.729) (-357.221) (-360.744) -- 0:00:59
201000 -- [-359.041] (-362.586) (-359.861) (-357.568) * (-362.790) [-359.080] (-358.575) (-360.431) -- 0:00:59
201500 -- (-360.319) [-357.425] (-362.002) (-362.965) * [-361.951] (-358.065) (-357.441) (-360.649) -- 0:00:59
202000 -- [-360.135] (-357.328) (-358.614) (-358.260) * [-359.172] (-361.723) (-359.608) (-360.958) -- 0:00:59
202500 -- (-357.228) (-366.418) (-359.233) [-361.762] * (-364.866) [-357.882] (-358.645) (-359.715) -- 0:00:59
203000 -- (-357.566) [-364.425] (-358.289) (-358.573) * (-360.543) (-359.120) [-359.130] (-358.129) -- 0:00:58
203500 -- [-356.417] (-360.981) (-367.174) (-362.525) * (-361.400) (-358.931) [-359.333] (-357.730) -- 0:00:58
204000 -- [-359.919] (-357.724) (-358.499) (-358.880) * (-358.618) [-358.264] (-359.151) (-357.351) -- 0:00:58
204500 -- (-357.964) [-357.944] (-363.090) (-360.398) * [-361.056] (-360.361) (-358.627) (-358.445) -- 0:00:58
205000 -- (-356.599) (-357.760) [-359.144] (-360.355) * (-357.509) (-358.348) (-359.913) [-358.940] -- 0:00:58
Average standard deviation of split frequencies: 0.014112
205500 -- (-359.565) (-359.857) (-357.773) [-357.458] * (-358.583) (-362.608) (-359.635) [-361.474] -- 0:00:57
206000 -- [-361.229] (-357.817) (-356.628) (-358.158) * [-356.821] (-361.793) (-357.382) (-360.736) -- 0:00:57
206500 -- (-364.250) [-356.850] (-356.725) (-357.381) * [-359.575] (-359.400) (-356.965) (-358.558) -- 0:00:57
207000 -- [-357.528] (-363.613) (-359.081) (-358.221) * (-357.552) (-358.380) [-356.956] (-357.880) -- 0:00:57
207500 -- [-358.165] (-356.971) (-361.178) (-358.863) * (-357.378) (-362.604) [-365.098] (-359.210) -- 0:00:57
208000 -- (-358.018) (-360.340) [-358.944] (-365.914) * (-361.204) (-358.924) (-357.496) [-360.515] -- 0:00:57
208500 -- (-356.404) [-360.443] (-358.954) (-359.531) * (-359.379) (-357.812) [-361.420] (-356.996) -- 0:01:00
209000 -- [-359.093] (-360.166) (-357.515) (-358.925) * [-359.227] (-357.432) (-359.619) (-358.339) -- 0:01:00
209500 -- (-357.321) (-356.919) (-359.281) [-360.560] * (-358.336) (-357.723) (-358.215) [-358.325] -- 0:01:00
210000 -- (-359.931) [-357.160] (-357.130) (-365.956) * [-358.684] (-357.223) (-358.043) (-361.528) -- 0:01:00
Average standard deviation of split frequencies: 0.014486
210500 -- (-357.935) [-361.861] (-357.120) (-359.960) * (-357.795) [-358.147] (-361.140) (-366.208) -- 0:01:00
211000 -- (-360.469) [-360.350] (-360.002) (-359.139) * (-356.938) [-360.519] (-358.041) (-357.307) -- 0:00:59
211500 -- [-362.741] (-359.717) (-361.104) (-359.374) * [-361.499] (-358.610) (-360.758) (-364.342) -- 0:00:59
212000 -- (-358.699) [-357.430] (-358.263) (-362.483) * (-363.167) (-362.642) (-357.770) [-357.479] -- 0:00:59
212500 -- [-357.888] (-358.729) (-357.533) (-358.332) * (-357.759) (-357.427) [-357.723] (-358.227) -- 0:00:59
213000 -- (-357.732) (-361.380) (-358.785) [-357.585] * (-357.987) (-357.611) [-357.908] (-356.674) -- 0:00:59
213500 -- [-358.390] (-359.452) (-357.239) (-358.372) * (-357.161) (-358.694) (-359.497) [-362.652] -- 0:00:58
214000 -- [-361.401] (-356.744) (-357.955) (-357.538) * (-357.093) (-359.803) (-357.616) [-359.731] -- 0:00:58
214500 -- (-358.716) (-358.641) (-359.270) [-358.257] * (-361.229) (-361.349) [-357.442] (-358.670) -- 0:00:58
215000 -- (-358.573) (-359.755) [-359.651] (-359.001) * (-359.394) (-359.191) [-358.549] (-357.894) -- 0:00:58
Average standard deviation of split frequencies: 0.014358
215500 -- (-359.778) (-361.463) (-361.437) [-358.962] * [-358.766] (-358.848) (-358.563) (-357.689) -- 0:00:58
216000 -- (-359.284) [-359.540] (-359.250) (-361.783) * (-356.954) [-357.315] (-360.409) (-357.365) -- 0:00:58
216500 -- (-358.000) [-357.089] (-357.247) (-358.365) * [-357.163] (-357.980) (-361.067) (-358.520) -- 0:00:57
217000 -- (-358.038) (-358.558) (-356.967) [-357.709] * [-358.294] (-359.427) (-358.713) (-359.670) -- 0:00:57
217500 -- (-357.635) (-361.654) (-359.486) [-357.046] * (-359.480) (-359.609) (-358.852) [-358.291] -- 0:00:57
218000 -- (-357.914) (-360.107) [-364.818] (-358.053) * (-358.447) [-358.659] (-357.350) (-363.572) -- 0:00:57
218500 -- (-356.693) [-358.427] (-359.822) (-358.077) * (-357.473) (-360.110) (-359.238) [-362.533] -- 0:00:57
219000 -- (-358.367) (-360.344) [-360.930] (-359.757) * [-357.312] (-359.688) (-357.800) (-361.540) -- 0:00:57
219500 -- (-358.845) [-360.596] (-360.702) (-358.550) * (-357.398) (-358.328) (-357.950) [-358.165] -- 0:00:56
220000 -- (-359.365) (-358.358) (-359.453) [-360.007] * (-358.790) (-361.288) [-358.038] (-358.215) -- 0:00:56
Average standard deviation of split frequencies: 0.012143
220500 -- (-358.411) [-359.582] (-358.389) (-360.272) * (-358.392) (-363.552) (-358.511) [-361.423] -- 0:00:56
221000 -- (-360.546) [-359.179] (-357.164) (-359.264) * (-360.810) (-360.009) [-359.490] (-361.154) -- 0:00:56
221500 -- [-357.318] (-357.349) (-359.972) (-361.086) * (-360.282) (-358.037) [-359.787] (-359.615) -- 0:00:56
222000 -- (-358.167) (-357.875) (-358.400) [-359.916] * (-361.381) (-357.548) [-360.469] (-356.796) -- 0:00:56
222500 -- (-357.719) (-360.414) (-367.260) [-357.378] * [-359.065] (-358.348) (-364.942) (-360.144) -- 0:00:59
223000 -- [-357.234] (-356.994) (-359.122) (-357.279) * (-358.425) [-357.927] (-360.847) (-360.143) -- 0:00:59
223500 -- (-357.170) (-357.141) (-359.733) [-360.551] * (-358.713) [-362.806] (-357.215) (-358.203) -- 0:00:59
224000 -- (-358.681) [-357.557] (-358.264) (-357.227) * (-357.073) [-361.160] (-358.692) (-358.631) -- 0:00:58
224500 -- (-357.716) [-356.658] (-357.373) (-360.075) * (-357.606) (-358.387) [-356.851] (-358.380) -- 0:00:58
225000 -- (-358.195) (-357.755) (-358.464) [-358.125] * (-357.191) (-357.442) [-358.040] (-358.535) -- 0:00:58
Average standard deviation of split frequencies: 0.012405
225500 -- (-357.489) (-356.848) (-362.924) [-360.749] * (-359.597) [-359.125] (-358.397) (-360.512) -- 0:00:58
226000 -- (-358.515) [-356.832] (-358.400) (-360.132) * (-357.643) (-359.646) (-359.125) [-358.266] -- 0:00:58
226500 -- [-358.642] (-358.784) (-359.644) (-361.124) * (-358.661) (-356.895) (-358.586) [-359.236] -- 0:00:58
227000 -- (-359.573) (-361.810) [-357.297] (-358.063) * (-358.388) (-357.322) [-357.348] (-356.588) -- 0:00:57
227500 -- (-360.825) [-362.824] (-359.731) (-358.174) * (-356.531) [-358.509] (-359.111) (-357.070) -- 0:00:57
228000 -- (-358.585) (-358.083) (-357.051) [-357.550] * (-358.202) (-359.928) (-360.091) [-358.688] -- 0:00:57
228500 -- (-358.546) [-357.006] (-357.577) (-358.818) * (-366.544) (-360.201) (-357.342) [-357.594] -- 0:00:57
229000 -- [-358.272] (-359.973) (-361.867) (-357.452) * (-364.450) (-361.546) (-360.718) [-360.893] -- 0:00:57
229500 -- (-358.148) [-361.942] (-361.823) (-361.804) * (-361.715) [-358.621] (-363.558) (-359.674) -- 0:00:57
230000 -- (-363.771) (-356.743) (-358.889) [-359.163] * (-357.802) (-358.374) [-359.773] (-361.542) -- 0:00:56
Average standard deviation of split frequencies: 0.011581
230500 -- (-357.258) [-359.989] (-357.707) (-357.291) * [-359.543] (-360.994) (-359.265) (-362.316) -- 0:00:56
231000 -- [-357.583] (-358.894) (-357.451) (-357.688) * [-360.674] (-358.773) (-359.545) (-357.675) -- 0:00:56
231500 -- (-360.650) [-361.611] (-357.903) (-358.879) * (-359.947) (-358.366) [-357.143] (-364.264) -- 0:00:56
232000 -- (-357.820) (-359.914) [-359.110] (-356.846) * (-357.561) (-360.073) (-357.784) [-357.256] -- 0:00:56
232500 -- (-359.397) (-357.261) [-357.184] (-357.251) * (-363.893) (-360.291) [-357.006] (-357.231) -- 0:00:56
233000 -- [-357.382] (-360.727) (-357.563) (-357.952) * (-358.484) [-359.884] (-361.425) (-357.483) -- 0:00:55
233500 -- [-357.552] (-357.207) (-357.399) (-361.098) * [-358.755] (-360.757) (-358.032) (-356.547) -- 0:00:55
234000 -- (-362.107) (-357.091) (-357.162) [-359.525] * (-361.402) [-359.586] (-358.339) (-358.817) -- 0:00:55
234500 -- (-362.798) (-357.740) (-357.692) [-356.564] * (-360.705) [-358.524] (-357.189) (-358.093) -- 0:00:55
235000 -- (-359.568) [-358.538] (-360.159) (-357.665) * (-359.801) (-361.408) [-360.753] (-356.746) -- 0:00:55
Average standard deviation of split frequencies: 0.009765
235500 -- (-361.644) [-359.994] (-358.886) (-360.138) * [-358.743] (-356.652) (-358.192) (-358.095) -- 0:00:55
236000 -- (-361.064) (-361.191) [-357.548] (-360.235) * (-357.584) (-358.334) (-361.398) [-359.693] -- 0:00:58
236500 -- [-359.322] (-357.650) (-359.536) (-362.356) * (-361.694) [-358.309] (-360.044) (-357.087) -- 0:00:58
237000 -- (-362.820) [-360.022] (-358.437) (-356.691) * (-364.126) (-357.497) (-359.657) [-357.861] -- 0:00:57
237500 -- (-358.650) [-361.745] (-359.271) (-359.894) * (-357.222) (-359.609) [-358.923] (-358.764) -- 0:00:57
238000 -- [-358.913] (-359.306) (-360.518) (-357.398) * [-359.045] (-357.513) (-366.356) (-357.260) -- 0:00:57
238500 -- [-359.599] (-357.018) (-357.946) (-361.618) * [-359.749] (-357.421) (-359.396) (-360.217) -- 0:00:57
239000 -- (-357.656) (-359.487) [-357.494] (-359.132) * (-358.878) (-359.180) [-357.515] (-357.398) -- 0:00:57
239500 -- [-362.224] (-359.073) (-357.993) (-360.880) * (-357.926) (-357.854) [-357.985] (-363.007) -- 0:00:57
240000 -- (-356.880) (-358.923) [-358.360] (-358.352) * (-359.734) (-357.853) [-359.138] (-359.747) -- 0:00:56
Average standard deviation of split frequencies: 0.010024
240500 -- (-358.499) (-357.929) [-358.296] (-361.603) * (-358.672) [-357.154] (-361.411) (-358.155) -- 0:00:56
241000 -- [-357.746] (-367.301) (-359.238) (-359.631) * (-360.531) (-361.478) (-363.307) [-358.712] -- 0:00:56
241500 -- (-364.055) [-358.683] (-357.877) (-362.834) * (-358.248) [-358.151] (-362.096) (-359.433) -- 0:00:56
242000 -- [-360.928] (-363.201) (-357.465) (-359.323) * (-357.079) [-358.463] (-359.241) (-362.563) -- 0:00:56
242500 -- (-358.564) [-356.671] (-357.420) (-362.577) * (-358.776) (-357.375) (-357.929) [-358.545] -- 0:00:56
243000 -- (-358.345) [-359.102] (-358.727) (-357.113) * (-359.497) [-358.081] (-359.885) (-358.759) -- 0:00:56
243500 -- (-359.796) (-358.341) (-359.928) [-359.609] * [-359.171] (-357.489) (-361.205) (-362.045) -- 0:00:55
244000 -- (-360.399) (-358.064) [-358.430] (-356.973) * (-359.366) [-357.376] (-358.590) (-357.570) -- 0:00:55
244500 -- (-363.128) [-362.456] (-360.257) (-359.315) * (-357.076) [-356.805] (-356.976) (-357.510) -- 0:00:55
245000 -- [-357.081] (-359.313) (-359.972) (-361.217) * (-357.080) (-358.627) (-362.106) [-357.450] -- 0:00:55
Average standard deviation of split frequencies: 0.010258
245500 -- (-358.471) (-357.659) (-361.084) [-360.072] * [-358.548] (-359.452) (-358.898) (-359.189) -- 0:00:55
246000 -- [-360.279] (-358.439) (-361.545) (-356.659) * (-358.248) [-357.846] (-359.610) (-357.718) -- 0:00:55
246500 -- (-357.991) (-360.416) [-360.208] (-359.935) * (-359.277) (-357.837) [-357.177] (-356.365) -- 0:00:55
247000 -- (-357.867) (-360.459) [-359.192] (-357.034) * (-359.437) [-357.003] (-357.262) (-358.141) -- 0:00:54
247500 -- (-359.095) [-359.127] (-357.251) (-358.727) * (-359.595) (-358.902) [-357.571] (-357.127) -- 0:00:54
248000 -- (-360.219) (-365.141) (-356.844) [-359.236] * [-359.537] (-358.911) (-361.682) (-358.813) -- 0:00:54
248500 -- (-360.413) (-362.735) [-359.043] (-362.510) * (-356.972) (-362.698) [-361.538] (-360.205) -- 0:00:54
249000 -- (-360.745) (-359.820) (-356.882) [-358.352] * (-363.334) [-362.280] (-359.492) (-362.110) -- 0:00:54
249500 -- (-358.846) (-359.324) [-356.855] (-361.907) * (-358.716) (-361.512) (-359.450) [-359.196] -- 0:00:54
250000 -- (-358.196) [-357.137] (-358.354) (-361.026) * [-358.255] (-357.683) (-358.717) (-360.287) -- 0:00:57
Average standard deviation of split frequencies: 0.011505
250500 -- (-357.488) (-361.315) (-358.397) [-358.320] * (-359.433) (-357.083) [-357.194] (-357.883) -- 0:00:56
251000 -- [-357.822] (-364.896) (-360.824) (-359.438) * (-359.948) [-358.368] (-359.404) (-358.279) -- 0:00:56
251500 -- (-359.384) [-357.518] (-357.945) (-356.574) * (-361.050) [-357.628] (-357.474) (-357.283) -- 0:00:56
252000 -- [-359.699] (-360.131) (-357.227) (-359.004) * (-356.811) [-362.075] (-358.629) (-357.723) -- 0:00:56
252500 -- [-359.458] (-360.322) (-359.960) (-361.375) * [-356.797] (-359.331) (-358.973) (-364.544) -- 0:00:56
253000 -- (-361.236) (-368.417) [-360.306] (-362.431) * (-356.787) (-359.555) [-358.684] (-357.733) -- 0:00:56
253500 -- [-358.469] (-360.864) (-356.874) (-361.329) * (-357.624) [-359.251] (-358.121) (-357.572) -- 0:00:55
254000 -- (-358.912) (-360.473) (-356.787) [-356.920] * [-356.554] (-359.151) (-358.057) (-357.409) -- 0:00:55
254500 -- [-357.873] (-358.965) (-358.181) (-359.327) * (-357.719) (-360.754) [-356.491] (-358.023) -- 0:00:55
255000 -- (-358.685) [-357.276] (-358.671) (-358.515) * (-361.462) [-358.927] (-360.735) (-358.510) -- 0:00:55
Average standard deviation of split frequencies: 0.010832
255500 -- (-358.549) (-361.030) [-360.804] (-359.626) * (-362.292) [-359.255] (-359.785) (-360.596) -- 0:00:55
256000 -- (-357.857) (-362.110) [-359.612] (-360.532) * (-360.857) (-359.265) (-359.744) [-358.927] -- 0:00:55
256500 -- [-359.204] (-356.904) (-358.594) (-358.914) * (-359.734) [-358.505] (-357.878) (-362.935) -- 0:00:55
257000 -- [-357.432] (-359.784) (-358.339) (-358.014) * (-357.499) [-358.093] (-360.925) (-363.882) -- 0:00:54
257500 -- (-357.594) [-358.662] (-356.973) (-358.455) * [-358.287] (-358.339) (-358.260) (-358.103) -- 0:00:54
258000 -- (-357.004) (-360.583) (-359.535) [-358.748] * (-357.764) [-358.123] (-358.789) (-359.056) -- 0:00:54
258500 -- [-357.889] (-356.781) (-358.800) (-358.474) * [-358.838] (-357.738) (-357.159) (-358.007) -- 0:00:54
259000 -- (-358.173) (-358.216) [-357.508] (-358.518) * (-359.000) [-357.318] (-358.033) (-366.166) -- 0:00:54
259500 -- (-358.951) [-358.678] (-358.126) (-358.812) * [-359.182] (-357.414) (-358.934) (-358.868) -- 0:00:54
260000 -- (-358.758) (-358.409) [-359.458] (-358.721) * (-359.780) [-357.348] (-359.036) (-361.848) -- 0:00:54
Average standard deviation of split frequencies: 0.010625
260500 -- (-357.542) [-359.043] (-357.206) (-358.415) * (-359.552) (-357.793) [-357.766] (-361.155) -- 0:00:53
261000 -- [-358.585] (-359.261) (-358.412) (-361.816) * (-358.087) (-359.893) (-361.285) [-357.648] -- 0:00:53
261500 -- (-359.356) (-358.766) [-360.263] (-362.722) * (-357.725) (-357.748) [-360.392] (-359.422) -- 0:00:53
262000 -- (-361.405) (-359.642) [-357.155] (-361.241) * (-357.367) (-357.878) [-357.826] (-360.396) -- 0:00:53
262500 -- [-360.268] (-360.252) (-359.214) (-362.893) * (-359.878) [-357.767] (-360.351) (-364.718) -- 0:00:53
263000 -- (-360.279) (-364.723) (-362.111) [-358.457] * (-359.910) (-357.980) (-358.423) [-361.033] -- 0:00:53
263500 -- (-360.809) (-362.613) (-358.421) [-357.656] * (-357.878) (-357.060) [-359.435] (-358.855) -- 0:00:55
264000 -- (-358.955) [-364.085] (-357.210) (-359.463) * (-357.944) (-362.036) (-358.580) [-357.219] -- 0:00:55
264500 -- (-357.533) (-361.222) (-359.547) [-359.724] * (-357.683) (-359.248) [-358.954] (-360.732) -- 0:00:55
265000 -- (-358.418) [-362.308] (-358.183) (-362.738) * (-359.716) (-359.632) (-357.978) [-360.745] -- 0:00:55
Average standard deviation of split frequencies: 0.010412
265500 -- (-358.693) [-358.067] (-357.440) (-359.742) * (-356.878) [-360.385] (-357.308) (-359.665) -- 0:00:55
266000 -- [-360.310] (-358.479) (-358.275) (-360.069) * (-357.483) (-360.718) (-358.786) [-357.727] -- 0:00:55
266500 -- (-360.531) [-358.621] (-357.370) (-358.782) * (-358.477) [-357.609] (-357.610) (-358.874) -- 0:00:55
267000 -- [-361.814] (-362.479) (-357.777) (-359.410) * (-356.803) [-358.493] (-356.997) (-360.804) -- 0:00:54
267500 -- (-359.823) (-360.259) [-361.764] (-358.850) * (-358.606) (-358.929) (-359.064) [-356.744] -- 0:00:54
268000 -- [-358.306] (-360.483) (-364.778) (-359.713) * [-357.272] (-358.323) (-358.948) (-358.112) -- 0:00:54
268500 -- [-358.321] (-358.523) (-359.272) (-358.101) * (-357.967) (-358.285) (-361.333) [-362.446] -- 0:00:54
269000 -- (-359.196) (-358.966) (-358.632) [-357.734] * (-358.307) [-361.013] (-360.877) (-358.449) -- 0:00:54
269500 -- (-360.276) (-358.063) [-357.016] (-357.796) * (-358.707) (-359.690) (-360.190) [-358.137] -- 0:00:54
270000 -- (-357.411) (-359.940) [-359.100] (-360.843) * (-358.009) (-359.011) (-357.850) [-357.388] -- 0:00:54
Average standard deviation of split frequencies: 0.010450
270500 -- (-356.957) (-360.363) (-358.626) [-358.089] * (-359.695) (-358.977) (-358.916) [-357.582] -- 0:00:53
271000 -- (-357.749) (-359.171) [-358.690] (-360.398) * [-358.568] (-359.708) (-357.828) (-358.481) -- 0:00:53
271500 -- [-357.545] (-360.387) (-360.099) (-358.159) * [-357.806] (-357.421) (-359.126) (-357.610) -- 0:00:53
272000 -- (-357.309) (-357.338) [-358.205] (-361.170) * (-360.725) (-357.832) (-360.793) [-359.302] -- 0:00:53
272500 -- [-358.206] (-361.300) (-358.467) (-360.768) * (-356.645) [-359.333] (-357.456) (-358.622) -- 0:00:53
273000 -- (-358.179) [-357.882] (-357.825) (-357.897) * (-359.262) (-358.918) (-361.251) [-359.706] -- 0:00:53
273500 -- (-358.804) [-358.152] (-358.487) (-357.381) * (-364.308) (-359.662) [-359.694] (-363.881) -- 0:00:53
274000 -- (-358.306) [-359.228] (-357.557) (-358.770) * (-361.084) (-357.549) [-361.074] (-360.945) -- 0:00:52
274500 -- (-360.063) (-357.123) (-357.823) [-356.421] * (-358.636) [-357.639] (-362.323) (-361.495) -- 0:00:52
275000 -- (-359.900) [-359.317] (-358.619) (-358.795) * (-356.672) (-356.698) [-357.778] (-356.611) -- 0:00:52
Average standard deviation of split frequencies: 0.011454
275500 -- [-362.492] (-357.743) (-359.667) (-358.910) * (-358.531) (-358.939) [-357.232] (-358.086) -- 0:00:52
276000 -- (-363.586) (-357.824) (-357.910) [-360.422] * [-358.516] (-356.696) (-357.728) (-358.090) -- 0:00:52
276500 -- (-364.941) (-358.186) [-358.310] (-359.476) * [-360.800] (-357.257) (-360.292) (-358.144) -- 0:00:52
277000 -- [-357.792] (-361.618) (-359.321) (-356.456) * (-356.934) (-358.882) (-361.845) [-358.948] -- 0:00:52
277500 -- (-357.606) [-359.379] (-357.303) (-358.926) * [-357.452] (-358.860) (-359.685) (-358.325) -- 0:00:52
278000 -- [-360.323] (-358.571) (-359.095) (-359.880) * (-357.882) [-358.768] (-357.756) (-360.173) -- 0:00:51
278500 -- [-358.185] (-358.513) (-362.779) (-359.732) * (-358.642) (-359.783) (-356.817) [-358.933] -- 0:00:51
279000 -- [-360.751] (-356.864) (-356.874) (-358.504) * (-359.005) (-358.283) (-361.475) [-356.644] -- 0:00:54
279500 -- (-358.932) [-358.987] (-360.999) (-357.568) * (-357.524) [-358.900] (-357.859) (-357.289) -- 0:00:54
280000 -- [-359.435] (-357.113) (-363.710) (-363.520) * (-357.144) (-362.350) [-357.055] (-357.779) -- 0:00:53
Average standard deviation of split frequencies: 0.011164
280500 -- (-358.121) (-357.035) (-363.531) [-358.203] * (-361.700) (-361.420) [-359.982] (-357.258) -- 0:00:53
281000 -- [-358.873] (-359.382) (-356.880) (-361.105) * (-360.981) (-357.603) (-360.017) [-358.419] -- 0:00:53
281500 -- (-358.400) (-357.675) (-360.547) [-358.445] * [-357.153] (-357.757) (-357.162) (-361.307) -- 0:00:53
282000 -- [-359.541] (-363.141) (-361.898) (-358.490) * (-360.696) [-358.783] (-358.890) (-361.194) -- 0:00:53
282500 -- (-360.989) (-368.175) [-357.409] (-357.466) * [-359.752] (-358.975) (-360.666) (-361.960) -- 0:00:53
283000 -- (-359.203) (-357.112) [-357.007] (-358.557) * [-359.206] (-357.406) (-358.858) (-358.349) -- 0:00:53
283500 -- (-361.470) [-360.781] (-358.624) (-357.125) * (-358.834) (-357.536) [-357.824] (-360.193) -- 0:00:53
284000 -- (-359.625) (-359.830) (-360.119) [-359.413] * [-359.498] (-359.395) (-358.867) (-360.363) -- 0:00:52
284500 -- (-361.640) (-360.879) (-359.301) [-357.653] * (-361.652) [-359.318] (-358.530) (-360.686) -- 0:00:52
285000 -- [-358.227] (-359.563) (-358.502) (-356.716) * (-356.666) (-359.846) [-357.852] (-359.508) -- 0:00:52
Average standard deviation of split frequencies: 0.011053
285500 -- (-356.713) [-362.341] (-357.979) (-359.045) * (-360.705) [-361.746] (-358.081) (-356.867) -- 0:00:52
286000 -- (-359.841) (-359.382) (-357.805) [-357.723] * (-358.634) (-361.019) (-357.546) [-359.665] -- 0:00:52
286500 -- (-360.735) (-361.462) [-360.333] (-359.041) * (-360.007) (-358.358) [-358.722] (-358.106) -- 0:00:52
287000 -- [-357.649] (-359.524) (-360.378) (-361.981) * (-358.807) (-363.419) (-358.125) [-365.264] -- 0:00:52
287500 -- (-357.045) (-358.414) (-357.630) [-358.527] * (-357.790) (-357.214) (-362.150) [-359.094] -- 0:00:52
288000 -- [-356.671] (-360.077) (-359.751) (-360.589) * [-359.961] (-358.008) (-359.312) (-358.699) -- 0:00:51
288500 -- (-358.366) (-359.574) [-359.268] (-361.012) * (-357.818) (-358.593) [-359.225] (-359.324) -- 0:00:51
289000 -- (-359.105) [-359.708] (-361.225) (-360.443) * (-357.743) [-356.962] (-358.230) (-359.186) -- 0:00:51
289500 -- [-360.035] (-358.456) (-358.682) (-359.445) * [-356.537] (-363.091) (-356.959) (-359.668) -- 0:00:51
290000 -- (-356.944) (-359.001) (-361.175) [-359.206] * (-358.980) (-359.862) [-356.855] (-360.434) -- 0:00:51
Average standard deviation of split frequencies: 0.011162
290500 -- [-357.444] (-359.630) (-356.820) (-358.627) * [-358.270] (-361.406) (-357.502) (-357.476) -- 0:00:51
291000 -- (-357.060) (-358.341) [-357.496] (-359.721) * (-362.653) (-360.469) [-356.975] (-358.791) -- 0:00:51
291500 -- [-356.828] (-360.003) (-361.908) (-363.002) * (-359.618) (-358.258) (-357.757) [-357.598] -- 0:00:51
292000 -- [-358.219] (-358.169) (-361.894) (-363.149) * [-359.040] (-359.421) (-357.751) (-358.830) -- 0:00:50
292500 -- [-359.649] (-358.653) (-357.984) (-362.703) * (-359.414) (-357.688) [-358.743] (-357.628) -- 0:00:50
293000 -- (-359.020) (-362.461) (-357.412) [-358.650] * [-359.154] (-361.310) (-357.750) (-360.051) -- 0:00:50
293500 -- [-356.642] (-360.547) (-360.919) (-358.856) * (-357.722) (-362.347) (-357.236) [-360.156] -- 0:00:50
294000 -- (-357.443) (-359.918) (-357.490) [-360.218] * [-358.337] (-359.699) (-362.499) (-362.481) -- 0:00:50
294500 -- (-358.160) [-358.649] (-357.376) (-359.339) * [-358.829] (-357.882) (-359.666) (-359.454) -- 0:00:50
295000 -- (-359.371) (-356.952) (-358.873) [-357.689] * [-357.984] (-359.187) (-358.338) (-359.144) -- 0:00:50
Average standard deviation of split frequencies: 0.011804
295500 -- (-358.597) (-359.510) [-357.626] (-358.868) * [-358.835] (-356.987) (-357.344) (-361.855) -- 0:00:52
296000 -- (-358.384) (-359.160) (-359.053) [-359.534] * (-359.515) (-358.905) (-357.839) [-358.066] -- 0:00:52
296500 -- (-357.832) (-357.301) [-359.500] (-361.481) * [-357.920] (-359.994) (-359.123) (-357.800) -- 0:00:52
297000 -- (-357.949) (-358.588) (-359.182) [-359.909] * (-356.834) (-360.628) [-357.547] (-357.906) -- 0:00:52
297500 -- (-357.983) (-358.242) (-359.578) [-358.124] * (-357.193) [-358.672] (-358.349) (-357.539) -- 0:00:51
298000 -- (-359.249) [-357.822] (-358.120) (-358.389) * (-359.284) (-363.787) [-359.531] (-359.125) -- 0:00:51
298500 -- [-358.984] (-358.521) (-357.262) (-358.673) * [-356.687] (-357.325) (-361.460) (-357.004) -- 0:00:51
299000 -- (-356.875) (-357.206) [-356.790] (-359.032) * (-357.492) [-357.544] (-361.424) (-359.848) -- 0:00:51
299500 -- (-358.688) (-360.283) [-357.952] (-357.969) * [-357.871] (-362.378) (-357.667) (-358.544) -- 0:00:51
300000 -- [-359.518] (-358.250) (-358.998) (-357.634) * [-360.385] (-359.028) (-359.740) (-358.599) -- 0:00:51
Average standard deviation of split frequencies: 0.011621
300500 -- (-359.100) (-357.899) [-360.963] (-362.047) * (-362.989) [-357.726] (-359.860) (-361.083) -- 0:00:51
301000 -- (-360.278) [-357.676] (-363.731) (-358.903) * (-367.954) (-357.446) (-358.273) [-361.327] -- 0:00:51
301500 -- [-357.253] (-358.103) (-361.375) (-360.886) * [-360.670] (-359.554) (-359.842) (-360.904) -- 0:00:50
302000 -- (-357.642) [-359.160] (-358.272) (-357.025) * [-363.992] (-358.232) (-358.206) (-361.008) -- 0:00:50
302500 -- [-357.243] (-358.153) (-359.403) (-361.656) * [-357.840] (-360.602) (-358.660) (-357.304) -- 0:00:50
303000 -- [-361.000] (-358.178) (-357.792) (-360.518) * (-356.708) [-361.218] (-358.603) (-357.414) -- 0:00:50
303500 -- (-357.072) (-357.603) [-359.403] (-358.546) * (-358.917) (-360.123) [-358.644] (-357.361) -- 0:00:50
304000 -- (-358.470) (-363.275) [-357.592] (-357.821) * [-357.774] (-362.769) (-357.855) (-365.615) -- 0:00:50
304500 -- (-359.134) [-358.741] (-358.222) (-358.295) * [-358.788] (-358.233) (-356.891) (-357.821) -- 0:00:50
305000 -- (-360.531) (-357.570) (-359.483) [-357.136] * (-358.037) (-357.623) (-357.139) [-359.297] -- 0:00:50
Average standard deviation of split frequencies: 0.011297
305500 -- (-359.182) [-363.838] (-358.776) (-358.216) * [-357.736] (-360.051) (-361.359) (-359.088) -- 0:00:50
306000 -- [-358.418] (-357.401) (-360.752) (-358.414) * (-357.057) (-360.266) [-358.447] (-362.854) -- 0:00:49
306500 -- [-357.633] (-359.287) (-358.574) (-361.436) * (-358.373) [-357.934] (-358.425) (-361.308) -- 0:00:49
307000 -- (-357.895) (-356.840) [-358.029] (-357.613) * (-357.563) (-357.257) [-358.617] (-363.819) -- 0:00:49
307500 -- (-359.002) [-357.903] (-360.743) (-358.554) * (-357.446) [-359.655] (-359.826) (-359.709) -- 0:00:49
308000 -- [-358.313] (-359.122) (-357.430) (-357.705) * [-357.381] (-359.036) (-359.869) (-360.869) -- 0:00:49
308500 -- (-358.319) (-358.219) (-359.013) [-357.008] * (-359.292) (-359.946) (-357.793) [-358.204] -- 0:00:49
309000 -- (-359.036) (-357.133) (-361.256) [-359.371] * [-359.015] (-359.240) (-358.052) (-359.384) -- 0:00:49
309500 -- (-359.457) (-361.473) [-357.617] (-358.008) * (-359.218) (-359.493) (-357.423) [-359.447] -- 0:00:49
310000 -- (-361.032) (-358.806) [-358.213] (-357.792) * (-358.422) (-359.897) (-358.537) [-361.796] -- 0:00:48
Average standard deviation of split frequencies: 0.012055
310500 -- (-361.971) (-357.577) (-363.832) [-359.512] * [-358.451] (-357.994) (-359.173) (-358.948) -- 0:00:48
311000 -- (-362.826) (-358.317) [-359.581] (-357.727) * (-359.307) (-358.018) [-359.880] (-358.646) -- 0:00:48
311500 -- [-362.603] (-356.636) (-360.838) (-360.272) * (-365.634) (-356.972) (-359.775) [-360.775] -- 0:00:50
312000 -- (-358.076) (-359.573) (-359.877) [-359.962] * [-357.713] (-357.842) (-357.045) (-358.949) -- 0:00:50
312500 -- (-358.713) [-357.575] (-357.918) (-358.716) * (-360.498) (-358.784) [-356.849] (-358.456) -- 0:00:50
313000 -- (-356.488) [-358.766] (-357.090) (-358.289) * (-358.106) (-359.079) [-359.965] (-359.001) -- 0:00:50
313500 -- (-357.065) [-358.402] (-358.318) (-359.528) * (-358.792) (-360.189) [-357.001] (-358.509) -- 0:00:50
314000 -- [-356.704] (-358.977) (-363.332) (-358.645) * (-357.384) [-359.534] (-360.731) (-360.796) -- 0:00:50
314500 -- (-360.943) (-357.867) [-360.246] (-357.988) * (-358.577) (-362.310) (-358.128) [-363.844] -- 0:00:50
315000 -- (-360.520) [-357.468] (-360.844) (-359.979) * [-358.878] (-357.111) (-356.837) (-359.638) -- 0:00:50
Average standard deviation of split frequencies: 0.011232
315500 -- (-358.565) [-359.940] (-361.868) (-357.490) * (-363.143) (-358.774) (-356.840) [-357.697] -- 0:00:49
316000 -- [-360.171] (-361.552) (-358.984) (-364.400) * [-358.315] (-363.115) (-357.456) (-357.095) -- 0:00:49
316500 -- [-359.414] (-359.389) (-359.871) (-365.385) * (-358.408) (-357.555) (-361.126) [-358.668] -- 0:00:49
317000 -- (-359.408) [-363.420] (-357.502) (-359.888) * (-358.179) [-359.771] (-361.080) (-357.038) -- 0:00:49
317500 -- [-362.501] (-362.647) (-359.290) (-359.963) * (-358.846) (-357.711) [-364.868] (-358.916) -- 0:00:49
318000 -- (-359.881) (-362.586) (-357.735) [-358.032] * (-359.513) (-359.577) (-358.089) [-359.103] -- 0:00:49
318500 -- (-358.826) (-358.869) (-358.958) [-358.250] * [-360.675] (-358.651) (-357.027) (-358.056) -- 0:00:49
319000 -- (-357.287) (-359.576) [-357.395] (-359.751) * (-358.828) (-361.404) (-359.746) [-361.052] -- 0:00:49
319500 -- (-357.962) [-357.763] (-360.827) (-358.989) * [-357.468] (-363.811) (-357.121) (-359.624) -- 0:00:48
320000 -- [-356.509] (-358.962) (-360.084) (-361.648) * (-360.057) [-359.825] (-367.167) (-360.980) -- 0:00:48
Average standard deviation of split frequencies: 0.010896
320500 -- (-360.113) (-358.987) (-362.199) [-360.013] * (-357.905) [-357.362] (-366.977) (-357.064) -- 0:00:48
321000 -- [-358.230] (-363.079) (-358.820) (-358.377) * (-359.901) [-358.032] (-369.691) (-358.161) -- 0:00:48
321500 -- (-359.778) (-360.972) [-358.209] (-357.686) * (-356.588) (-356.796) [-360.212] (-358.501) -- 0:00:48
322000 -- (-360.807) (-362.266) [-357.622] (-359.327) * (-358.156) [-359.984] (-358.411) (-359.193) -- 0:00:48
322500 -- (-360.146) [-359.705] (-359.673) (-358.101) * (-358.236) (-358.294) (-356.825) [-357.285] -- 0:00:48
323000 -- (-360.515) [-362.804] (-357.046) (-358.427) * (-357.624) (-358.201) [-357.562] (-364.786) -- 0:00:48
323500 -- (-358.243) [-360.001] (-357.426) (-362.569) * (-358.000) (-359.182) [-357.052] (-358.944) -- 0:00:48
324000 -- [-357.089] (-358.603) (-357.015) (-359.658) * (-358.287) (-358.845) (-357.476) [-366.261] -- 0:00:47
324500 -- (-357.741) [-361.390] (-357.319) (-359.736) * (-357.430) (-362.736) [-356.833] (-364.357) -- 0:00:47
325000 -- (-360.426) [-361.845] (-357.335) (-357.343) * (-357.615) (-364.582) (-360.907) [-361.269] -- 0:00:47
Average standard deviation of split frequencies: 0.009881
325500 -- (-360.685) (-358.586) [-358.082] (-358.841) * (-358.717) (-366.290) (-357.603) [-362.135] -- 0:00:47
326000 -- (-360.051) (-360.457) [-358.618] (-362.955) * (-356.804) [-358.495] (-357.030) (-357.860) -- 0:00:47
326500 -- (-360.553) [-358.545] (-356.371) (-358.796) * (-357.009) (-357.189) (-360.019) [-357.389] -- 0:00:47
327000 -- [-357.488] (-356.735) (-357.694) (-360.000) * [-358.774] (-358.471) (-359.109) (-356.947) -- 0:00:47
327500 -- [-356.568] (-358.235) (-357.576) (-357.293) * [-356.618] (-359.289) (-362.740) (-359.143) -- 0:00:47
328000 -- (-358.456) (-360.761) (-359.670) [-359.328] * [-357.827] (-363.775) (-357.454) (-357.199) -- 0:00:47
328500 -- (-358.419) (-358.501) [-358.197] (-358.267) * (-359.287) (-358.314) (-357.780) [-357.366] -- 0:00:49
329000 -- [-358.292] (-362.194) (-360.004) (-356.773) * (-360.628) [-356.820] (-358.433) (-357.323) -- 0:00:48
329500 -- (-357.205) (-359.181) (-358.562) [-358.167] * [-365.642] (-363.349) (-356.683) (-357.669) -- 0:00:48
330000 -- (-361.575) (-363.375) (-356.522) [-357.725] * [-358.448] (-361.704) (-356.377) (-359.096) -- 0:00:48
Average standard deviation of split frequencies: 0.009141
330500 -- (-360.210) (-367.611) (-356.996) [-357.966] * (-360.473) (-359.101) [-356.716] (-360.756) -- 0:00:48
331000 -- [-357.142] (-360.335) (-358.499) (-357.954) * (-362.743) (-358.704) (-357.672) [-357.895] -- 0:00:48
331500 -- (-359.304) [-359.165] (-357.681) (-359.749) * (-358.246) [-357.276] (-358.189) (-357.634) -- 0:00:48
332000 -- (-357.128) (-358.791) [-357.057] (-358.865) * (-358.523) (-360.205) (-363.207) [-357.922] -- 0:00:48
332500 -- (-360.015) (-359.562) [-359.324] (-359.431) * (-360.805) (-361.838) (-357.966) [-358.017] -- 0:00:48
333000 -- (-357.223) (-356.648) [-357.577] (-358.905) * (-359.182) (-360.538) (-359.748) [-358.606] -- 0:00:48
333500 -- (-363.869) (-358.804) (-357.307) [-358.044] * (-357.114) (-361.564) (-362.486) [-359.876] -- 0:00:47
334000 -- [-360.121] (-362.805) (-359.807) (-361.399) * (-359.649) [-357.812] (-356.991) (-358.743) -- 0:00:47
334500 -- (-359.289) [-357.177] (-358.036) (-357.140) * [-357.404] (-358.011) (-356.538) (-359.351) -- 0:00:47
335000 -- (-360.821) (-358.752) [-359.756] (-362.068) * (-357.229) [-361.400] (-358.062) (-358.646) -- 0:00:47
Average standard deviation of split frequencies: 0.009041
335500 -- [-356.884] (-359.141) (-358.309) (-360.420) * [-359.286] (-357.207) (-356.555) (-360.799) -- 0:00:47
336000 -- (-358.783) (-361.031) (-357.202) [-361.678] * (-356.880) (-359.310) [-357.587] (-357.050) -- 0:00:47
336500 -- [-357.923] (-360.916) (-357.557) (-364.134) * (-358.637) (-357.663) (-358.322) [-357.443] -- 0:00:47
337000 -- (-360.529) (-358.803) (-356.674) [-357.392] * (-359.951) (-357.329) (-358.719) [-361.697] -- 0:00:47
337500 -- (-363.533) (-359.202) (-358.451) [-358.238] * [-359.181] (-360.971) (-359.595) (-360.551) -- 0:00:47
338000 -- (-358.242) (-360.211) (-359.193) [-357.399] * [-358.736] (-357.260) (-360.945) (-359.280) -- 0:00:47
338500 -- (-359.010) (-359.428) [-358.195] (-357.723) * (-359.880) (-360.644) [-357.607] (-357.988) -- 0:00:46
339000 -- (-357.899) (-359.516) [-357.064] (-363.094) * (-358.136) (-357.684) [-358.923] (-358.142) -- 0:00:46
339500 -- [-357.971] (-358.606) (-357.851) (-356.859) * (-358.991) (-358.241) (-359.822) [-358.714] -- 0:00:46
340000 -- [-358.983] (-358.639) (-360.083) (-356.992) * (-357.170) [-358.888] (-360.330) (-358.876) -- 0:00:46
Average standard deviation of split frequencies: 0.008841
340500 -- (-359.897) (-358.927) [-357.499] (-357.645) * (-357.858) (-357.566) [-360.449] (-361.269) -- 0:00:46
341000 -- (-359.699) (-356.730) [-359.475] (-359.572) * (-359.363) [-356.862] (-360.139) (-361.778) -- 0:00:46
341500 -- (-358.935) [-357.566] (-360.176) (-357.775) * (-358.757) [-358.499] (-358.809) (-359.204) -- 0:00:46
342000 -- (-360.523) (-359.914) (-360.614) [-356.931] * [-357.595] (-362.722) (-358.065) (-358.136) -- 0:00:46
342500 -- (-357.133) (-362.309) [-360.290] (-359.533) * (-356.537) [-358.158] (-360.142) (-356.959) -- 0:00:46
343000 -- (-363.114) (-358.015) (-366.772) [-358.875] * (-358.480) (-358.331) (-360.843) [-356.498] -- 0:00:45
343500 -- [-358.989] (-357.159) (-358.197) (-359.558) * (-357.855) [-356.574] (-359.365) (-358.352) -- 0:00:45
344000 -- (-357.867) [-358.350] (-359.816) (-359.810) * (-360.269) (-356.780) (-358.655) [-358.148] -- 0:00:45
344500 -- [-356.782] (-358.029) (-358.683) (-359.424) * [-357.757] (-358.596) (-358.706) (-357.027) -- 0:00:45
345000 -- [-357.283] (-358.092) (-357.323) (-361.291) * (-361.160) (-361.219) (-357.021) [-357.795] -- 0:00:45
Average standard deviation of split frequencies: 0.008326
345500 -- (-358.792) [-358.197] (-359.743) (-361.409) * (-358.151) (-357.482) [-356.978] (-357.847) -- 0:00:47
346000 -- (-360.456) (-360.894) [-357.798] (-363.979) * (-356.950) (-359.639) [-357.743] (-357.931) -- 0:00:47
346500 -- (-356.865) (-360.627) [-358.419] (-358.256) * [-357.011] (-359.377) (-357.455) (-361.774) -- 0:00:47
347000 -- (-358.665) (-356.979) (-358.809) [-358.031] * (-358.110) (-361.865) [-357.873] (-358.492) -- 0:00:47
347500 -- (-358.788) (-358.121) (-360.131) [-359.718] * [-357.659] (-358.669) (-365.098) (-357.184) -- 0:00:46
348000 -- (-362.656) (-357.540) (-363.194) [-357.815] * (-359.390) (-360.480) (-361.940) [-356.416] -- 0:00:46
348500 -- (-359.343) (-359.541) [-362.102] (-359.212) * (-359.680) (-358.064) [-361.383] (-358.505) -- 0:00:46
349000 -- (-358.864) (-357.736) (-364.181) [-357.204] * (-360.203) (-358.626) (-357.323) [-359.590] -- 0:00:46
349500 -- (-359.142) [-359.511] (-358.905) (-357.305) * (-361.436) (-356.554) [-357.474] (-358.858) -- 0:00:46
350000 -- (-359.298) (-360.153) (-359.013) [-358.983] * (-358.359) (-356.859) (-360.321) [-359.364] -- 0:00:46
Average standard deviation of split frequencies: 0.009111
350500 -- (-356.622) (-357.863) (-356.397) [-359.660] * (-358.881) [-357.268] (-360.788) (-360.533) -- 0:00:46
351000 -- (-360.658) (-363.426) (-358.538) [-358.598] * (-356.904) [-357.757] (-361.358) (-358.581) -- 0:00:46
351500 -- (-360.425) (-357.737) (-360.011) [-360.692] * (-361.129) [-357.521] (-357.402) (-359.449) -- 0:00:46
352000 -- (-358.464) (-359.093) (-358.181) [-356.656] * [-359.984] (-358.874) (-356.826) (-359.521) -- 0:00:46
352500 -- (-359.747) [-360.066] (-361.646) (-357.952) * (-357.835) (-358.574) [-357.834] (-357.352) -- 0:00:45
353000 -- (-358.032) (-359.618) (-358.885) [-358.820] * [-356.772] (-356.841) (-357.391) (-359.776) -- 0:00:45
353500 -- [-359.425] (-359.453) (-359.773) (-357.679) * [-359.639] (-358.651) (-358.552) (-358.585) -- 0:00:45
354000 -- [-359.089] (-361.122) (-360.540) (-357.786) * [-360.561] (-359.051) (-357.341) (-358.443) -- 0:00:45
354500 -- (-357.883) (-357.240) (-357.626) [-358.565] * (-358.318) (-356.673) (-358.633) [-358.966] -- 0:00:45
355000 -- (-358.302) (-358.330) (-357.340) [-357.791] * (-358.392) [-358.528] (-357.703) (-365.284) -- 0:00:45
Average standard deviation of split frequencies: 0.009048
355500 -- [-357.876] (-358.575) (-357.672) (-358.363) * [-360.770] (-359.034) (-360.479) (-361.545) -- 0:00:45
356000 -- (-358.915) (-361.085) [-360.144] (-358.883) * (-357.543) (-359.811) [-358.063] (-366.938) -- 0:00:45
356500 -- (-357.491) [-361.483] (-357.957) (-358.228) * [-360.009] (-360.191) (-358.507) (-357.324) -- 0:00:45
357000 -- [-356.637] (-357.332) (-358.386) (-356.997) * (-356.487) (-359.050) (-357.617) [-361.344] -- 0:00:45
357500 -- (-363.531) [-358.953] (-359.802) (-359.839) * (-357.043) (-357.311) [-358.244] (-359.468) -- 0:00:44
358000 -- (-360.962) (-359.202) [-358.254] (-357.434) * (-357.512) (-360.247) [-356.991] (-357.712) -- 0:00:44
358500 -- (-358.397) [-357.315] (-359.988) (-358.187) * (-360.674) (-360.953) [-359.808] (-357.987) -- 0:00:44
359000 -- [-360.055] (-357.911) (-362.282) (-361.000) * (-358.434) (-358.652) [-358.188] (-357.443) -- 0:00:44
359500 -- [-357.253] (-359.497) (-360.247) (-357.249) * (-357.858) (-358.848) (-361.388) [-356.836] -- 0:00:44
360000 -- (-360.694) [-357.862] (-358.690) (-358.297) * (-357.233) (-357.786) (-357.630) [-359.226] -- 0:00:44
Average standard deviation of split frequencies: 0.009303
360500 -- (-362.382) (-358.452) (-361.560) [-358.235] * (-358.417) [-357.612] (-359.621) (-369.021) -- 0:00:44
361000 -- (-362.663) (-358.170) [-359.281] (-359.306) * (-361.934) [-359.807] (-359.507) (-364.482) -- 0:00:44
361500 -- (-359.749) (-358.786) (-361.939) [-361.887] * (-362.831) (-362.704) (-357.968) [-359.454] -- 0:00:45
362000 -- (-365.245) (-357.703) (-361.090) [-359.198] * [-357.009] (-358.433) (-360.226) (-360.222) -- 0:00:45
362500 -- (-359.908) (-358.246) [-358.733] (-358.685) * (-357.442) (-358.303) [-358.954] (-358.927) -- 0:00:45
363000 -- (-359.490) (-359.424) [-357.537] (-361.956) * (-359.121) (-358.511) (-359.521) [-361.764] -- 0:00:45
363500 -- (-358.103) (-358.215) [-359.428] (-357.474) * (-363.140) (-358.587) [-357.231] (-359.768) -- 0:00:45
364000 -- [-357.227] (-359.298) (-357.925) (-357.965) * (-357.756) (-358.093) (-358.465) [-359.199] -- 0:00:45
364500 -- (-357.411) (-357.248) [-362.513] (-360.379) * (-358.621) [-359.803] (-358.889) (-362.385) -- 0:00:45
365000 -- (-356.718) [-358.941] (-361.013) (-357.633) * (-357.766) [-359.818] (-358.005) (-360.857) -- 0:00:45
Average standard deviation of split frequencies: 0.008944
365500 -- (-356.963) (-362.464) (-359.362) [-357.590] * (-359.102) [-358.006] (-360.152) (-359.226) -- 0:00:45
366000 -- [-358.609] (-358.595) (-360.167) (-357.915) * (-359.119) (-359.326) (-359.469) [-361.571] -- 0:00:45
366500 -- (-360.625) [-358.007] (-359.428) (-357.316) * [-357.382] (-357.267) (-356.981) (-364.336) -- 0:00:44
367000 -- [-357.434] (-357.561) (-358.995) (-356.810) * (-358.230) (-358.569) (-359.198) [-362.522] -- 0:00:44
367500 -- (-359.803) [-358.301] (-360.526) (-358.212) * [-359.258] (-359.235) (-360.981) (-361.995) -- 0:00:44
368000 -- (-360.917) (-359.287) [-358.998] (-359.682) * [-357.789] (-360.199) (-359.175) (-359.040) -- 0:00:44
368500 -- (-360.128) [-359.778] (-358.354) (-360.787) * [-359.135] (-357.331) (-361.443) (-359.890) -- 0:00:44
369000 -- (-358.831) (-360.243) (-359.678) [-357.534] * (-358.439) [-357.481] (-357.607) (-357.556) -- 0:00:44
369500 -- (-358.901) [-359.211] (-357.040) (-362.667) * [-356.984] (-360.697) (-359.132) (-359.052) -- 0:00:44
370000 -- (-359.666) (-362.264) (-359.361) [-360.367] * [-357.229] (-364.997) (-358.312) (-361.530) -- 0:00:44
Average standard deviation of split frequencies: 0.009875
370500 -- (-358.178) (-361.886) [-358.076] (-356.441) * (-362.998) [-357.803] (-363.017) (-360.025) -- 0:00:44
371000 -- (-364.033) (-358.114) (-360.718) [-358.178] * (-360.159) (-357.981) (-359.848) [-356.888] -- 0:00:44
371500 -- (-357.705) [-358.485] (-358.276) (-359.721) * (-357.827) [-360.376] (-359.197) (-361.626) -- 0:00:43
372000 -- (-361.551) [-357.748] (-360.709) (-359.039) * [-357.517] (-358.921) (-359.326) (-358.868) -- 0:00:43
372500 -- (-358.763) (-359.022) (-357.707) [-357.220] * (-359.092) (-357.568) (-357.759) [-357.090] -- 0:00:43
373000 -- [-359.995] (-357.961) (-358.643) (-360.623) * (-356.856) (-357.465) (-356.599) [-358.226] -- 0:00:43
373500 -- (-359.610) [-356.967] (-358.665) (-357.502) * [-356.803] (-357.768) (-357.432) (-358.227) -- 0:00:43
374000 -- (-357.100) (-357.152) (-359.316) [-357.952] * (-361.692) [-357.675] (-356.957) (-358.626) -- 0:00:43
374500 -- (-358.085) (-358.840) (-358.535) [-358.146] * (-362.209) [-359.072] (-362.014) (-358.380) -- 0:00:43
375000 -- [-358.727] (-358.923) (-358.152) (-360.596) * (-363.393) (-358.345) [-359.023] (-357.503) -- 0:00:43
Average standard deviation of split frequencies: 0.009071
375500 -- (-362.130) [-359.036] (-359.770) (-357.415) * (-357.949) [-357.608] (-357.095) (-358.646) -- 0:00:43
376000 -- (-359.355) [-360.555] (-357.718) (-362.531) * [-358.856] (-356.919) (-358.323) (-357.525) -- 0:00:43
376500 -- (-359.926) (-357.102) [-357.163] (-362.393) * (-359.152) [-357.872] (-357.600) (-357.134) -- 0:00:43
377000 -- [-360.421] (-357.686) (-356.995) (-357.772) * [-358.162] (-358.234) (-361.582) (-359.154) -- 0:00:42
377500 -- (-359.503) (-361.970) [-358.249] (-362.025) * [-358.770] (-357.575) (-357.241) (-359.475) -- 0:00:42
378000 -- [-360.703] (-357.707) (-359.705) (-359.866) * [-358.352] (-356.533) (-357.767) (-356.445) -- 0:00:42
378500 -- (-357.373) [-357.287] (-362.417) (-359.928) * [-360.272] (-359.457) (-357.647) (-356.823) -- 0:00:44
379000 -- (-357.299) (-358.193) (-366.185) [-360.018] * (-358.121) (-359.790) [-358.671] (-357.553) -- 0:00:44
379500 -- (-356.854) (-358.975) (-365.314) [-359.654] * (-357.954) (-358.498) [-356.616] (-356.393) -- 0:00:44
380000 -- (-360.339) [-359.048] (-359.789) (-358.456) * (-357.414) (-358.750) (-357.360) [-357.203] -- 0:00:44
Average standard deviation of split frequencies: 0.009033
380500 -- (-360.532) (-360.383) (-358.178) [-357.083] * [-357.633] (-360.645) (-356.459) (-357.813) -- 0:00:43
381000 -- (-359.990) (-360.435) (-357.889) [-356.971] * (-359.397) [-359.494] (-357.101) (-357.371) -- 0:00:43
381500 -- (-361.940) (-360.348) (-359.362) [-358.842] * (-357.367) (-360.044) [-356.600] (-357.239) -- 0:00:43
382000 -- (-361.249) (-359.839) (-359.411) [-357.277] * (-356.939) [-356.995] (-357.080) (-360.315) -- 0:00:43
382500 -- [-359.182] (-358.863) (-359.902) (-356.906) * [-359.351] (-361.903) (-360.209) (-357.569) -- 0:00:43
383000 -- (-359.603) [-360.385] (-359.591) (-357.404) * [-359.982] (-361.134) (-359.962) (-360.499) -- 0:00:43
383500 -- (-359.575) [-360.062] (-357.859) (-358.832) * [-356.690] (-357.427) (-362.656) (-360.628) -- 0:00:43
384000 -- (-360.642) [-360.338] (-360.034) (-358.650) * (-360.142) [-357.792] (-359.053) (-356.948) -- 0:00:43
384500 -- [-363.341] (-357.004) (-360.763) (-357.165) * [-364.208] (-358.693) (-358.302) (-359.635) -- 0:00:43
385000 -- (-359.990) (-360.150) (-360.377) [-357.756] * (-359.020) (-360.759) [-356.863] (-358.536) -- 0:00:43
Average standard deviation of split frequencies: 0.008481
385500 -- (-362.601) (-359.416) [-357.830] (-356.770) * [-356.655] (-361.334) (-358.203) (-358.477) -- 0:00:43
386000 -- (-360.084) (-360.074) (-360.125) [-358.888] * [-358.799] (-357.926) (-358.783) (-357.073) -- 0:00:42
386500 -- (-361.313) [-357.529] (-361.085) (-357.440) * (-357.282) [-357.534] (-357.927) (-363.492) -- 0:00:42
387000 -- [-358.414] (-359.331) (-358.506) (-361.470) * (-362.919) (-361.650) (-358.615) [-359.243] -- 0:00:42
387500 -- (-359.307) (-359.960) [-360.653] (-363.879) * (-365.848) (-358.573) [-357.325] (-360.756) -- 0:00:42
388000 -- (-358.250) (-357.824) [-364.604] (-365.645) * (-360.863) (-357.888) (-360.022) [-359.811] -- 0:00:42
388500 -- (-359.455) (-357.612) (-361.398) [-361.950] * (-364.660) (-360.491) (-357.421) [-356.985] -- 0:00:42
389000 -- (-357.229) (-359.762) (-362.816) [-359.598] * (-358.847) [-358.623] (-367.076) (-360.036) -- 0:00:42
389500 -- (-358.871) (-358.566) (-362.184) [-357.457] * (-357.628) (-357.552) [-357.264] (-360.509) -- 0:00:42
390000 -- [-360.149] (-359.983) (-360.625) (-357.960) * [-360.461] (-358.562) (-359.793) (-360.195) -- 0:00:42
Average standard deviation of split frequencies: 0.008021
390500 -- (-361.766) (-360.185) [-359.496] (-359.116) * (-362.210) (-361.333) [-357.710] (-360.861) -- 0:00:42
391000 -- (-357.686) (-359.398) [-362.484] (-361.204) * (-362.357) (-359.389) [-357.062] (-366.285) -- 0:00:42
391500 -- (-360.013) [-357.988] (-357.984) (-359.551) * (-357.841) (-367.218) (-359.356) [-363.585] -- 0:00:41
392000 -- (-360.588) (-358.637) (-358.253) [-357.416] * [-359.939] (-359.016) (-361.157) (-367.990) -- 0:00:41
392500 -- (-359.593) (-360.612) [-357.068] (-356.709) * (-357.134) [-358.324] (-359.220) (-362.391) -- 0:00:41
393000 -- (-359.278) [-359.097] (-357.612) (-358.355) * (-360.515) [-362.620] (-360.490) (-363.062) -- 0:00:41
393500 -- [-361.252] (-357.798) (-358.082) (-356.965) * (-361.653) [-359.426] (-360.003) (-359.464) -- 0:00:41
394000 -- [-359.682] (-357.255) (-356.582) (-358.654) * (-362.131) (-360.722) [-361.491] (-357.653) -- 0:00:41
394500 -- (-357.898) (-358.363) (-357.778) [-357.165] * (-363.303) [-357.928] (-361.377) (-356.875) -- 0:00:41
395000 -- (-357.139) (-363.355) [-359.870] (-358.037) * [-357.917] (-360.349) (-360.268) (-362.857) -- 0:00:42
Average standard deviation of split frequencies: 0.009453
395500 -- (-362.452) (-363.538) (-357.307) [-360.395] * (-362.177) (-358.827) [-356.565] (-361.166) -- 0:00:42
396000 -- [-358.184] (-356.984) (-357.332) (-359.169) * (-357.001) [-361.018] (-357.051) (-361.841) -- 0:00:42
396500 -- [-357.395] (-356.617) (-362.437) (-363.462) * (-361.212) (-360.113) [-357.407] (-362.658) -- 0:00:42
397000 -- [-361.108] (-357.169) (-361.278) (-357.879) * (-357.281) (-358.451) [-356.935] (-358.625) -- 0:00:42
397500 -- (-357.805) (-358.751) (-358.463) [-357.890] * [-360.263] (-357.950) (-357.597) (-357.259) -- 0:00:42
398000 -- [-358.548] (-357.695) (-358.786) (-358.463) * (-356.893) [-358.392] (-361.261) (-360.216) -- 0:00:42
398500 -- (-361.401) (-359.280) [-359.484] (-358.446) * (-358.817) (-358.719) (-361.578) [-357.808] -- 0:00:42
399000 -- (-361.350) [-357.129] (-360.146) (-357.584) * (-360.478) [-362.422] (-358.295) (-357.736) -- 0:00:42
399500 -- [-360.097] (-357.563) (-358.282) (-362.087) * [-356.979] (-358.249) (-358.005) (-357.222) -- 0:00:42
400000 -- [-357.460] (-359.018) (-358.524) (-360.355) * (-357.394) [-359.285] (-359.998) (-357.392) -- 0:00:41
Average standard deviation of split frequencies: 0.009045
400500 -- (-360.805) (-358.645) [-358.237] (-358.707) * (-358.456) [-363.338] (-361.594) (-358.560) -- 0:00:41
401000 -- (-358.589) [-359.166] (-356.990) (-359.064) * (-360.342) (-359.156) (-359.049) [-357.772] -- 0:00:41
401500 -- (-361.327) (-357.226) (-357.259) [-358.003] * (-357.711) (-359.859) (-360.355) [-358.062] -- 0:00:41
402000 -- (-359.047) (-362.572) (-357.931) [-358.769] * (-357.027) (-363.063) (-357.113) [-358.834] -- 0:00:41
402500 -- (-361.805) (-357.935) (-357.150) [-357.524] * (-363.154) (-364.616) [-357.016] (-357.146) -- 0:00:41
403000 -- (-358.280) (-361.005) (-356.930) [-358.656] * [-358.576] (-359.071) (-358.816) (-357.355) -- 0:00:41
403500 -- (-357.948) [-358.697] (-357.245) (-357.259) * (-357.261) (-362.039) (-366.537) [-358.473] -- 0:00:41
404000 -- (-358.429) (-357.699) [-357.222] (-357.458) * (-358.711) (-357.861) [-358.405] (-358.173) -- 0:00:41
404500 -- (-360.313) (-357.533) (-361.662) [-358.509] * (-359.617) (-363.163) (-358.198) [-358.436] -- 0:00:41
405000 -- [-357.041] (-358.687) (-357.934) (-357.994) * (-359.869) [-357.230] (-356.679) (-358.345) -- 0:00:41
Average standard deviation of split frequencies: 0.010385
405500 -- [-359.577] (-361.790) (-362.367) (-357.451) * (-360.236) [-357.628] (-357.785) (-359.608) -- 0:00:41
406000 -- (-358.468) [-361.603] (-359.080) (-359.974) * (-360.885) (-357.597) [-357.506] (-357.674) -- 0:00:40
406500 -- [-358.085] (-358.664) (-358.029) (-358.351) * (-357.898) (-360.121) (-358.797) [-356.960] -- 0:00:40
407000 -- (-356.689) [-356.977] (-358.671) (-357.682) * (-363.849) (-359.545) (-357.592) [-358.545] -- 0:00:40
407500 -- [-358.373] (-361.482) (-356.615) (-359.481) * [-359.458] (-361.347) (-360.927) (-358.898) -- 0:00:40
408000 -- [-356.615] (-359.896) (-361.527) (-357.231) * (-359.894) [-358.644] (-357.819) (-359.284) -- 0:00:40
408500 -- (-362.350) (-357.687) [-357.650] (-358.523) * (-357.315) [-358.415] (-357.560) (-359.829) -- 0:00:40
409000 -- (-356.672) [-357.107] (-358.261) (-356.598) * (-359.919) [-357.732] (-359.427) (-356.781) -- 0:00:40
409500 -- (-360.465) (-358.702) (-357.978) [-361.120] * (-357.636) (-357.860) (-365.066) [-358.169] -- 0:00:40
410000 -- [-358.001] (-359.417) (-358.116) (-357.550) * (-359.275) (-360.927) [-358.519] (-357.845) -- 0:00:40
Average standard deviation of split frequencies: 0.010522
410500 -- (-358.755) (-358.604) [-358.256] (-357.718) * (-359.692) (-367.508) (-357.656) [-359.541] -- 0:00:40
411000 -- (-361.221) (-357.326) [-361.372] (-359.577) * (-363.540) [-359.800] (-357.157) (-360.702) -- 0:00:40
411500 -- (-357.540) [-359.062] (-357.304) (-364.006) * (-363.078) (-358.471) [-357.415] (-360.800) -- 0:00:41
412000 -- (-358.149) (-358.931) [-359.696] (-359.512) * (-359.541) (-358.117) [-359.797] (-357.216) -- 0:00:41
412500 -- (-360.008) [-357.909] (-359.132) (-357.513) * [-359.346] (-359.228) (-359.730) (-360.587) -- 0:00:41
413000 -- (-359.118) [-359.192] (-359.773) (-360.392) * [-364.777] (-358.951) (-358.244) (-359.806) -- 0:00:41
413500 -- [-359.264] (-357.960) (-358.490) (-361.909) * (-364.956) [-357.163] (-358.600) (-358.258) -- 0:00:41
414000 -- [-360.912] (-358.443) (-360.394) (-359.187) * (-362.059) (-357.598) [-359.325] (-359.556) -- 0:00:41
414500 -- [-361.226] (-357.028) (-357.534) (-359.984) * (-357.942) (-359.825) (-357.112) [-356.907] -- 0:00:40
415000 -- (-360.071) (-360.898) [-359.300] (-358.921) * (-357.377) [-359.361] (-358.032) (-357.556) -- 0:00:40
Average standard deviation of split frequencies: 0.010450
415500 -- (-360.791) [-357.237] (-358.849) (-357.523) * (-357.352) (-358.108) [-358.537] (-357.942) -- 0:00:40
416000 -- (-359.192) (-358.757) [-363.030] (-359.769) * [-359.697] (-357.471) (-360.261) (-358.898) -- 0:00:40
416500 -- [-357.317] (-361.686) (-357.433) (-357.761) * (-356.423) (-357.183) [-359.151] (-358.072) -- 0:00:40
417000 -- [-358.828] (-361.481) (-359.736) (-363.465) * [-357.263] (-357.463) (-357.595) (-360.609) -- 0:00:40
417500 -- (-358.133) (-359.245) (-356.649) [-360.370] * [-359.084] (-360.241) (-358.103) (-358.324) -- 0:00:40
418000 -- (-358.037) [-358.699] (-358.520) (-358.327) * (-358.051) [-360.924] (-360.715) (-357.584) -- 0:00:40
418500 -- [-360.803] (-359.225) (-358.402) (-357.455) * [-356.518] (-358.607) (-358.735) (-358.384) -- 0:00:40
419000 -- (-363.060) (-363.381) [-358.784] (-357.667) * [-356.971] (-358.981) (-360.089) (-358.598) -- 0:00:40
419500 -- (-363.070) (-361.317) (-362.157) [-358.037] * (-363.395) (-357.971) [-360.780] (-357.498) -- 0:00:40
420000 -- (-363.868) (-362.196) [-362.072] (-358.343) * (-358.296) (-357.498) (-358.440) [-361.599] -- 0:00:40
Average standard deviation of split frequencies: 0.009888
420500 -- (-358.606) (-361.803) (-359.626) [-358.891] * (-358.301) (-357.821) (-359.366) [-358.024] -- 0:00:39
421000 -- (-358.154) [-359.380] (-357.478) (-358.708) * (-358.952) [-357.819] (-362.986) (-358.737) -- 0:00:39
421500 -- [-356.387] (-357.470) (-357.428) (-359.650) * (-360.097) (-359.293) [-364.127] (-359.562) -- 0:00:39
422000 -- (-361.354) [-359.224] (-356.466) (-358.483) * (-358.511) (-358.411) [-357.156] (-360.014) -- 0:00:39
422500 -- (-361.079) (-358.385) [-359.021] (-357.899) * [-358.527] (-358.432) (-357.363) (-361.385) -- 0:00:39
423000 -- (-358.059) (-358.000) (-358.369) [-357.731] * (-357.260) (-358.755) (-356.906) [-358.642] -- 0:00:39
423500 -- (-358.909) (-362.866) (-357.271) [-357.381] * (-357.852) (-356.880) (-365.108) [-356.930] -- 0:00:39
424000 -- (-358.157) (-358.390) (-361.053) [-359.208] * (-363.146) (-357.559) (-361.234) [-360.211] -- 0:00:39
424500 -- [-358.186] (-357.300) (-358.827) (-360.112) * (-361.843) (-358.502) (-357.384) [-360.112] -- 0:00:39
425000 -- (-357.342) [-358.337] (-358.074) (-358.485) * [-361.274] (-357.915) (-358.253) (-358.381) -- 0:00:39
Average standard deviation of split frequencies: 0.010205
425500 -- (-360.443) [-357.115] (-359.461) (-362.855) * (-358.936) (-359.394) [-358.290] (-360.445) -- 0:00:39
426000 -- (-357.336) [-357.178] (-361.102) (-361.049) * (-357.591) (-364.719) [-357.436] (-360.400) -- 0:00:39
426500 -- (-361.504) (-360.493) (-359.599) [-361.833] * (-357.190) (-360.149) [-361.682] (-358.807) -- 0:00:38
427000 -- (-360.505) (-358.176) (-357.181) [-360.207] * [-362.221] (-360.149) (-362.604) (-359.391) -- 0:00:38
427500 -- [-359.357] (-356.332) (-362.665) (-361.844) * [-358.656] (-359.802) (-359.588) (-363.140) -- 0:00:38
428000 -- (-356.389) (-358.429) [-359.275] (-359.764) * [-361.048] (-359.732) (-358.800) (-360.593) -- 0:00:38
428500 -- [-359.688] (-357.985) (-359.754) (-356.812) * (-358.552) (-360.753) (-359.540) [-358.926] -- 0:00:40
429000 -- (-359.104) (-359.480) [-357.762] (-366.520) * (-357.694) (-359.138) [-358.251] (-360.262) -- 0:00:39
429500 -- (-358.333) [-361.205] (-358.205) (-363.562) * (-359.180) (-358.458) (-357.911) [-357.253] -- 0:00:39
430000 -- (-357.619) (-361.734) [-357.515] (-358.862) * (-358.732) (-356.745) (-357.166) [-358.284] -- 0:00:39
Average standard deviation of split frequencies: 0.009973
430500 -- (-358.604) (-358.197) (-356.947) [-357.522] * [-358.366] (-356.787) (-356.842) (-358.388) -- 0:00:39
431000 -- (-358.166) (-357.802) [-356.939] (-360.810) * (-357.347) [-357.323] (-358.944) (-357.867) -- 0:00:39
431500 -- (-360.081) (-356.891) (-357.016) [-357.941] * [-357.805] (-361.675) (-357.099) (-358.175) -- 0:00:39
432000 -- (-360.142) (-358.948) (-358.543) [-363.467] * [-357.863] (-362.481) (-357.431) (-360.899) -- 0:00:39
432500 -- (-356.872) [-360.624] (-359.750) (-359.509) * (-358.326) [-360.360] (-360.680) (-362.316) -- 0:00:39
433000 -- (-358.799) (-357.160) [-363.198] (-359.727) * (-356.580) [-356.619] (-358.165) (-358.509) -- 0:00:39
433500 -- (-359.260) (-357.450) [-361.118] (-360.076) * (-357.834) [-358.982] (-359.848) (-357.820) -- 0:00:39
434000 -- (-361.748) (-359.157) [-357.958] (-359.320) * (-359.914) (-358.004) (-357.568) [-363.094] -- 0:00:39
434500 -- (-359.379) (-360.790) (-359.328) [-359.563] * (-360.046) [-359.129] (-357.928) (-359.066) -- 0:00:39
435000 -- (-357.276) [-359.005] (-357.179) (-358.876) * (-358.364) (-359.478) [-356.691] (-357.857) -- 0:00:38
Average standard deviation of split frequencies: 0.009791
435500 -- (-358.181) (-359.131) [-358.235] (-359.590) * (-358.640) (-359.349) [-359.006] (-360.579) -- 0:00:38
436000 -- (-358.925) (-360.663) [-362.065] (-358.203) * (-357.963) (-359.062) [-358.396] (-357.836) -- 0:00:38
436500 -- (-363.682) (-358.036) [-360.730] (-366.862) * [-358.338] (-361.260) (-364.576) (-360.627) -- 0:00:38
437000 -- (-363.816) (-359.837) (-363.504) [-366.309] * [-358.050] (-357.297) (-360.557) (-366.922) -- 0:00:38
437500 -- (-362.618) [-359.446] (-359.488) (-356.773) * (-358.393) (-359.839) (-363.015) [-359.174] -- 0:00:38
438000 -- (-361.279) (-359.634) [-358.398] (-357.032) * (-360.765) [-357.524] (-360.235) (-357.812) -- 0:00:38
438500 -- (-357.881) (-359.406) (-357.974) [-358.392] * (-359.852) (-359.930) (-359.080) [-357.259] -- 0:00:38
439000 -- (-359.072) (-361.100) (-358.659) [-358.708] * (-359.738) (-359.305) (-358.545) [-356.918] -- 0:00:38
439500 -- (-357.904) [-357.162] (-357.092) (-361.483) * (-360.111) [-358.767] (-357.499) (-358.693) -- 0:00:38
440000 -- [-363.292] (-357.284) (-356.704) (-360.819) * (-357.926) (-357.483) [-357.002] (-358.152) -- 0:00:38
Average standard deviation of split frequencies: 0.009331
440500 -- [-359.413] (-358.952) (-359.557) (-358.633) * (-364.072) (-358.648) (-356.597) [-360.382] -- 0:00:38
441000 -- [-359.380] (-360.507) (-358.964) (-362.811) * (-360.484) [-361.420] (-356.677) (-359.680) -- 0:00:38
441500 -- (-357.454) [-358.276] (-357.305) (-360.371) * (-357.005) (-362.909) [-357.774] (-357.746) -- 0:00:37
442000 -- (-359.796) (-357.793) [-357.064] (-357.678) * (-357.921) [-361.167] (-361.775) (-357.848) -- 0:00:37
442500 -- (-358.445) (-359.352) [-364.878] (-357.677) * (-357.712) (-364.346) (-357.932) [-358.182] -- 0:00:37
443000 -- (-364.224) (-359.403) (-360.513) [-358.565] * [-357.601] (-360.209) (-357.456) (-360.825) -- 0:00:37
443500 -- (-362.525) (-359.313) (-362.087) [-360.261] * (-358.082) (-361.205) [-357.599] (-359.512) -- 0:00:37
444000 -- (-358.552) [-359.166] (-359.218) (-358.831) * (-357.287) (-357.185) [-358.789] (-357.491) -- 0:00:37
444500 -- (-358.335) (-359.180) (-359.929) [-358.827] * [-358.601] (-357.082) (-357.258) (-359.422) -- 0:00:37
445000 -- (-359.713) (-361.158) (-357.539) [-357.249] * (-357.967) [-357.320] (-364.202) (-359.191) -- 0:00:37
Average standard deviation of split frequencies: 0.009336
445500 -- (-361.862) [-356.912] (-358.333) (-359.089) * (-357.920) (-358.311) [-358.945] (-356.645) -- 0:00:38
446000 -- (-358.992) [-357.710] (-360.478) (-361.033) * (-359.576) [-357.316] (-358.185) (-356.680) -- 0:00:38
446500 -- (-358.259) (-361.543) [-357.680] (-358.679) * (-360.429) (-359.650) [-357.399] (-358.484) -- 0:00:38
447000 -- [-357.904] (-357.162) (-356.534) (-359.645) * (-358.891) (-359.342) [-357.259] (-360.607) -- 0:00:38
447500 -- (-359.161) (-358.782) (-358.482) [-359.313] * [-358.522] (-358.134) (-358.521) (-358.019) -- 0:00:38
448000 -- (-361.675) (-359.057) [-357.232] (-359.738) * [-356.740] (-358.747) (-356.666) (-361.244) -- 0:00:38
448500 -- (-357.790) (-362.862) (-361.332) [-358.156] * (-357.687) (-357.218) [-356.883] (-360.253) -- 0:00:38
449000 -- (-357.060) (-361.189) [-357.388] (-358.042) * [-357.014] (-361.998) (-358.306) (-357.225) -- 0:00:38
449500 -- (-361.645) (-362.882) [-358.727] (-358.545) * (-359.169) [-358.184] (-360.086) (-357.378) -- 0:00:37
450000 -- (-358.839) [-360.463] (-359.489) (-358.177) * (-359.486) (-356.877) (-360.541) [-359.621] -- 0:00:37
Average standard deviation of split frequencies: 0.008676
450500 -- (-358.421) [-359.893] (-357.845) (-357.591) * (-357.395) [-356.729] (-357.454) (-363.590) -- 0:00:37
451000 -- [-359.137] (-358.022) (-357.831) (-357.761) * (-358.219) (-357.513) (-360.943) [-358.290] -- 0:00:37
451500 -- (-358.147) [-358.515] (-358.509) (-357.436) * (-357.341) (-358.316) [-357.733] (-358.544) -- 0:00:37
452000 -- (-357.314) [-358.552] (-360.793) (-356.583) * (-359.185) [-357.333] (-357.243) (-361.822) -- 0:00:37
452500 -- (-359.610) (-359.840) [-357.302] (-359.201) * [-357.150] (-360.060) (-357.143) (-357.430) -- 0:00:37
453000 -- (-359.100) (-360.082) [-359.519] (-360.574) * [-357.902] (-358.550) (-359.839) (-358.481) -- 0:00:37
453500 -- (-356.969) [-362.128] (-360.446) (-360.275) * (-357.420) (-358.212) [-358.116] (-360.232) -- 0:00:37
454000 -- (-356.776) [-358.391] (-357.895) (-361.791) * [-359.087] (-363.034) (-357.675) (-357.988) -- 0:00:37
454500 -- (-357.478) (-361.413) (-357.066) [-363.661] * (-365.162) (-360.542) [-360.827] (-360.209) -- 0:00:37
455000 -- [-360.483] (-362.592) (-359.558) (-358.776) * (-358.680) [-356.589] (-359.730) (-358.072) -- 0:00:37
Average standard deviation of split frequencies: 0.009361
455500 -- (-360.756) [-358.403] (-358.773) (-357.470) * (-360.071) (-359.725) (-361.477) [-358.125] -- 0:00:37
456000 -- (-359.634) [-358.945] (-364.252) (-359.730) * (-357.990) (-357.182) [-365.082] (-357.708) -- 0:00:36
456500 -- (-358.300) (-359.962) (-360.994) [-361.190] * [-356.390] (-358.714) (-360.290) (-359.222) -- 0:00:36
457000 -- (-357.628) [-360.352] (-358.401) (-358.975) * [-359.527] (-362.253) (-358.870) (-357.762) -- 0:00:36
457500 -- (-362.113) [-358.151] (-357.940) (-359.923) * (-359.841) [-358.183] (-356.513) (-360.308) -- 0:00:36
458000 -- [-359.501] (-359.563) (-358.199) (-360.041) * (-359.783) (-359.483) (-356.795) [-359.075] -- 0:00:36
458500 -- (-358.470) (-361.653) (-358.072) [-358.564] * [-358.881] (-357.986) (-357.197) (-357.641) -- 0:00:36
459000 -- [-358.089] (-360.738) (-361.854) (-359.048) * (-358.557) (-359.586) [-360.577] (-358.959) -- 0:00:36
459500 -- (-358.164) [-359.006] (-358.147) (-358.164) * [-357.600] (-363.496) (-357.530) (-358.719) -- 0:00:36
460000 -- (-357.090) [-359.667] (-362.106) (-357.357) * (-358.006) (-357.113) (-358.527) [-358.177] -- 0:00:36
Average standard deviation of split frequencies: 0.009608
460500 -- (-359.632) [-357.965] (-361.791) (-357.083) * (-359.243) (-362.548) [-358.835] (-361.330) -- 0:00:36
461000 -- (-359.178) (-358.566) [-361.819] (-359.703) * [-357.426] (-357.182) (-357.803) (-358.904) -- 0:00:36
461500 -- (-360.292) (-360.614) (-357.140) [-358.264] * (-357.858) (-357.436) (-360.820) [-361.760] -- 0:00:36
462000 -- (-356.826) [-358.428] (-360.484) (-362.198) * (-357.354) [-359.480] (-359.822) (-356.867) -- 0:00:36
462500 -- (-357.582) (-357.538) (-359.679) [-357.394] * (-358.896) [-357.816] (-358.407) (-357.025) -- 0:00:37
463000 -- [-358.146] (-358.622) (-359.935) (-357.639) * (-357.439) (-361.537) (-358.199) [-359.426] -- 0:00:37
463500 -- (-357.720) (-360.126) [-360.273] (-356.891) * (-357.975) (-358.889) [-358.603] (-358.848) -- 0:00:37
464000 -- (-357.322) (-357.979) [-362.890] (-361.521) * (-366.527) (-360.608) [-358.792] (-359.088) -- 0:00:36
464500 -- (-357.913) (-357.702) (-359.698) [-357.269] * [-359.493] (-358.750) (-357.584) (-358.465) -- 0:00:36
465000 -- [-357.064] (-356.724) (-359.702) (-357.467) * (-359.455) [-357.102] (-360.298) (-361.386) -- 0:00:36
Average standard deviation of split frequencies: 0.009584
465500 -- (-357.808) (-356.718) [-359.560] (-359.254) * (-357.784) (-362.424) (-356.849) [-358.757] -- 0:00:36
466000 -- (-359.804) (-357.656) [-357.551] (-357.939) * [-359.815] (-359.698) (-356.818) (-358.256) -- 0:00:36
466500 -- (-357.145) (-360.576) [-357.557] (-357.835) * (-357.846) (-356.800) [-358.092] (-358.368) -- 0:00:36
467000 -- [-358.836] (-357.272) (-358.646) (-361.289) * [-358.695] (-357.252) (-359.434) (-359.098) -- 0:00:36
467500 -- (-356.777) (-362.187) [-356.502] (-359.762) * (-361.526) (-357.310) (-357.849) [-357.162] -- 0:00:36
468000 -- (-359.093) (-357.856) [-357.278] (-359.245) * [-359.698] (-357.971) (-360.702) (-359.659) -- 0:00:36
468500 -- (-361.764) [-358.858] (-359.449) (-358.516) * [-358.404] (-358.273) (-359.356) (-361.471) -- 0:00:36
469000 -- [-358.228] (-358.866) (-361.081) (-358.462) * (-357.855) (-357.336) [-361.759] (-358.975) -- 0:00:36
469500 -- [-357.561] (-360.188) (-361.881) (-362.150) * [-358.673] (-357.376) (-363.926) (-363.280) -- 0:00:36
470000 -- [-357.759] (-359.614) (-360.643) (-360.307) * (-357.589) [-362.401] (-362.053) (-360.402) -- 0:00:36
Average standard deviation of split frequencies: 0.010227
470500 -- (-358.075) (-358.593) [-356.673] (-360.619) * [-360.058] (-359.073) (-358.487) (-357.764) -- 0:00:36
471000 -- (-358.571) (-357.501) (-357.170) [-357.826] * [-360.641] (-359.865) (-357.614) (-358.766) -- 0:00:35
471500 -- [-357.379] (-358.639) (-358.118) (-356.795) * (-360.080) (-357.095) [-357.508] (-362.854) -- 0:00:35
472000 -- (-357.974) (-361.598) (-357.553) [-356.844] * (-358.967) (-356.958) [-359.190] (-359.857) -- 0:00:35
472500 -- (-360.927) (-362.867) (-358.461) [-357.247] * (-361.456) [-356.832] (-359.952) (-359.506) -- 0:00:35
473000 -- (-359.485) (-364.251) [-360.796] (-357.145) * [-358.696] (-357.619) (-357.334) (-357.466) -- 0:00:35
473500 -- (-357.395) (-358.397) (-358.486) [-359.326] * [-362.051] (-362.204) (-357.578) (-357.021) -- 0:00:35
474000 -- [-360.591] (-358.540) (-358.703) (-357.654) * (-359.705) (-358.866) [-359.571] (-360.537) -- 0:00:35
474500 -- (-358.965) (-359.302) (-357.213) [-357.534] * (-357.764) (-362.887) (-360.348) [-357.711] -- 0:00:35
475000 -- (-359.126) [-360.859] (-357.973) (-357.241) * [-356.517] (-364.684) (-356.385) (-359.680) -- 0:00:35
Average standard deviation of split frequencies: 0.010253
475500 -- (-361.100) (-360.137) (-356.686) [-359.421] * [-356.299] (-356.902) (-359.691) (-360.006) -- 0:00:35
476000 -- (-363.012) (-360.916) [-360.287] (-359.189) * (-356.883) (-357.054) [-358.980] (-359.757) -- 0:00:35
476500 -- (-358.152) (-358.952) [-359.300] (-357.871) * [-358.467] (-357.444) (-357.045) (-358.375) -- 0:00:35
477000 -- (-358.697) (-358.132) [-358.141] (-360.328) * (-359.138) (-357.103) (-360.016) [-359.878] -- 0:00:35
477500 -- (-357.043) [-358.362] (-358.162) (-359.706) * (-359.300) (-357.983) (-363.332) [-360.546] -- 0:00:35
478000 -- (-360.399) (-357.616) (-357.930) [-362.610] * (-361.839) (-358.951) (-357.049) [-358.116] -- 0:00:34
478500 -- [-358.809] (-360.275) (-358.786) (-358.177) * (-362.071) (-358.980) (-358.020) [-358.080] -- 0:00:34
479000 -- [-358.808] (-359.092) (-356.800) (-360.753) * (-357.846) (-356.923) (-360.916) [-360.279] -- 0:00:34
479500 -- (-359.839) (-357.082) [-358.790] (-360.320) * [-357.699] (-358.260) (-358.395) (-359.467) -- 0:00:35
480000 -- [-357.025] (-357.946) (-356.959) (-364.377) * (-357.744) [-357.154] (-358.693) (-357.791) -- 0:00:35
Average standard deviation of split frequencies: 0.010269
480500 -- (-361.239) [-357.445] (-357.308) (-365.937) * (-359.528) (-359.169) [-359.664] (-359.627) -- 0:00:35
481000 -- [-360.735] (-359.508) (-361.297) (-357.004) * (-359.376) (-359.342) (-358.409) [-361.733] -- 0:00:35
481500 -- (-358.573) [-356.943] (-358.800) (-363.266) * (-359.963) (-359.322) [-359.586] (-357.805) -- 0:00:35
482000 -- (-356.570) [-359.625] (-359.047) (-358.886) * [-360.348] (-370.605) (-359.310) (-357.700) -- 0:00:35
482500 -- (-358.007) (-358.480) [-358.557] (-357.748) * (-357.498) [-359.007] (-361.806) (-359.955) -- 0:00:35
483000 -- [-357.809] (-363.293) (-358.404) (-358.116) * (-361.044) [-359.143] (-357.464) (-361.023) -- 0:00:35
483500 -- [-358.421] (-360.513) (-356.464) (-356.565) * [-359.734] (-358.119) (-357.306) (-357.389) -- 0:00:35
484000 -- (-358.743) (-360.096) [-359.025] (-363.760) * [-359.611] (-358.532) (-358.109) (-358.639) -- 0:00:35
484500 -- [-359.852] (-358.145) (-357.624) (-370.422) * (-359.134) (-358.035) [-359.118] (-357.773) -- 0:00:35
485000 -- (-365.243) (-358.657) [-357.448] (-358.903) * (-357.894) [-359.559] (-360.850) (-357.711) -- 0:00:35
Average standard deviation of split frequencies: 0.010556
485500 -- [-360.148] (-358.025) (-359.309) (-358.347) * [-359.449] (-358.832) (-361.510) (-358.834) -- 0:00:34
486000 -- (-360.108) (-356.345) [-357.794] (-360.367) * (-358.234) (-358.496) (-360.295) [-360.005] -- 0:00:34
486500 -- (-358.792) (-357.895) [-360.651] (-361.695) * (-363.757) (-360.339) [-358.370] (-359.964) -- 0:00:34
487000 -- (-361.627) (-359.421) (-362.105) [-360.375] * (-363.731) (-357.743) (-358.509) [-359.294] -- 0:00:34
487500 -- (-357.945) (-361.190) (-363.481) [-357.198] * (-357.640) (-359.587) [-357.257] (-359.368) -- 0:00:34
488000 -- (-358.521) (-358.810) (-358.880) [-358.896] * (-359.960) (-358.419) [-357.667] (-359.286) -- 0:00:34
488500 -- (-360.411) (-356.860) (-362.627) [-357.605] * [-359.306] (-359.386) (-359.063) (-359.429) -- 0:00:34
489000 -- (-357.440) [-357.463] (-362.739) (-357.654) * [-358.799] (-360.141) (-359.946) (-358.314) -- 0:00:34
489500 -- (-360.532) (-356.873) (-362.124) [-358.565] * [-358.069] (-359.376) (-357.461) (-363.295) -- 0:00:34
490000 -- (-357.421) (-357.933) (-361.869) [-357.802] * [-358.935] (-357.704) (-357.726) (-359.672) -- 0:00:34
Average standard deviation of split frequencies: 0.010625
490500 -- [-363.467] (-359.821) (-358.945) (-358.474) * (-358.633) (-359.900) (-362.661) [-360.938] -- 0:00:34
491000 -- (-358.964) (-359.232) (-358.121) [-359.692] * (-357.827) (-357.917) [-356.604] (-358.100) -- 0:00:34
491500 -- (-359.981) [-361.806] (-357.199) (-358.347) * (-359.829) [-357.592] (-356.995) (-362.038) -- 0:00:34
492000 -- (-361.722) [-356.563] (-359.309) (-359.028) * (-357.929) (-359.898) (-360.379) [-357.490] -- 0:00:34
492500 -- (-360.479) [-362.608] (-361.301) (-360.309) * (-360.451) (-360.948) (-357.533) [-357.261] -- 0:00:34
493000 -- (-360.684) [-359.191] (-357.876) (-359.088) * [-360.783] (-357.960) (-359.846) (-359.091) -- 0:00:33
493500 -- [-358.597] (-359.296) (-357.669) (-360.838) * (-362.078) (-359.987) [-358.125] (-358.634) -- 0:00:33
494000 -- (-358.606) [-359.068] (-357.489) (-360.332) * (-357.497) [-357.288] (-357.477) (-358.346) -- 0:00:33
494500 -- (-360.254) (-357.584) [-358.338] (-360.207) * (-358.435) [-359.964] (-362.031) (-357.514) -- 0:00:33
495000 -- [-359.325] (-360.708) (-359.225) (-360.785) * (-358.450) [-356.635] (-360.380) (-357.689) -- 0:00:33
Average standard deviation of split frequencies: 0.010276
495500 -- (-358.252) (-360.278) (-358.564) [-358.910] * (-362.483) (-357.406) [-357.414] (-357.872) -- 0:00:33
496000 -- [-357.488] (-359.847) (-359.585) (-358.906) * [-357.183] (-359.363) (-358.857) (-358.775) -- 0:00:33
496500 -- (-357.539) [-358.137] (-357.789) (-358.966) * [-359.283] (-359.413) (-358.053) (-358.350) -- 0:00:34
497000 -- (-359.800) (-360.319) [-357.311] (-357.915) * [-363.478] (-358.396) (-358.995) (-358.655) -- 0:00:34
497500 -- (-358.400) (-360.107) [-358.299] (-359.819) * [-361.239] (-359.683) (-360.300) (-360.728) -- 0:00:34
498000 -- (-361.334) (-360.896) [-359.318] (-361.498) * (-359.937) (-357.305) [-358.978] (-358.939) -- 0:00:34
498500 -- (-358.180) [-358.913] (-360.329) (-359.389) * (-360.027) [-360.865] (-360.557) (-358.052) -- 0:00:34
499000 -- (-356.820) (-359.422) (-358.107) [-357.490] * (-358.864) (-358.791) (-357.192) [-357.882] -- 0:00:34
499500 -- (-358.172) [-359.259] (-358.739) (-359.016) * (-358.230) (-357.728) [-360.059] (-358.920) -- 0:00:34
500000 -- (-357.819) (-358.389) (-359.717) [-356.553] * (-357.130) (-363.112) (-358.337) [-361.209] -- 0:00:34
Average standard deviation of split frequencies: 0.010710
500500 -- (-358.321) (-357.893) [-357.395] (-359.518) * (-360.628) [-357.674] (-358.731) (-359.085) -- 0:00:33
501000 -- (-359.224) (-357.762) (-358.903) [-357.864] * [-360.749] (-357.853) (-357.710) (-361.872) -- 0:00:33
501500 -- (-360.302) (-356.994) [-357.176] (-359.177) * (-356.453) (-359.600) (-357.352) [-360.303] -- 0:00:33
502000 -- (-357.364) (-360.892) (-358.749) [-358.171] * (-358.271) [-358.837] (-361.584) (-358.478) -- 0:00:33
502500 -- (-357.169) [-357.965] (-361.283) (-361.206) * (-357.395) (-359.455) [-359.644] (-358.114) -- 0:00:33
503000 -- [-361.528] (-358.068) (-360.626) (-358.104) * (-357.416) (-358.579) (-358.965) [-362.602] -- 0:00:33
503500 -- (-359.100) [-357.679] (-361.377) (-358.241) * (-359.617) (-358.043) [-360.250] (-360.597) -- 0:00:33
504000 -- (-359.795) [-360.270] (-359.116) (-357.246) * (-359.759) (-357.332) [-360.024] (-358.599) -- 0:00:33
504500 -- (-357.961) (-362.169) [-357.375] (-357.612) * (-359.038) [-357.675] (-364.267) (-356.886) -- 0:00:33
505000 -- (-358.209) [-358.613] (-357.009) (-358.330) * (-358.335) (-358.916) [-356.654] (-360.067) -- 0:00:33
Average standard deviation of split frequencies: 0.010522
505500 -- (-357.458) (-358.005) (-359.220) [-359.137] * (-361.569) (-358.362) (-357.507) [-361.031] -- 0:00:33
506000 -- [-357.847] (-357.653) (-359.536) (-358.935) * (-359.361) [-359.205] (-357.338) (-362.085) -- 0:00:33
506500 -- (-359.446) [-359.562] (-360.487) (-363.524) * (-358.260) (-360.695) (-362.413) [-356.389] -- 0:00:33
507000 -- (-359.663) (-359.339) (-363.233) [-357.169] * [-357.891] (-360.006) (-358.412) (-358.608) -- 0:00:33
507500 -- (-362.238) [-358.829] (-362.095) (-357.049) * (-362.605) [-358.838] (-358.381) (-361.685) -- 0:00:32
508000 -- (-359.710) (-359.357) [-360.212] (-356.596) * (-359.204) (-372.036) (-358.950) [-360.316] -- 0:00:32
508500 -- (-358.879) [-360.331] (-358.333) (-356.749) * (-357.703) [-359.170] (-359.404) (-362.081) -- 0:00:32
509000 -- (-359.788) (-358.196) (-359.253) [-356.804] * (-357.516) [-358.907] (-357.624) (-361.705) -- 0:00:32
509500 -- (-359.568) [-357.561] (-360.887) (-361.067) * (-359.183) (-360.884) [-357.403] (-360.618) -- 0:00:32
510000 -- (-359.645) (-357.183) (-357.696) [-359.602] * [-358.940] (-356.825) (-357.409) (-359.024) -- 0:00:32
Average standard deviation of split frequencies: 0.010209
510500 -- (-361.318) (-358.948) (-360.156) [-357.605] * (-357.565) [-356.821] (-357.557) (-360.865) -- 0:00:32
511000 -- (-358.189) (-358.262) [-357.411] (-361.724) * [-357.578] (-362.738) (-357.247) (-357.347) -- 0:00:32
511500 -- [-357.899] (-362.743) (-361.141) (-357.172) * [-357.562] (-359.672) (-360.384) (-357.037) -- 0:00:32
512000 -- (-358.745) (-363.521) [-357.073] (-358.829) * (-359.337) (-357.231) [-358.681] (-358.221) -- 0:00:32
512500 -- (-357.958) (-356.546) [-358.232] (-359.047) * (-357.305) (-358.179) [-357.871] (-357.484) -- 0:00:32
513000 -- [-358.687] (-359.854) (-358.553) (-359.321) * (-358.747) [-356.650] (-360.038) (-356.992) -- 0:00:33
513500 -- [-359.317] (-358.217) (-360.156) (-358.833) * (-358.773) [-362.084] (-359.095) (-358.008) -- 0:00:33
514000 -- (-358.061) [-359.111] (-361.421) (-358.676) * [-358.368] (-359.892) (-357.337) (-357.182) -- 0:00:33
514500 -- (-358.741) [-359.677] (-360.178) (-357.910) * (-358.736) (-361.582) [-358.505] (-357.456) -- 0:00:33
515000 -- (-361.662) (-359.199) (-360.184) [-356.887] * [-358.485] (-362.086) (-360.141) (-357.205) -- 0:00:32
Average standard deviation of split frequencies: 0.009834
515500 -- (-361.391) (-359.760) [-356.662] (-357.316) * [-359.939] (-361.494) (-361.963) (-358.949) -- 0:00:32
516000 -- (-363.053) (-358.918) [-358.277] (-356.848) * [-357.505] (-358.467) (-359.474) (-357.671) -- 0:00:32
516500 -- (-359.461) (-362.353) (-360.417) [-360.253] * (-358.572) [-357.979] (-358.859) (-357.343) -- 0:00:32
517000 -- (-358.230) (-360.666) [-360.397] (-358.286) * (-358.170) (-358.619) [-359.989] (-359.233) -- 0:00:32
517500 -- (-359.747) [-357.619] (-359.797) (-361.221) * (-359.192) (-361.153) (-357.940) [-357.280] -- 0:00:32
518000 -- (-358.431) (-357.663) [-359.340] (-360.197) * (-361.247) (-361.284) [-357.947] (-362.830) -- 0:00:32
518500 -- (-359.632) (-358.674) [-359.651] (-360.225) * [-358.801] (-358.448) (-361.404) (-361.089) -- 0:00:32
519000 -- (-357.738) [-358.209] (-358.272) (-358.389) * (-358.468) (-361.212) (-358.008) [-362.432] -- 0:00:32
519500 -- (-358.854) (-358.478) [-358.985] (-361.328) * (-357.084) [-361.117] (-357.462) (-365.392) -- 0:00:32
520000 -- (-356.669) [-358.040] (-359.769) (-359.443) * (-356.998) (-359.913) (-359.821) [-364.305] -- 0:00:32
Average standard deviation of split frequencies: 0.009906
520500 -- (-358.324) [-358.915] (-357.369) (-358.650) * (-356.597) (-359.577) [-358.742] (-362.443) -- 0:00:32
521000 -- (-360.575) (-358.006) [-356.864] (-356.905) * (-359.457) [-358.233] (-358.721) (-359.770) -- 0:00:32
521500 -- (-358.653) [-356.777] (-358.778) (-358.795) * [-357.744] (-356.850) (-359.561) (-356.952) -- 0:00:32
522000 -- (-357.515) [-358.164] (-358.619) (-359.317) * (-358.890) [-357.247] (-358.344) (-360.554) -- 0:00:32
522500 -- [-358.162] (-357.096) (-357.917) (-361.620) * [-359.690] (-357.394) (-360.614) (-358.669) -- 0:00:31
523000 -- (-358.729) (-358.527) (-357.181) [-357.322] * (-357.385) [-358.762] (-358.346) (-359.151) -- 0:00:31
523500 -- [-359.363] (-357.233) (-360.619) (-358.394) * (-361.855) (-358.726) [-360.457] (-357.713) -- 0:00:31
524000 -- (-357.885) (-359.957) (-360.365) [-359.037] * (-360.993) [-359.012] (-357.867) (-357.946) -- 0:00:31
524500 -- (-356.718) (-362.806) (-357.901) [-358.509] * (-359.196) [-357.198] (-357.010) (-357.745) -- 0:00:31
525000 -- [-357.695] (-362.052) (-359.016) (-360.944) * (-358.761) (-358.635) [-359.863] (-357.631) -- 0:00:31
Average standard deviation of split frequencies: 0.010605
525500 -- (-357.139) (-357.772) [-358.790] (-358.250) * (-359.080) (-356.984) (-360.315) [-358.357] -- 0:00:31
526000 -- (-358.363) [-358.268] (-360.556) (-358.040) * [-359.646] (-357.935) (-357.289) (-359.609) -- 0:00:31
526500 -- (-357.545) [-359.656] (-360.428) (-356.843) * (-358.705) [-359.882] (-359.733) (-359.481) -- 0:00:31
527000 -- (-357.624) [-358.809] (-358.199) (-358.462) * (-359.053) [-357.054] (-361.870) (-357.167) -- 0:00:31
527500 -- (-358.846) (-359.402) (-357.662) [-357.994] * (-357.716) (-357.653) (-361.758) [-357.433] -- 0:00:31
528000 -- [-358.912] (-361.594) (-361.630) (-358.155) * [-360.029] (-358.726) (-357.709) (-361.502) -- 0:00:31
528500 -- (-357.596) (-361.336) [-357.747] (-356.801) * [-358.338] (-359.962) (-360.225) (-358.811) -- 0:00:31
529000 -- (-357.819) (-360.590) [-356.822] (-358.878) * (-360.232) (-358.875) (-366.323) [-358.405] -- 0:00:31
529500 -- (-363.090) (-358.601) (-356.836) [-359.421] * (-360.997) [-356.807] (-364.300) (-361.341) -- 0:00:31
530000 -- (-361.725) (-360.364) [-358.405] (-360.000) * (-358.289) (-359.407) (-360.755) [-359.188] -- 0:00:31
Average standard deviation of split frequencies: 0.010956
530500 -- (-359.712) (-358.317) (-358.733) [-358.029] * (-358.061) [-357.275] (-361.840) (-357.111) -- 0:00:31
531000 -- (-358.047) [-359.746] (-360.022) (-358.759) * (-362.008) (-357.062) [-358.604] (-357.651) -- 0:00:31
531500 -- (-360.322) [-357.083] (-358.251) (-360.928) * (-359.762) [-356.961] (-361.298) (-356.968) -- 0:00:31
532000 -- [-359.221] (-359.074) (-359.763) (-360.303) * (-359.575) (-357.399) [-359.302] (-358.430) -- 0:00:31
532500 -- (-358.196) (-358.182) (-358.383) [-359.859] * (-356.685) (-359.355) [-356.824] (-357.584) -- 0:00:31
533000 -- (-358.714) [-360.190] (-359.449) (-356.631) * (-360.215) (-357.455) [-356.698] (-357.776) -- 0:00:31
533500 -- (-362.994) (-358.432) (-357.409) [-359.415] * (-362.863) [-356.783] (-363.483) (-358.543) -- 0:00:31
534000 -- (-357.051) (-358.726) (-357.407) [-358.491] * (-357.565) (-357.054) [-360.269] (-357.807) -- 0:00:31
534500 -- (-357.099) [-357.257] (-359.356) (-359.548) * (-360.933) [-360.382] (-358.444) (-359.661) -- 0:00:31
535000 -- [-356.602] (-356.919) (-360.685) (-358.281) * [-357.851] (-358.034) (-357.756) (-361.400) -- 0:00:31
Average standard deviation of split frequencies: 0.010749
535500 -- [-357.989] (-357.220) (-359.830) (-358.113) * (-358.563) [-356.881] (-359.177) (-358.454) -- 0:00:31
536000 -- [-359.482] (-357.287) (-357.835) (-359.964) * (-358.495) [-360.483] (-357.835) (-359.087) -- 0:00:31
536500 -- (-358.650) [-357.310] (-361.790) (-361.224) * (-364.273) (-359.131) [-357.777] (-358.654) -- 0:00:31
537000 -- (-358.570) (-356.451) (-357.908) [-359.973] * (-359.907) (-360.899) [-357.130] (-361.878) -- 0:00:31
537500 -- (-357.926) [-363.999] (-357.118) (-358.822) * [-358.563] (-358.858) (-359.657) (-357.725) -- 0:00:30
538000 -- (-357.159) (-362.859) (-358.866) [-359.181] * (-357.403) (-359.361) [-359.446] (-359.464) -- 0:00:30
538500 -- (-362.373) [-360.263] (-359.584) (-363.878) * [-357.544] (-361.166) (-358.887) (-360.587) -- 0:00:30
539000 -- [-357.979] (-359.369) (-361.883) (-363.641) * [-357.565] (-358.000) (-359.356) (-358.181) -- 0:00:30
539500 -- (-358.156) (-358.145) (-363.273) [-358.610] * (-356.995) [-358.226] (-357.815) (-360.035) -- 0:00:30
540000 -- (-357.565) [-359.972] (-361.279) (-356.582) * (-359.987) (-357.553) [-358.487] (-357.790) -- 0:00:30
Average standard deviation of split frequencies: 0.010511
540500 -- (-357.230) (-357.213) (-358.757) [-359.042] * (-357.557) [-358.658] (-361.277) (-359.496) -- 0:00:30
541000 -- (-357.927) (-356.930) [-359.306] (-360.550) * (-358.468) (-356.996) [-360.857] (-358.818) -- 0:00:30
541500 -- (-357.863) (-358.498) [-365.041] (-358.455) * (-361.179) (-357.455) [-357.867] (-361.783) -- 0:00:30
542000 -- (-359.108) (-359.064) (-360.347) [-356.915] * (-364.276) [-357.129] (-357.942) (-360.182) -- 0:00:30
542500 -- [-359.246] (-360.889) (-360.946) (-358.141) * (-357.814) (-357.941) [-358.586] (-358.366) -- 0:00:30
543000 -- [-360.525] (-359.387) (-361.985) (-359.261) * (-357.299) [-358.717] (-358.666) (-356.786) -- 0:00:30
543500 -- (-357.131) (-358.319) (-364.583) [-360.571] * (-358.001) [-360.221] (-359.355) (-357.798) -- 0:00:30
544000 -- (-357.705) (-360.535) [-358.622] (-358.482) * (-359.639) (-357.732) [-356.743] (-357.602) -- 0:00:31
544500 -- (-357.444) (-360.399) [-357.013] (-357.384) * (-357.858) [-358.899] (-360.953) (-359.777) -- 0:00:30
545000 -- (-358.966) (-361.553) [-357.378] (-360.947) * (-359.481) [-356.739] (-357.718) (-358.039) -- 0:00:30
Average standard deviation of split frequencies: 0.010504
545500 -- (-358.871) (-359.762) [-360.366] (-358.344) * (-361.117) (-359.415) (-358.438) [-358.117] -- 0:00:30
546000 -- (-358.319) (-358.254) [-357.697] (-360.696) * (-357.427) (-357.259) (-359.341) [-358.717] -- 0:00:30
546500 -- (-358.634) (-360.037) (-358.374) [-359.188] * [-358.116] (-360.340) (-357.998) (-357.019) -- 0:00:30
547000 -- (-356.492) (-357.837) [-359.495] (-357.245) * [-357.836] (-357.724) (-359.370) (-358.823) -- 0:00:30
547500 -- [-356.858] (-362.120) (-358.468) (-357.315) * (-356.743) (-357.625) (-358.783) [-358.601] -- 0:00:30
548000 -- (-356.660) (-364.504) (-359.517) [-358.087] * (-360.356) [-357.963] (-359.276) (-356.803) -- 0:00:30
548500 -- (-357.649) (-362.198) (-358.434) [-359.848] * [-358.258] (-356.691) (-361.563) (-358.567) -- 0:00:30
549000 -- [-357.697] (-365.936) (-358.955) (-358.963) * (-357.961) (-357.998) [-357.847] (-357.210) -- 0:00:30
549500 -- (-360.225) [-359.844] (-356.452) (-357.703) * (-362.891) (-357.692) (-357.453) [-359.408] -- 0:00:30
550000 -- (-356.897) (-357.873) [-356.755] (-359.861) * (-359.345) [-356.833] (-359.629) (-358.325) -- 0:00:30
Average standard deviation of split frequencies: 0.009512
550500 -- (-357.296) [-357.346] (-362.698) (-359.419) * (-361.047) (-358.625) [-359.208] (-359.643) -- 0:00:30
551000 -- (-359.526) [-359.811] (-362.715) (-359.435) * (-359.993) [-358.863] (-358.496) (-360.913) -- 0:00:30
551500 -- (-358.281) (-365.480) [-359.103] (-357.023) * [-359.691] (-361.158) (-358.943) (-358.584) -- 0:00:30
552000 -- (-358.262) (-360.376) [-357.600] (-358.206) * (-359.744) (-360.690) [-357.481] (-360.744) -- 0:00:30
552500 -- (-360.231) (-359.369) (-359.815) [-358.469] * (-364.440) (-358.226) [-358.984] (-359.008) -- 0:00:29
553000 -- (-358.062) [-358.706] (-357.373) (-356.923) * (-356.292) [-357.077] (-361.154) (-362.110) -- 0:00:29
553500 -- (-357.467) [-358.706] (-359.847) (-357.853) * (-358.910) (-358.574) [-356.814] (-363.634) -- 0:00:29
554000 -- [-357.632] (-357.114) (-358.141) (-358.805) * (-358.404) [-361.936] (-356.819) (-363.029) -- 0:00:29
554500 -- (-360.984) (-356.957) (-358.400) [-362.922] * (-358.112) (-359.391) (-357.465) [-358.848] -- 0:00:29
555000 -- (-359.848) [-359.236] (-365.816) (-357.015) * [-357.809] (-364.136) (-357.209) (-361.211) -- 0:00:29
Average standard deviation of split frequencies: 0.009426
555500 -- (-357.595) (-358.482) [-361.958] (-356.712) * [-357.860] (-361.629) (-366.846) (-357.382) -- 0:00:29
556000 -- (-357.794) (-359.228) (-362.885) [-360.455] * (-357.812) [-357.742] (-365.334) (-357.705) -- 0:00:29
556500 -- (-357.075) (-359.145) [-357.098] (-364.886) * (-358.107) (-361.039) (-360.532) [-360.318] -- 0:00:29
557000 -- (-356.707) (-357.647) [-359.035] (-359.368) * [-357.256] (-362.832) (-362.847) (-359.487) -- 0:00:29
557500 -- (-356.489) [-358.151] (-359.609) (-358.624) * (-357.642) (-361.216) (-365.419) [-358.733] -- 0:00:29
558000 -- [-357.191] (-358.318) (-357.975) (-360.515) * [-357.724] (-363.524) (-358.937) (-361.118) -- 0:00:29
558500 -- [-359.288] (-357.013) (-356.397) (-360.323) * (-357.976) (-360.589) (-359.401) [-358.226] -- 0:00:29
559000 -- (-358.331) (-358.773) (-357.437) [-358.850] * (-356.966) (-357.294) [-357.306] (-357.645) -- 0:00:29
559500 -- (-357.984) [-360.465] (-357.777) (-360.946) * [-360.359] (-360.284) (-357.945) (-361.613) -- 0:00:29
560000 -- (-360.729) [-358.668] (-357.011) (-363.539) * (-359.744) (-360.811) (-362.165) [-356.993] -- 0:00:29
Average standard deviation of split frequencies: 0.008952
560500 -- (-358.875) (-358.205) (-357.972) [-357.921] * (-358.146) [-359.513] (-360.503) (-362.821) -- 0:00:29
561000 -- (-356.939) (-359.874) [-359.060] (-360.257) * [-357.168] (-356.774) (-358.144) (-362.029) -- 0:00:29
561500 -- (-357.892) (-362.278) (-360.983) [-357.283] * (-358.982) (-358.632) [-359.305] (-356.953) -- 0:00:29
562000 -- (-356.940) (-358.559) (-357.680) [-358.617] * [-358.858] (-357.968) (-356.569) (-360.391) -- 0:00:29
562500 -- [-361.653] (-361.350) (-358.833) (-357.338) * (-360.838) [-357.326] (-360.201) (-360.370) -- 0:00:29
563000 -- (-362.182) [-358.443] (-357.589) (-360.953) * (-359.589) (-356.700) (-361.124) [-358.668] -- 0:00:29
563500 -- (-360.037) (-359.503) (-357.305) [-360.471] * [-359.766] (-361.554) (-358.006) (-362.059) -- 0:00:29
564000 -- [-363.377] (-358.879) (-361.568) (-360.062) * (-361.954) [-357.516] (-358.766) (-365.836) -- 0:00:29
564500 -- [-356.655] (-357.482) (-359.425) (-359.887) * (-362.144) [-357.649] (-358.188) (-358.907) -- 0:00:29
565000 -- (-356.963) [-358.743] (-359.713) (-361.105) * (-358.223) [-357.670] (-356.700) (-358.643) -- 0:00:29
Average standard deviation of split frequencies: 0.009300
565500 -- [-357.089] (-359.154) (-358.916) (-359.129) * (-364.690) (-361.665) [-357.200] (-362.910) -- 0:00:29
566000 -- (-358.568) [-360.919] (-358.852) (-357.167) * (-360.852) (-356.945) [-357.023] (-359.025) -- 0:00:29
566500 -- [-359.258] (-357.135) (-357.248) (-359.628) * (-360.360) [-358.893] (-356.895) (-358.319) -- 0:00:29
567000 -- (-359.156) (-358.316) [-358.182] (-358.915) * (-361.334) (-362.313) [-357.360] (-362.795) -- 0:00:29
567500 -- (-358.994) (-358.739) [-358.796] (-363.575) * [-358.978] (-363.694) (-358.859) (-361.863) -- 0:00:28
568000 -- (-360.823) (-357.303) [-358.013] (-358.475) * (-358.092) (-361.909) [-361.144] (-358.488) -- 0:00:28
568500 -- (-358.337) (-359.087) (-358.172) [-358.475] * (-358.851) [-359.258] (-359.808) (-357.801) -- 0:00:28
569000 -- [-359.329] (-362.055) (-359.104) (-357.102) * (-356.949) (-357.331) (-358.377) [-358.556] -- 0:00:28
569500 -- [-358.844] (-357.296) (-357.916) (-357.152) * [-364.636] (-362.569) (-357.294) (-359.139) -- 0:00:28
570000 -- (-362.910) (-359.118) (-359.404) [-361.565] * (-358.349) [-359.679] (-359.323) (-362.067) -- 0:00:28
Average standard deviation of split frequencies: 0.009959
570500 -- (-359.442) (-359.314) (-356.985) [-357.987] * (-358.985) (-358.535) (-357.364) [-358.817] -- 0:00:28
571000 -- (-357.722) [-358.581] (-358.175) (-358.984) * (-359.928) [-359.820] (-357.617) (-363.644) -- 0:00:28
571500 -- (-356.924) [-357.629] (-358.341) (-357.922) * [-359.447] (-361.711) (-360.245) (-360.126) -- 0:00:28
572000 -- (-360.771) [-360.749] (-358.520) (-362.698) * (-357.239) (-360.140) (-359.929) [-357.856] -- 0:00:28
572500 -- (-357.138) [-357.667] (-362.147) (-358.716) * (-359.919) (-358.029) (-361.592) [-357.934] -- 0:00:28
573000 -- [-358.351] (-357.737) (-357.740) (-358.696) * (-358.811) (-361.518) (-358.309) [-363.480] -- 0:00:28
573500 -- [-358.019] (-357.463) (-359.882) (-359.003) * (-359.039) (-359.797) (-359.065) [-356.866] -- 0:00:28
574000 -- (-360.735) [-357.630] (-356.530) (-359.126) * [-358.318] (-359.266) (-357.979) (-359.033) -- 0:00:28
574500 -- (-359.911) (-358.117) [-358.821] (-358.831) * (-357.073) [-358.810] (-360.053) (-358.057) -- 0:00:28
575000 -- (-358.805) [-358.619] (-359.571) (-359.854) * [-358.454] (-356.513) (-361.982) (-358.351) -- 0:00:28
Average standard deviation of split frequencies: 0.009821
575500 -- (-358.771) [-357.049] (-356.604) (-361.934) * [-357.632] (-365.811) (-365.328) (-357.911) -- 0:00:28
576000 -- (-357.770) [-361.374] (-357.693) (-362.711) * (-357.968) (-359.485) (-362.162) [-358.785] -- 0:00:27
576500 -- (-358.097) (-357.192) (-360.868) [-357.193] * (-363.089) [-359.199] (-357.836) (-356.955) -- 0:00:28
577000 -- (-358.097) (-361.009) (-358.324) [-357.314] * (-363.791) [-359.140] (-360.066) (-357.753) -- 0:00:28
577500 -- (-358.670) [-357.321] (-356.459) (-357.450) * [-361.511] (-359.133) (-357.781) (-360.262) -- 0:00:28
578000 -- (-356.535) (-361.464) (-357.470) [-359.036] * [-357.575] (-359.004) (-359.728) (-357.819) -- 0:00:28
578500 -- (-358.581) [-359.975] (-357.826) (-357.146) * (-359.402) [-359.729] (-357.375) (-357.323) -- 0:00:28
579000 -- (-358.495) (-358.064) (-357.041) [-357.883] * (-356.949) (-357.754) [-360.614] (-362.467) -- 0:00:28
579500 -- (-356.880) (-357.274) (-358.136) [-358.002] * (-358.096) [-358.529] (-360.006) (-359.818) -- 0:00:28
580000 -- (-357.769) [-359.525] (-356.893) (-357.064) * (-361.977) (-358.510) (-358.492) [-362.109] -- 0:00:28
Average standard deviation of split frequencies: 0.009652
580500 -- (-356.707) (-359.946) (-362.476) [-358.326] * (-359.622) (-359.108) [-359.443] (-361.469) -- 0:00:28
581000 -- (-361.661) (-359.893) (-357.241) [-358.942] * [-359.780] (-360.010) (-357.361) (-358.825) -- 0:00:28
581500 -- [-358.399] (-359.329) (-358.810) (-360.505) * (-359.402) (-359.140) [-357.049] (-360.687) -- 0:00:28
582000 -- (-357.408) (-361.128) [-361.102] (-359.306) * [-359.035] (-359.660) (-358.332) (-360.055) -- 0:00:28
582500 -- (-360.521) (-359.402) (-358.628) [-361.270] * [-360.167] (-358.266) (-361.093) (-357.326) -- 0:00:27
583000 -- (-363.529) (-358.271) (-358.599) [-358.574] * (-359.256) (-359.988) [-360.537] (-356.932) -- 0:00:27
583500 -- [-360.143] (-357.061) (-360.837) (-356.542) * (-356.881) (-361.086) (-360.074) [-356.938] -- 0:00:27
584000 -- (-359.172) (-357.090) [-361.175] (-356.789) * [-361.531] (-359.805) (-358.799) (-359.449) -- 0:00:27
584500 -- (-359.447) (-360.164) [-358.450] (-357.321) * (-363.253) (-358.968) [-359.782] (-360.362) -- 0:00:27
585000 -- (-363.191) (-358.189) (-357.721) [-356.825] * (-360.768) (-359.622) [-357.430] (-361.097) -- 0:00:27
Average standard deviation of split frequencies: 0.009117
585500 -- (-359.832) (-358.949) (-358.122) [-356.579] * (-357.769) (-360.367) (-357.461) [-360.178] -- 0:00:27
586000 -- (-359.013) (-359.391) [-358.782] (-359.996) * (-359.514) [-358.477] (-358.040) (-358.749) -- 0:00:27
586500 -- (-359.159) [-358.105] (-357.074) (-363.233) * (-359.339) (-356.715) [-357.238] (-362.544) -- 0:00:27
587000 -- (-357.412) (-356.880) (-359.331) [-363.131] * (-361.401) [-360.008] (-357.146) (-359.928) -- 0:00:27
587500 -- [-359.627] (-359.066) (-361.901) (-357.899) * (-358.682) [-359.167] (-358.200) (-359.457) -- 0:00:27
588000 -- (-356.741) (-359.242) (-361.894) [-360.307] * (-366.166) (-358.304) (-362.663) [-357.902] -- 0:00:27
588500 -- [-359.112] (-356.997) (-359.381) (-358.594) * (-362.450) [-356.803] (-358.338) (-358.532) -- 0:00:27
589000 -- (-358.608) (-358.396) (-358.321) [-356.592] * (-356.501) (-359.907) (-356.743) [-356.755] -- 0:00:27
589500 -- (-360.201) (-361.166) (-360.851) [-358.284] * [-359.051] (-357.491) (-356.728) (-357.755) -- 0:00:27
590000 -- [-359.112] (-360.671) (-360.828) (-357.809) * (-356.809) (-360.339) (-360.645) [-358.568] -- 0:00:27
Average standard deviation of split frequencies: 0.008912
590500 -- (-358.770) (-358.342) [-358.445] (-357.457) * (-363.053) [-358.388] (-359.855) (-357.198) -- 0:00:27
591000 -- (-357.730) (-359.036) [-358.167] (-357.728) * (-360.072) [-356.338] (-357.308) (-359.332) -- 0:00:26
591500 -- (-357.746) [-359.265] (-359.020) (-359.024) * [-358.262] (-359.143) (-361.323) (-357.886) -- 0:00:26
592000 -- [-359.160] (-363.549) (-359.579) (-359.888) * (-356.977) (-358.090) (-360.091) [-358.531] -- 0:00:26
592500 -- (-359.178) (-363.065) (-360.136) [-359.053] * (-360.694) [-361.383] (-358.769) (-359.236) -- 0:00:26
593000 -- (-358.222) (-358.569) (-358.643) [-359.131] * (-357.399) (-360.369) [-361.255] (-357.940) -- 0:00:26
593500 -- [-360.974] (-356.939) (-357.355) (-358.951) * (-357.271) [-359.785] (-361.381) (-357.480) -- 0:00:27
594000 -- (-358.044) [-356.552] (-357.579) (-357.899) * (-358.602) (-357.403) [-358.954] (-361.881) -- 0:00:27
594500 -- (-358.637) (-357.885) [-361.377] (-361.852) * (-361.274) [-356.783] (-359.185) (-361.857) -- 0:00:27
595000 -- (-359.648) (-359.024) (-364.535) [-358.140] * (-363.166) [-358.765] (-359.300) (-364.841) -- 0:00:27
Average standard deviation of split frequencies: 0.008525
595500 -- (-359.242) (-359.478) [-359.121] (-362.453) * (-357.984) [-358.261] (-357.380) (-360.104) -- 0:00:27
596000 -- (-359.480) (-357.530) [-356.994] (-357.904) * [-358.325] (-357.923) (-357.976) (-359.502) -- 0:00:27
596500 -- (-357.594) (-362.267) [-357.200] (-358.369) * (-357.471) (-357.998) [-360.054] (-358.592) -- 0:00:27
597000 -- (-360.588) (-360.983) [-359.055] (-357.498) * (-359.911) (-360.829) [-359.752] (-357.695) -- 0:00:27
597500 -- (-359.154) [-356.726] (-358.069) (-358.404) * (-359.832) [-356.949] (-359.576) (-359.893) -- 0:00:26
598000 -- (-360.716) [-357.130] (-358.665) (-358.641) * [-360.641] (-359.823) (-360.713) (-359.698) -- 0:00:26
598500 -- [-357.412] (-358.708) (-360.679) (-359.142) * [-360.517] (-362.567) (-364.040) (-361.305) -- 0:00:26
599000 -- (-357.346) (-360.732) [-358.860] (-361.129) * [-359.677] (-359.225) (-359.419) (-361.519) -- 0:00:26
599500 -- (-358.159) [-360.851] (-357.939) (-358.372) * (-364.061) (-357.830) [-357.877] (-359.157) -- 0:00:26
600000 -- (-359.037) (-356.892) [-360.044] (-359.022) * [-358.041] (-357.547) (-357.686) (-357.479) -- 0:00:26
Average standard deviation of split frequencies: 0.007848
600500 -- (-357.736) (-356.671) (-359.294) [-369.916] * (-357.662) (-360.411) (-361.999) [-359.881] -- 0:00:26
601000 -- [-361.157] (-359.905) (-361.255) (-360.714) * (-360.950) (-357.258) (-358.904) [-358.410] -- 0:00:26
601500 -- (-366.285) [-356.753] (-357.370) (-361.357) * (-364.939) (-358.024) (-359.799) [-361.134] -- 0:00:26
602000 -- (-358.237) (-359.759) (-358.180) [-358.692] * [-359.124] (-358.472) (-358.522) (-358.206) -- 0:00:26
602500 -- (-358.864) (-362.952) [-356.504] (-358.305) * [-357.695] (-360.495) (-358.570) (-356.929) -- 0:00:26
603000 -- (-357.706) (-363.218) [-357.097] (-358.848) * (-357.972) (-359.079) (-359.760) [-360.637] -- 0:00:26
603500 -- [-361.093] (-360.081) (-357.902) (-356.670) * (-359.684) [-357.793] (-358.437) (-359.270) -- 0:00:26
604000 -- (-358.499) (-361.374) [-356.972] (-357.266) * (-358.927) (-357.309) [-356.725] (-356.961) -- 0:00:26
604500 -- (-358.277) (-359.117) (-361.888) [-357.740] * (-365.265) (-359.498) [-358.754] (-357.755) -- 0:00:26
605000 -- (-357.539) [-358.704] (-360.266) (-358.963) * (-363.407) [-357.379] (-358.245) (-356.507) -- 0:00:26
Average standard deviation of split frequencies: 0.008686
605500 -- [-357.274] (-359.311) (-359.114) (-359.916) * (-361.757) [-358.055] (-358.310) (-359.308) -- 0:00:26
606000 -- (-357.122) (-359.160) [-362.623] (-361.401) * (-359.743) (-357.514) [-357.415] (-358.519) -- 0:00:26
606500 -- (-362.759) (-363.952) [-360.693] (-359.218) * (-358.872) (-356.304) [-359.649] (-358.215) -- 0:00:25
607000 -- (-360.827) (-360.255) [-357.034] (-357.377) * (-360.175) [-356.983] (-363.473) (-359.516) -- 0:00:25
607500 -- (-358.130) (-361.134) (-357.026) [-359.312] * (-358.780) [-359.324] (-357.688) (-362.338) -- 0:00:25
608000 -- [-358.281] (-361.862) (-359.988) (-358.191) * (-361.875) [-357.201] (-356.942) (-362.266) -- 0:00:25
608500 -- [-358.125] (-359.566) (-362.295) (-359.940) * (-360.726) (-358.114) [-358.151] (-357.047) -- 0:00:25
609000 -- (-358.683) [-358.523] (-361.436) (-358.603) * (-357.397) (-362.061) [-357.048] (-360.850) -- 0:00:25
609500 -- (-357.874) (-360.145) [-357.069] (-357.682) * (-360.354) (-363.822) [-358.578] (-359.482) -- 0:00:25
610000 -- [-365.654] (-360.011) (-357.870) (-359.591) * (-358.188) (-366.265) [-361.505] (-358.403) -- 0:00:25
Average standard deviation of split frequencies: 0.008920
610500 -- (-359.469) (-361.446) (-357.683) [-357.803] * [-361.105] (-358.561) (-358.230) (-357.481) -- 0:00:26
611000 -- (-364.162) [-358.043] (-358.283) (-362.101) * (-363.032) (-361.208) [-358.029] (-359.970) -- 0:00:26
611500 -- (-359.772) (-358.971) (-358.827) [-359.851] * (-361.472) (-359.081) [-360.154] (-363.147) -- 0:00:26
612000 -- (-358.354) (-360.865) (-361.006) [-360.997] * (-360.411) (-359.878) [-360.335] (-360.162) -- 0:00:25
612500 -- (-357.248) (-356.977) (-358.543) [-358.142] * (-362.316) (-356.873) (-360.801) [-357.369] -- 0:00:25
613000 -- (-358.470) (-358.472) [-357.909] (-360.678) * (-359.168) [-359.767] (-357.342) (-360.681) -- 0:00:25
613500 -- (-357.195) [-359.632] (-357.359) (-359.623) * (-357.551) [-358.507] (-358.498) (-360.938) -- 0:00:25
614000 -- (-358.855) [-359.089] (-357.497) (-362.534) * (-359.136) (-357.249) [-359.867] (-358.636) -- 0:00:25
614500 -- (-358.098) [-356.366] (-357.767) (-361.291) * [-357.915] (-357.778) (-359.858) (-358.811) -- 0:00:25
615000 -- (-357.732) (-359.037) [-357.784] (-363.060) * (-358.340) (-359.999) (-356.775) [-359.499] -- 0:00:25
Average standard deviation of split frequencies: 0.008801
615500 -- (-357.736) (-358.483) (-358.632) [-363.506] * (-360.742) (-359.264) [-359.813] (-362.216) -- 0:00:25
616000 -- (-359.537) (-358.018) (-358.318) [-357.760] * (-358.507) (-358.177) [-360.871] (-358.102) -- 0:00:25
616500 -- (-356.854) [-359.101] (-360.435) (-358.169) * (-360.318) (-357.813) [-360.984] (-361.770) -- 0:00:25
617000 -- (-358.458) (-357.447) (-357.855) [-358.838] * (-359.082) [-358.040] (-358.747) (-359.146) -- 0:00:25
617500 -- (-360.069) [-358.170] (-358.475) (-359.339) * (-356.946) [-358.537] (-357.745) (-359.988) -- 0:00:25
618000 -- (-359.919) (-361.484) (-360.516) [-357.462] * (-358.607) [-358.772] (-356.724) (-362.685) -- 0:00:25
618500 -- (-359.464) [-359.386] (-359.229) (-357.677) * (-357.616) (-360.112) [-359.301] (-359.953) -- 0:00:25
619000 -- (-364.429) (-356.797) (-360.381) [-358.295] * (-358.068) (-363.661) (-358.356) [-361.382] -- 0:00:25
619500 -- [-358.347] (-358.957) (-358.465) (-356.812) * (-359.143) (-360.042) [-358.011] (-362.054) -- 0:00:25
620000 -- (-356.884) (-357.781) (-360.754) [-358.554] * (-358.055) (-360.145) (-359.065) [-363.166] -- 0:00:25
Average standard deviation of split frequencies: 0.008757
620500 -- (-360.446) (-362.788) [-360.649] (-357.359) * [-358.486] (-358.560) (-364.592) (-359.297) -- 0:00:25
621000 -- (-357.536) (-363.655) (-360.022) [-357.430] * (-364.501) [-357.214] (-359.017) (-360.802) -- 0:00:25
621500 -- [-357.904] (-360.243) (-359.399) (-361.160) * [-358.408] (-361.457) (-360.229) (-357.578) -- 0:00:24
622000 -- (-357.999) (-360.323) (-359.146) [-358.290] * (-359.383) [-361.846] (-359.485) (-361.615) -- 0:00:24
622500 -- (-359.072) [-361.006] (-357.301) (-359.148) * (-360.734) (-358.097) (-360.108) [-358.350] -- 0:00:24
623000 -- (-358.619) (-359.192) [-356.801] (-358.716) * (-359.754) [-357.659] (-358.649) (-358.408) -- 0:00:24
623500 -- (-357.466) (-357.334) [-357.782] (-357.962) * (-358.968) (-359.133) (-357.281) [-361.399] -- 0:00:24
624000 -- (-357.762) (-362.865) (-366.311) [-358.805] * (-360.754) (-358.859) [-358.606] (-357.907) -- 0:00:24
624500 -- (-357.314) (-359.396) (-358.457) [-359.351] * (-360.003) (-358.702) [-358.303] (-359.650) -- 0:00:24
625000 -- [-358.501] (-357.202) (-358.897) (-358.289) * (-357.308) (-358.652) (-358.313) [-357.701] -- 0:00:24
Average standard deviation of split frequencies: 0.008785
625500 -- (-361.042) (-360.972) [-359.000] (-362.743) * (-360.115) [-358.400] (-357.737) (-357.370) -- 0:00:24
626000 -- (-358.643) (-357.485) (-356.820) [-359.097] * (-360.045) [-356.957] (-359.152) (-359.690) -- 0:00:24
626500 -- (-360.001) (-358.925) [-358.894] (-358.135) * (-365.419) (-357.867) [-358.457] (-358.273) -- 0:00:24
627000 -- (-358.522) [-357.990] (-363.697) (-362.017) * (-359.299) (-358.363) [-358.097] (-360.163) -- 0:00:24
627500 -- (-358.334) (-359.123) (-358.850) [-360.704] * [-360.563] (-359.207) (-357.013) (-358.401) -- 0:00:24
628000 -- (-357.624) (-356.599) (-358.164) [-360.755] * (-358.142) (-358.981) (-357.859) [-356.649] -- 0:00:24
628500 -- [-358.885] (-360.109) (-359.280) (-361.088) * [-360.332] (-356.599) (-360.584) (-359.285) -- 0:00:24
629000 -- (-361.543) (-362.726) (-357.567) [-357.792] * (-360.635) [-358.686] (-357.689) (-357.462) -- 0:00:24
629500 -- [-358.655] (-356.350) (-362.838) (-359.104) * (-357.431) (-360.355) [-356.806] (-359.752) -- 0:00:24
630000 -- (-359.565) [-357.150] (-360.156) (-360.122) * (-362.498) (-357.253) (-358.952) [-357.953] -- 0:00:24
Average standard deviation of split frequencies: 0.008266
630500 -- (-359.657) (-356.888) [-358.314] (-360.294) * (-360.218) [-359.676] (-359.255) (-357.762) -- 0:00:24
631000 -- (-357.129) [-360.248] (-361.471) (-362.079) * (-362.489) (-357.191) (-366.297) [-360.071] -- 0:00:24
631500 -- (-361.994) (-359.861) [-357.048] (-357.643) * (-358.419) [-358.654] (-358.581) (-357.481) -- 0:00:24
632000 -- (-361.135) (-360.826) [-360.664] (-357.444) * (-361.612) [-357.735] (-360.569) (-360.688) -- 0:00:24
632500 -- (-361.138) (-361.631) [-358.285] (-357.595) * (-358.235) (-358.561) [-358.428] (-363.232) -- 0:00:24
633000 -- [-358.329] (-358.558) (-359.352) (-361.024) * (-357.628) (-358.379) (-358.539) [-360.286] -- 0:00:24
633500 -- (-360.104) (-357.935) [-360.724] (-358.419) * [-356.697] (-357.638) (-358.449) (-361.100) -- 0:00:24
634000 -- (-358.279) [-360.898] (-358.900) (-360.097) * (-358.371) [-358.479] (-356.844) (-362.506) -- 0:00:24
634500 -- (-359.022) (-360.007) (-360.052) [-356.486] * (-361.191) (-357.182) (-358.354) [-358.071] -- 0:00:24
635000 -- (-356.661) (-361.073) (-358.772) [-357.684] * (-357.092) [-358.835] (-363.022) (-357.125) -- 0:00:24
Average standard deviation of split frequencies: 0.008110
635500 -- (-357.886) [-364.128] (-358.475) (-359.684) * (-359.713) (-357.658) (-360.675) [-358.194] -- 0:00:24
636000 -- [-359.721] (-359.956) (-358.509) (-359.501) * (-357.569) (-357.505) [-362.683] (-361.783) -- 0:00:24
636500 -- (-361.125) (-359.117) (-358.120) [-356.663] * (-359.717) (-356.973) [-360.791] (-358.019) -- 0:00:23
637000 -- (-361.838) (-361.150) [-359.335] (-357.118) * (-359.316) (-357.756) (-362.947) [-358.816] -- 0:00:23
637500 -- (-358.635) [-359.066] (-359.932) (-357.065) * [-359.132] (-358.364) (-360.450) (-358.047) -- 0:00:23
638000 -- [-361.910] (-363.444) (-361.560) (-356.753) * [-357.235] (-357.510) (-363.669) (-357.940) -- 0:00:23
638500 -- (-358.344) (-361.388) (-361.771) [-357.060] * (-357.919) (-357.276) [-362.278] (-356.887) -- 0:00:23
639000 -- (-358.327) [-359.678] (-361.246) (-358.967) * [-356.994] (-356.935) (-361.966) (-356.771) -- 0:00:23
639500 -- [-359.740] (-357.224) (-360.070) (-358.248) * (-358.630) [-357.913] (-362.979) (-358.902) -- 0:00:23
640000 -- (-358.817) (-356.461) (-362.861) [-360.384] * [-361.703] (-358.386) (-360.716) (-360.923) -- 0:00:23
Average standard deviation of split frequencies: 0.008216
640500 -- (-362.532) (-358.111) [-362.720] (-358.759) * [-359.138] (-358.443) (-358.826) (-357.330) -- 0:00:23
641000 -- (-365.985) (-357.642) [-361.213] (-359.313) * [-357.267] (-361.600) (-359.431) (-358.528) -- 0:00:23
641500 -- (-361.868) [-357.956] (-357.232) (-361.118) * (-360.773) [-359.240] (-360.349) (-359.428) -- 0:00:23
642000 -- (-362.526) [-357.837] (-360.293) (-357.758) * [-359.672] (-358.989) (-367.638) (-358.275) -- 0:00:23
642500 -- (-359.738) (-357.743) [-356.857] (-359.802) * (-358.262) (-361.138) [-359.638] (-361.894) -- 0:00:23
643000 -- (-358.344) (-357.774) (-357.523) [-358.116] * [-358.942] (-357.612) (-356.478) (-360.067) -- 0:00:23
643500 -- (-360.008) (-357.628) (-357.389) [-356.827] * (-360.029) (-360.002) [-356.774] (-359.622) -- 0:00:23
644000 -- (-358.986) (-358.571) [-358.334] (-357.565) * (-358.960) (-364.512) [-359.080] (-358.701) -- 0:00:23
644500 -- (-359.087) (-357.153) (-360.527) [-358.703] * [-357.405] (-358.906) (-360.507) (-358.340) -- 0:00:23
645000 -- (-360.951) [-358.034] (-361.440) (-359.396) * [-357.825] (-358.040) (-357.652) (-359.189) -- 0:00:23
Average standard deviation of split frequencies: 0.008230
645500 -- (-356.899) (-360.654) (-363.284) [-358.754] * (-358.442) (-357.130) (-356.919) [-360.256] -- 0:00:23
646000 -- (-359.433) (-356.782) [-356.744] (-358.102) * (-363.094) [-359.264] (-361.066) (-361.439) -- 0:00:23
646500 -- (-359.267) (-359.277) (-359.986) [-357.017] * [-360.021] (-356.955) (-359.858) (-360.060) -- 0:00:23
647000 -- (-357.674) (-358.046) [-359.540] (-359.516) * (-361.300) (-358.748) (-365.039) [-357.428] -- 0:00:23
647500 -- (-358.766) (-357.562) (-361.526) [-358.982] * (-358.953) [-359.093] (-360.140) (-360.250) -- 0:00:23
648000 -- (-358.984) (-357.822) [-357.073] (-359.780) * [-356.594] (-357.056) (-359.187) (-356.629) -- 0:00:23
648500 -- (-360.027) (-358.197) [-360.415] (-359.949) * [-356.581] (-358.312) (-361.066) (-356.756) -- 0:00:23
649000 -- [-359.521] (-357.293) (-365.336) (-358.202) * [-358.329] (-363.545) (-357.216) (-360.024) -- 0:00:23
649500 -- (-358.054) (-360.193) (-360.373) [-360.920] * (-359.059) (-357.809) (-358.271) [-358.529] -- 0:00:23
650000 -- (-358.057) (-358.054) [-358.471] (-362.255) * (-357.077) [-358.652] (-358.085) (-357.276) -- 0:00:23
Average standard deviation of split frequencies: 0.007924
650500 -- (-359.526) (-361.295) (-359.154) [-358.989] * [-358.099] (-358.326) (-358.109) (-357.485) -- 0:00:23
651000 -- (-357.967) [-358.960] (-358.317) (-357.529) * (-357.470) (-357.779) (-358.380) [-360.637] -- 0:00:23
651500 -- (-361.022) (-360.314) (-357.928) [-360.162] * [-358.248] (-360.441) (-357.329) (-360.781) -- 0:00:23
652000 -- (-362.194) (-359.899) (-361.833) [-360.405] * (-358.519) (-360.868) (-357.424) [-358.752] -- 0:00:22
652500 -- [-360.786] (-360.965) (-359.011) (-363.104) * (-358.045) (-358.690) [-360.066] (-359.790) -- 0:00:22
653000 -- [-357.963] (-361.129) (-360.475) (-356.751) * [-361.635] (-360.159) (-359.164) (-357.776) -- 0:00:22
653500 -- (-357.996) [-357.017] (-358.194) (-362.494) * (-357.279) (-357.293) [-357.868] (-357.891) -- 0:00:22
654000 -- (-357.525) [-356.893] (-361.379) (-359.260) * (-358.336) [-362.482] (-356.955) (-361.275) -- 0:00:22
654500 -- (-360.569) [-358.620] (-358.915) (-366.190) * (-363.161) (-359.161) [-356.840] (-361.180) -- 0:00:22
655000 -- (-359.707) (-362.211) [-359.267] (-356.629) * [-357.969] (-360.368) (-360.619) (-359.377) -- 0:00:22
Average standard deviation of split frequencies: 0.008792
655500 -- (-360.304) [-358.878] (-358.656) (-359.078) * [-357.424] (-357.669) (-360.452) (-360.221) -- 0:00:22
656000 -- (-358.982) (-356.782) [-356.997] (-359.260) * (-360.014) (-357.542) [-357.446] (-358.761) -- 0:00:22
656500 -- (-357.892) (-359.905) [-360.150] (-357.807) * [-360.836] (-357.349) (-359.365) (-358.148) -- 0:00:22
657000 -- [-357.061] (-357.523) (-360.353) (-358.517) * [-359.775] (-359.030) (-358.475) (-357.815) -- 0:00:22
657500 -- (-357.368) (-361.451) [-357.922] (-357.434) * (-361.153) (-357.578) (-358.807) [-362.929] -- 0:00:22
658000 -- (-361.339) (-356.995) (-356.512) [-358.154] * (-356.513) [-356.923] (-360.646) (-367.251) -- 0:00:22
658500 -- (-359.050) (-358.176) (-359.150) [-356.967] * (-358.286) [-360.081] (-359.696) (-362.696) -- 0:00:22
659000 -- (-360.204) (-357.471) [-358.361] (-360.754) * (-357.785) (-357.231) [-358.187] (-358.918) -- 0:00:22
659500 -- (-358.590) (-358.078) [-358.277] (-362.919) * (-357.696) (-360.019) [-357.530] (-356.815) -- 0:00:22
660000 -- (-363.638) [-358.290] (-359.291) (-359.533) * (-360.410) (-361.024) [-358.883] (-358.978) -- 0:00:22
Average standard deviation of split frequencies: 0.008940
660500 -- (-361.978) (-358.743) [-357.233] (-361.744) * (-363.991) (-358.875) (-360.659) [-357.257] -- 0:00:22
661000 -- (-360.895) [-359.159] (-358.016) (-363.731) * (-358.248) (-358.469) (-358.871) [-359.201] -- 0:00:22
661500 -- (-357.030) [-358.334] (-357.654) (-366.434) * (-358.032) (-358.018) (-360.260) [-359.962] -- 0:00:22
662000 -- [-357.094] (-358.927) (-359.361) (-365.450) * (-358.846) (-359.376) [-358.167] (-356.893) -- 0:00:22
662500 -- (-361.594) (-359.498) [-362.744] (-359.805) * (-358.262) (-359.327) (-357.221) [-360.939] -- 0:00:22
663000 -- [-357.107] (-357.413) (-359.411) (-362.180) * (-356.555) [-358.343] (-360.038) (-358.196) -- 0:00:22
663500 -- (-358.553) [-358.301] (-363.314) (-360.512) * (-360.009) [-359.890] (-363.160) (-358.472) -- 0:00:22
664000 -- [-357.006] (-361.042) (-358.697) (-358.766) * (-357.884) [-358.129] (-356.942) (-359.345) -- 0:00:22
664500 -- (-359.380) (-360.790) (-359.272) [-358.377] * (-358.992) (-358.660) [-357.172] (-361.667) -- 0:00:22
665000 -- (-360.201) (-357.422) (-359.554) [-359.318] * (-356.923) (-359.112) (-357.786) [-358.561] -- 0:00:22
Average standard deviation of split frequencies: 0.008910
665500 -- [-359.723] (-364.274) (-357.267) (-359.595) * (-358.941) [-359.641] (-357.735) (-362.705) -- 0:00:22
666000 -- (-360.085) [-364.628] (-357.221) (-360.760) * (-357.956) (-361.507) (-358.059) [-358.620] -- 0:00:22
666500 -- (-358.368) (-359.518) (-358.792) [-357.999] * [-357.881] (-359.060) (-358.777) (-357.317) -- 0:00:22
667000 -- [-356.959] (-360.624) (-358.791) (-358.254) * (-362.082) (-358.037) (-356.882) [-359.400] -- 0:00:21
667500 -- [-357.185] (-357.611) (-359.676) (-358.038) * (-359.123) (-357.072) (-357.011) [-358.686] -- 0:00:21
668000 -- (-357.132) [-358.376] (-360.860) (-361.872) * (-357.851) [-357.372] (-357.467) (-357.852) -- 0:00:21
668500 -- (-359.296) (-357.826) (-360.683) [-359.401] * (-357.583) (-358.269) [-357.861] (-357.977) -- 0:00:21
669000 -- [-360.437] (-358.912) (-359.163) (-358.160) * [-356.728] (-357.066) (-357.559) (-357.758) -- 0:00:21
669500 -- (-359.756) (-357.376) [-358.395] (-358.825) * (-361.321) [-358.189] (-357.095) (-362.449) -- 0:00:21
670000 -- (-357.638) [-359.383] (-359.317) (-357.820) * (-358.953) [-358.746] (-358.445) (-361.128) -- 0:00:21
Average standard deviation of split frequencies: 0.009468
670500 -- (-359.244) (-360.271) [-360.074] (-358.430) * (-361.682) (-359.719) [-359.077] (-363.763) -- 0:00:21
671000 -- (-360.944) (-363.430) [-359.342] (-362.190) * [-359.367] (-359.229) (-361.482) (-361.559) -- 0:00:21
671500 -- [-358.461] (-361.076) (-359.873) (-358.480) * (-358.158) [-356.976] (-361.067) (-361.456) -- 0:00:21
672000 -- (-360.988) (-359.779) [-359.307] (-357.193) * (-359.365) [-356.882] (-360.565) (-360.611) -- 0:00:21
672500 -- (-358.882) (-359.968) (-359.369) [-358.874] * (-358.737) (-358.036) [-359.708] (-361.084) -- 0:00:21
673000 -- (-358.215) (-360.505) [-359.278] (-362.823) * (-357.345) [-361.381] (-360.396) (-357.607) -- 0:00:21
673500 -- (-360.633) (-359.802) (-361.460) [-357.684] * (-357.799) (-358.499) (-364.389) [-360.404] -- 0:00:21
674000 -- [-359.428] (-358.907) (-358.704) (-360.984) * (-358.926) (-360.593) [-357.517] (-358.214) -- 0:00:21
674500 -- (-357.659) [-358.736] (-362.390) (-361.595) * (-359.735) (-356.959) (-357.340) [-357.423] -- 0:00:21
675000 -- [-359.620] (-357.232) (-357.674) (-361.387) * [-358.707] (-356.530) (-357.785) (-361.251) -- 0:00:21
Average standard deviation of split frequencies: 0.009414
675500 -- [-358.812] (-357.863) (-357.401) (-359.815) * (-359.994) [-356.524] (-358.171) (-359.343) -- 0:00:21
676000 -- [-358.205] (-357.953) (-356.527) (-361.206) * [-357.519] (-359.501) (-358.350) (-360.561) -- 0:00:21
676500 -- [-358.205] (-358.121) (-358.434) (-360.218) * (-360.036) [-357.042] (-359.904) (-359.748) -- 0:00:21
677000 -- [-360.009] (-357.899) (-356.521) (-360.331) * [-357.501] (-358.563) (-359.344) (-359.931) -- 0:00:20
677500 -- (-358.725) (-359.692) [-360.102] (-359.358) * [-359.852] (-361.874) (-358.616) (-357.966) -- 0:00:20
678000 -- (-359.119) [-361.584] (-360.896) (-357.208) * (-358.371) [-362.962] (-357.779) (-357.473) -- 0:00:20
678500 -- (-359.880) (-359.944) (-357.075) [-356.672] * (-357.126) [-358.100] (-358.775) (-360.287) -- 0:00:21
679000 -- (-358.670) [-358.043] (-360.013) (-357.980) * (-360.040) [-358.269] (-357.797) (-360.345) -- 0:00:21
679500 -- (-358.419) (-358.209) [-361.759] (-356.489) * (-358.484) (-359.482) (-361.261) [-359.496] -- 0:00:21
680000 -- (-358.676) (-358.639) [-359.490] (-356.871) * [-358.768] (-359.681) (-358.545) (-360.224) -- 0:00:21
Average standard deviation of split frequencies: 0.009927
680500 -- (-356.741) [-359.038] (-359.222) (-359.627) * [-356.712] (-359.090) (-358.084) (-357.498) -- 0:00:21
681000 -- (-357.812) [-357.296] (-357.744) (-363.079) * (-357.956) (-359.308) (-357.325) [-359.189] -- 0:00:21
681500 -- (-358.585) (-356.996) [-363.678] (-361.775) * (-361.641) [-359.455] (-359.898) (-356.634) -- 0:00:21
682000 -- (-360.448) (-357.815) [-364.152] (-358.814) * (-357.486) [-357.081] (-359.075) (-356.586) -- 0:00:20
682500 -- [-358.423] (-357.181) (-359.236) (-363.196) * (-357.938) (-359.135) (-359.740) [-357.234] -- 0:00:20
683000 -- (-359.212) (-357.399) (-357.402) [-358.789] * [-357.473] (-357.012) (-357.062) (-358.755) -- 0:00:20
683500 -- (-357.013) (-360.138) (-359.714) [-358.914] * (-359.487) [-362.380] (-358.984) (-359.335) -- 0:00:20
684000 -- (-357.162) (-363.425) (-357.508) [-360.566] * [-359.600] (-359.541) (-357.857) (-358.216) -- 0:00:20
684500 -- [-357.834] (-359.194) (-362.640) (-357.379) * [-357.930] (-357.641) (-358.362) (-358.343) -- 0:00:20
685000 -- (-358.577) (-358.412) (-357.219) [-357.937] * (-357.811) (-359.802) [-358.028] (-362.514) -- 0:00:20
Average standard deviation of split frequencies: 0.010308
685500 -- (-363.272) [-357.684] (-358.997) (-366.387) * [-357.319] (-358.923) (-357.942) (-360.362) -- 0:00:20
686000 -- (-358.087) (-359.857) (-360.957) [-360.336] * (-358.197) (-359.679) (-358.941) [-358.856] -- 0:00:20
686500 -- (-357.985) (-357.891) (-359.448) [-360.740] * (-356.399) [-359.030] (-357.538) (-358.368) -- 0:00:20
687000 -- [-357.584] (-356.839) (-359.429) (-357.092) * [-361.633] (-359.065) (-358.054) (-357.665) -- 0:00:20
687500 -- (-358.426) [-358.213] (-357.961) (-359.146) * (-360.873) (-360.497) (-358.203) [-359.163] -- 0:00:20
688000 -- (-360.282) [-361.317] (-357.286) (-357.069) * [-358.355] (-358.341) (-357.357) (-358.539) -- 0:00:20
688500 -- (-359.332) [-358.589] (-358.796) (-358.347) * (-358.299) [-360.628] (-364.667) (-359.267) -- 0:00:20
689000 -- (-359.877) [-359.419] (-358.012) (-359.097) * (-357.137) (-359.845) (-360.435) [-362.980] -- 0:00:20
689500 -- (-361.284) (-357.967) [-362.050] (-359.536) * (-358.910) (-358.504) [-359.160] (-359.318) -- 0:00:20
690000 -- (-358.508) [-356.725] (-358.476) (-360.319) * (-358.152) (-358.572) [-356.648] (-360.114) -- 0:00:20
Average standard deviation of split frequencies: 0.010162
690500 -- (-358.055) (-357.656) (-357.928) [-359.599] * (-359.705) (-357.143) (-363.111) [-358.045] -- 0:00:20
691000 -- (-359.137) [-358.907] (-357.129) (-362.409) * (-360.073) (-361.449) (-364.947) [-358.318] -- 0:00:20
691500 -- (-360.196) (-360.764) [-359.801] (-361.476) * [-357.994] (-356.782) (-359.298) (-359.192) -- 0:00:20
692000 -- (-361.140) (-369.541) [-357.746] (-357.589) * (-362.301) [-357.735] (-357.822) (-359.474) -- 0:00:20
692500 -- (-360.871) (-358.788) (-360.900) [-358.343] * [-360.817] (-360.127) (-357.116) (-358.530) -- 0:00:19
693000 -- (-364.345) [-358.463] (-358.511) (-361.547) * [-360.936] (-359.071) (-358.377) (-361.678) -- 0:00:19
693500 -- [-360.321] (-358.356) (-359.327) (-358.152) * (-363.994) (-359.983) (-361.469) [-358.137] -- 0:00:19
694000 -- (-360.043) (-358.317) [-360.007] (-359.230) * [-359.426] (-362.644) (-362.702) (-356.992) -- 0:00:19
694500 -- (-358.236) [-358.006] (-365.064) (-358.943) * [-358.374] (-357.737) (-360.150) (-357.001) -- 0:00:19
695000 -- (-358.280) (-357.108) (-357.783) [-356.967] * [-358.086] (-359.693) (-357.080) (-359.422) -- 0:00:19
Average standard deviation of split frequencies: 0.009971
695500 -- (-357.007) (-358.345) (-357.648) [-357.505] * (-357.993) [-357.069] (-357.860) (-359.664) -- 0:00:20
696000 -- (-358.155) [-357.179] (-357.107) (-357.744) * (-358.379) [-358.287] (-356.973) (-359.306) -- 0:00:20
696500 -- (-358.891) (-356.853) [-357.706] (-356.670) * (-358.196) (-358.450) (-360.750) [-359.404] -- 0:00:20
697000 -- (-359.046) [-356.950] (-357.616) (-357.423) * (-360.872) [-358.021] (-357.158) (-362.707) -- 0:00:19
697500 -- (-360.828) (-358.892) [-357.957] (-356.553) * (-361.524) [-360.406] (-358.920) (-358.496) -- 0:00:19
698000 -- (-359.906) [-358.650] (-362.133) (-358.449) * (-357.380) (-359.657) (-362.969) [-358.284] -- 0:00:19
698500 -- (-358.907) (-359.075) (-364.592) [-360.826] * (-357.740) [-359.988] (-362.367) (-360.137) -- 0:00:19
699000 -- (-361.916) (-360.133) (-360.707) [-359.279] * (-358.754) (-362.186) [-357.521] (-357.126) -- 0:00:19
699500 -- (-361.741) (-360.497) (-359.684) [-362.244] * (-356.704) (-360.577) [-359.999] (-356.901) -- 0:00:19
700000 -- (-358.521) (-361.274) [-357.625] (-357.616) * (-357.141) (-358.698) [-357.373] (-361.310) -- 0:00:19
Average standard deviation of split frequencies: 0.010428
700500 -- [-358.769] (-358.306) (-359.431) (-357.283) * [-360.277] (-357.408) (-360.004) (-364.208) -- 0:00:19
701000 -- (-365.563) (-357.774) [-357.970] (-358.946) * (-358.449) [-358.670] (-360.542) (-358.688) -- 0:00:19
701500 -- (-357.836) (-359.582) [-358.266] (-360.128) * [-358.239] (-358.230) (-362.722) (-359.754) -- 0:00:19
702000 -- (-361.350) (-360.085) [-358.720] (-359.208) * [-357.438] (-364.022) (-357.871) (-360.394) -- 0:00:19
702500 -- [-364.469] (-359.316) (-357.278) (-359.391) * [-358.508] (-361.873) (-357.109) (-361.033) -- 0:00:19
703000 -- (-364.553) (-359.293) [-358.016] (-360.373) * (-358.863) (-357.881) [-360.990] (-357.606) -- 0:00:19
703500 -- [-359.022] (-362.893) (-359.994) (-359.829) * (-358.777) (-363.510) (-357.866) [-358.928] -- 0:00:19
704000 -- (-359.160) (-359.933) [-359.674] (-357.812) * [-357.279] (-360.421) (-357.098) (-358.434) -- 0:00:19
704500 -- (-357.979) (-360.323) [-358.218] (-357.545) * (-358.258) (-358.333) (-359.584) [-357.874] -- 0:00:19
705000 -- (-359.453) (-358.676) [-360.524] (-358.007) * (-358.929) (-357.633) [-361.180] (-360.578) -- 0:00:19
Average standard deviation of split frequencies: 0.010275
705500 -- (-362.886) [-360.263] (-357.044) (-358.996) * [-359.058] (-357.569) (-359.631) (-360.191) -- 0:00:19
706000 -- (-363.148) [-357.310] (-357.275) (-365.896) * (-357.691) (-360.568) (-359.101) [-359.064] -- 0:00:19
706500 -- (-359.422) (-357.980) [-356.443] (-362.480) * [-357.315] (-357.701) (-357.542) (-358.636) -- 0:00:19
707000 -- (-360.414) (-361.376) [-362.608] (-357.573) * (-358.997) (-357.487) [-358.727] (-358.335) -- 0:00:19
707500 -- (-359.412) [-361.115] (-356.771) (-358.793) * (-356.695) (-360.215) (-358.167) [-358.355] -- 0:00:19
708000 -- (-356.527) [-357.227] (-358.075) (-358.488) * (-357.600) [-360.869] (-361.068) (-359.601) -- 0:00:18
708500 -- [-357.981] (-358.931) (-359.562) (-358.891) * (-360.139) (-359.905) (-360.181) [-357.864] -- 0:00:18
709000 -- (-358.256) [-356.787] (-367.347) (-360.061) * (-357.745) [-356.438] (-359.055) (-360.417) -- 0:00:18
709500 -- [-357.502] (-357.024) (-365.386) (-360.419) * (-359.155) [-356.918] (-357.443) (-359.614) -- 0:00:18
710000 -- (-359.650) (-359.532) (-357.702) [-357.592] * (-358.461) (-359.510) (-356.772) [-360.658] -- 0:00:18
Average standard deviation of split frequencies: 0.009987
710500 -- [-358.388] (-357.793) (-360.808) (-360.415) * (-361.212) (-360.580) [-358.643] (-357.747) -- 0:00:18
711000 -- (-361.850) (-360.318) (-359.175) [-361.819] * (-358.115) [-358.990] (-359.692) (-356.820) -- 0:00:18
711500 -- [-362.685] (-361.177) (-360.901) (-361.161) * (-361.874) (-358.714) (-357.228) [-357.632] -- 0:00:18
712000 -- (-357.868) [-358.828] (-358.254) (-363.342) * (-360.422) (-358.711) [-359.030] (-357.410) -- 0:00:18
712500 -- (-360.017) (-356.901) [-357.626] (-361.188) * (-357.620) [-358.354] (-363.530) (-358.950) -- 0:00:18
713000 -- (-360.258) [-357.918] (-358.213) (-359.690) * [-357.175] (-357.692) (-357.950) (-358.376) -- 0:00:18
713500 -- (-359.266) (-358.757) [-357.909] (-360.914) * (-356.881) [-360.692] (-365.240) (-364.948) -- 0:00:18
714000 -- [-359.936] (-360.972) (-359.548) (-361.230) * (-360.201) (-360.319) [-357.745] (-358.027) -- 0:00:18
714500 -- (-359.341) [-357.425] (-356.992) (-367.127) * (-357.922) (-358.060) [-360.984] (-356.665) -- 0:00:18
715000 -- (-359.280) (-358.014) (-356.867) [-357.546] * [-358.133] (-357.230) (-362.362) (-360.477) -- 0:00:18
Average standard deviation of split frequencies: 0.009803
715500 -- (-360.043) [-359.093] (-358.405) (-357.687) * (-357.298) [-357.496] (-361.410) (-357.018) -- 0:00:18
716000 -- (-360.351) (-358.087) (-359.286) [-358.858] * (-358.616) [-357.444] (-358.499) (-359.675) -- 0:00:18
716500 -- (-357.371) (-358.713) (-358.845) [-357.542] * [-356.467] (-359.520) (-359.167) (-358.912) -- 0:00:18
717000 -- (-361.056) [-357.086] (-361.279) (-357.412) * [-358.349] (-359.347) (-358.955) (-357.811) -- 0:00:18
717500 -- (-356.880) (-359.592) (-362.768) [-361.388] * [-361.492] (-359.216) (-356.711) (-357.699) -- 0:00:18
718000 -- (-360.268) (-356.509) (-359.328) [-358.618] * (-361.350) [-358.057] (-359.317) (-358.541) -- 0:00:18
718500 -- (-359.900) [-357.165] (-358.660) (-358.835) * [-360.681] (-357.844) (-357.472) (-357.587) -- 0:00:18
719000 -- (-362.249) (-357.885) [-358.702] (-360.554) * (-359.829) (-357.600) (-358.015) [-359.292] -- 0:00:18
719500 -- (-359.210) [-359.096] (-359.221) (-359.349) * (-360.445) (-357.284) [-360.146] (-359.523) -- 0:00:18
720000 -- [-357.179] (-357.506) (-362.505) (-358.284) * (-358.027) (-357.244) (-357.131) [-358.961] -- 0:00:18
Average standard deviation of split frequencies: 0.009619
720500 -- [-356.995] (-358.976) (-359.045) (-360.203) * (-363.158) (-357.880) [-357.049] (-356.490) -- 0:00:18
721000 -- (-359.467) (-358.065) [-358.955] (-357.788) * [-358.059] (-359.827) (-357.489) (-358.968) -- 0:00:18
721500 -- [-359.412] (-362.525) (-361.594) (-361.860) * (-358.971) (-360.402) (-357.195) [-361.877] -- 0:00:18
722000 -- (-357.572) (-359.568) [-362.118] (-360.198) * (-361.683) (-358.143) [-357.714] (-357.098) -- 0:00:18
722500 -- (-360.195) [-360.084] (-356.995) (-360.486) * (-362.767) (-358.562) [-358.316] (-358.563) -- 0:00:18
723000 -- (-357.868) (-360.868) (-357.197) [-359.811] * (-358.958) (-357.930) [-357.068] (-357.264) -- 0:00:18
723500 -- (-357.124) (-360.826) (-357.287) [-357.965] * (-358.663) [-357.472] (-356.543) (-359.981) -- 0:00:17
724000 -- [-357.125] (-358.598) (-358.420) (-358.530) * (-358.833) [-361.277] (-357.627) (-358.439) -- 0:00:17
724500 -- (-359.432) (-359.881) (-358.413) [-357.558] * (-360.966) (-362.807) [-359.420] (-358.255) -- 0:00:17
725000 -- (-358.817) (-357.564) [-366.481] (-360.686) * (-356.559) [-356.960] (-360.273) (-358.559) -- 0:00:17
Average standard deviation of split frequencies: 0.009663
725500 -- (-357.177) [-356.916] (-358.159) (-359.649) * (-357.798) (-358.347) (-359.275) [-356.581] -- 0:00:17
726000 -- (-357.344) [-360.190] (-361.250) (-361.663) * (-361.317) (-358.611) [-358.828] (-358.384) -- 0:00:17
726500 -- [-357.322] (-360.544) (-358.353) (-358.340) * (-358.492) (-359.177) [-357.451] (-358.250) -- 0:00:17
727000 -- (-357.407) [-357.763] (-357.748) (-359.706) * (-357.275) (-359.116) (-357.981) [-358.815] -- 0:00:17
727500 -- [-359.946] (-359.064) (-359.306) (-358.805) * (-358.055) (-357.171) (-359.137) [-358.987] -- 0:00:17
728000 -- (-358.325) (-356.893) (-357.930) [-357.152] * (-357.702) (-359.130) [-357.607] (-362.954) -- 0:00:17
728500 -- [-358.446] (-357.101) (-361.927) (-358.338) * (-359.288) [-356.727] (-360.430) (-360.516) -- 0:00:17
729000 -- [-357.980] (-360.850) (-357.369) (-358.669) * [-362.568] (-358.555) (-358.074) (-357.806) -- 0:00:17
729500 -- (-362.836) (-358.923) (-356.882) [-356.544] * (-362.194) (-357.305) (-358.484) [-359.762] -- 0:00:17
730000 -- [-356.556] (-358.145) (-358.094) (-359.454) * (-357.045) (-357.792) (-360.933) [-358.589] -- 0:00:17
Average standard deviation of split frequencies: 0.009319
730500 -- [-361.208] (-362.946) (-359.823) (-364.780) * [-358.921] (-358.148) (-359.979) (-357.286) -- 0:00:17
731000 -- (-359.516) (-358.946) (-358.375) [-358.733] * (-358.141) (-359.741) (-360.112) [-356.594] -- 0:00:17
731500 -- (-361.370) (-361.790) [-357.855] (-359.145) * (-356.655) (-363.444) (-359.150) [-356.296] -- 0:00:17
732000 -- (-358.362) (-362.611) (-357.549) [-359.227] * (-359.902) [-360.462] (-358.924) (-356.472) -- 0:00:17
732500 -- (-357.760) [-359.204] (-357.429) (-359.301) * (-360.674) (-362.670) (-358.409) [-358.084] -- 0:00:17
733000 -- (-356.980) (-360.762) (-357.856) [-361.669] * (-357.898) (-359.074) (-357.997) [-358.483] -- 0:00:17
733500 -- (-358.303) (-361.420) (-358.140) [-356.943] * [-358.171] (-362.533) (-361.987) (-361.088) -- 0:00:17
734000 -- (-360.219) (-359.944) (-357.788) [-358.161] * [-358.088] (-360.374) (-357.682) (-367.077) -- 0:00:17
734500 -- (-356.760) (-358.797) (-363.589) [-356.937] * (-358.943) (-356.723) [-360.556] (-356.430) -- 0:00:17
735000 -- [-358.959] (-357.292) (-357.343) (-356.620) * (-358.291) (-357.058) (-359.567) [-358.111] -- 0:00:17
Average standard deviation of split frequencies: 0.009572
735500 -- (-358.167) (-358.232) [-358.639] (-361.214) * [-357.319] (-359.355) (-358.603) (-356.966) -- 0:00:17
736000 -- (-358.371) [-356.725] (-357.470) (-357.021) * (-358.136) (-360.850) [-358.172] (-356.727) -- 0:00:17
736500 -- (-358.821) (-357.096) [-357.452] (-357.238) * (-358.007) (-362.347) [-358.407] (-358.727) -- 0:00:17
737000 -- (-358.067) (-361.513) [-357.222] (-360.395) * (-362.743) (-359.781) (-356.931) [-362.451] -- 0:00:17
737500 -- (-361.680) [-361.326] (-358.227) (-358.563) * (-359.425) (-359.962) (-358.611) [-359.564] -- 0:00:17
738000 -- (-356.957) [-357.801] (-362.179) (-363.331) * (-358.034) (-357.642) [-361.238] (-359.774) -- 0:00:17
738500 -- (-357.411) (-356.912) [-358.914] (-357.806) * (-362.155) (-360.889) [-360.636] (-366.407) -- 0:00:16
739000 -- (-361.011) (-357.794) [-359.295] (-359.807) * (-358.658) (-359.012) [-359.606] (-360.467) -- 0:00:16
739500 -- (-357.537) (-358.575) [-360.818] (-361.148) * (-357.075) (-358.620) [-356.337] (-363.390) -- 0:00:16
740000 -- (-357.727) [-358.878] (-358.227) (-358.714) * (-362.866) (-358.319) [-361.404] (-363.144) -- 0:00:16
Average standard deviation of split frequencies: 0.009846
740500 -- [-360.365] (-364.143) (-362.060) (-358.770) * (-359.786) (-356.702) [-359.105] (-364.355) -- 0:00:16
741000 -- (-359.632) (-360.405) (-361.561) [-358.565] * (-357.361) [-356.688] (-360.594) (-362.764) -- 0:00:16
741500 -- (-360.557) (-357.660) (-359.814) [-360.937] * [-356.465] (-358.758) (-358.929) (-359.182) -- 0:00:16
742000 -- (-359.122) (-357.618) (-361.138) [-358.394] * (-358.459) [-358.902] (-360.099) (-361.648) -- 0:00:16
742500 -- (-360.982) (-362.749) (-358.879) [-359.495] * (-359.659) (-357.260) [-357.836] (-362.286) -- 0:00:16
743000 -- (-357.615) (-363.175) (-359.009) [-360.552] * (-357.477) [-360.311] (-358.294) (-365.371) -- 0:00:16
743500 -- (-360.719) (-359.954) (-359.935) [-358.510] * (-359.630) (-359.442) [-357.466] (-359.460) -- 0:00:16
744000 -- [-359.372] (-360.455) (-362.315) (-360.425) * [-359.369] (-359.383) (-358.010) (-357.780) -- 0:00:16
744500 -- (-356.878) (-361.951) (-359.790) [-358.269] * [-359.874] (-356.425) (-360.446) (-357.835) -- 0:00:16
745000 -- (-357.596) [-357.636] (-361.119) (-360.041) * (-357.383) [-357.558] (-358.435) (-357.289) -- 0:00:16
Average standard deviation of split frequencies: 0.010036
745500 -- [-358.796] (-362.879) (-359.785) (-363.133) * (-363.779) (-361.104) [-358.311] (-359.726) -- 0:00:16
746000 -- (-359.267) (-364.150) (-359.978) [-362.090] * (-358.238) [-359.881] (-357.535) (-359.376) -- 0:00:16
746500 -- (-359.685) (-358.558) (-360.267) [-359.115] * (-357.394) [-359.207] (-357.122) (-361.247) -- 0:00:16
747000 -- (-359.734) (-358.254) [-357.872] (-361.106) * (-356.888) [-357.937] (-357.399) (-359.736) -- 0:00:16
747500 -- [-359.080] (-357.614) (-359.149) (-363.909) * (-358.113) [-358.061] (-359.434) (-357.334) -- 0:00:16
748000 -- (-361.000) (-358.928) [-359.575] (-363.540) * (-356.824) [-358.724] (-358.848) (-357.715) -- 0:00:16
748500 -- (-360.787) [-359.361] (-359.669) (-358.296) * (-359.001) (-358.841) [-357.197] (-357.095) -- 0:00:16
749000 -- (-359.812) [-357.267] (-359.073) (-360.170) * [-358.358] (-358.997) (-359.462) (-359.905) -- 0:00:16
749500 -- (-360.404) (-358.786) (-357.535) [-360.776] * (-360.021) (-361.186) (-356.459) [-357.481] -- 0:00:16
750000 -- (-360.925) (-359.630) [-357.214] (-358.039) * (-358.124) [-358.760] (-357.953) (-358.860) -- 0:00:16
Average standard deviation of split frequencies: 0.009863
750500 -- (-359.402) (-359.704) [-358.641] (-358.805) * (-360.084) [-361.672] (-364.314) (-361.350) -- 0:00:16
751000 -- [-357.831] (-361.806) (-361.735) (-357.493) * (-356.711) (-356.902) [-360.911] (-360.336) -- 0:00:16
751500 -- (-361.081) [-360.673] (-359.625) (-360.173) * (-361.188) [-358.001] (-361.259) (-357.181) -- 0:00:16
752000 -- (-361.449) (-359.291) [-358.183] (-360.251) * (-359.942) [-357.566] (-362.490) (-358.514) -- 0:00:16
752500 -- (-363.395) (-357.120) [-361.839] (-360.311) * (-359.124) (-364.190) [-358.101] (-357.055) -- 0:00:16
753000 -- (-359.995) [-358.955] (-360.231) (-357.530) * (-357.922) [-358.383] (-363.471) (-360.777) -- 0:00:16
753500 -- (-361.122) (-359.998) (-358.921) [-358.170] * (-359.788) (-358.830) [-359.154] (-361.206) -- 0:00:16
754000 -- (-360.146) (-359.675) [-359.815] (-361.207) * [-364.541] (-359.409) (-358.927) (-360.905) -- 0:00:15
754500 -- (-359.824) [-359.596] (-360.856) (-358.090) * (-358.659) (-359.201) (-358.696) [-358.295] -- 0:00:15
755000 -- (-359.883) (-358.223) (-362.403) [-360.775] * (-361.505) (-361.590) (-357.651) [-358.313] -- 0:00:15
Average standard deviation of split frequencies: 0.010150
755500 -- [-356.782] (-358.609) (-358.880) (-358.915) * (-356.985) (-358.860) (-361.191) [-359.254] -- 0:00:15
756000 -- (-357.399) (-358.508) (-358.828) [-358.460] * (-360.251) (-358.722) (-360.283) [-359.728] -- 0:00:15
756500 -- [-359.267] (-358.179) (-359.485) (-359.614) * (-356.793) (-359.003) [-356.945] (-359.339) -- 0:00:15
757000 -- (-359.230) (-358.017) (-358.849) [-358.143] * (-362.593) (-356.970) [-356.891] (-362.199) -- 0:00:15
757500 -- (-356.654) (-360.518) (-359.377) [-358.113] * (-358.514) (-356.429) (-356.943) [-359.596] -- 0:00:15
758000 -- [-358.261] (-362.310) (-358.117) (-357.954) * (-358.617) (-357.694) (-360.040) [-359.938] -- 0:00:15
758500 -- (-358.865) (-357.562) [-358.608] (-358.002) * (-359.926) (-358.719) (-361.587) [-364.955] -- 0:00:15
759000 -- (-358.727) (-358.195) [-357.628] (-357.424) * (-359.335) [-357.191] (-358.697) (-358.021) -- 0:00:15
759500 -- (-358.862) (-359.903) (-359.738) [-357.570] * [-358.299] (-357.947) (-360.867) (-358.945) -- 0:00:15
760000 -- [-357.028] (-357.707) (-359.553) (-356.664) * (-362.531) [-360.981] (-358.791) (-364.096) -- 0:00:15
Average standard deviation of split frequencies: 0.009952
760500 -- [-358.036] (-356.597) (-363.900) (-357.451) * (-359.610) [-360.518] (-358.452) (-361.240) -- 0:00:15
761000 -- (-359.123) [-357.279] (-358.871) (-359.277) * (-359.261) (-356.667) [-357.057] (-359.007) -- 0:00:15
761500 -- (-357.069) [-360.278] (-361.224) (-360.643) * (-361.136) (-357.052) (-358.831) [-358.065] -- 0:00:15
762000 -- (-358.565) (-361.685) [-359.229] (-359.927) * (-359.665) (-358.450) (-358.112) [-357.117] -- 0:00:15
762500 -- (-360.139) (-363.729) (-358.897) [-356.696] * (-357.960) [-357.428] (-358.348) (-357.282) -- 0:00:15
763000 -- [-357.998] (-358.738) (-359.330) (-357.775) * (-357.709) (-370.294) (-360.023) [-357.626] -- 0:00:15
763500 -- (-359.339) [-358.131] (-356.715) (-356.911) * (-359.923) (-358.602) (-359.125) [-357.474] -- 0:00:15
764000 -- (-358.015) (-356.799) (-356.761) [-359.444] * (-361.796) (-357.007) (-357.673) [-356.746] -- 0:00:15
764500 -- (-358.926) [-360.923] (-357.660) (-357.767) * (-357.862) (-358.528) [-357.116] (-356.836) -- 0:00:15
765000 -- (-358.705) (-358.657) (-362.850) [-356.692] * (-360.211) (-358.649) [-356.557] (-357.513) -- 0:00:15
Average standard deviation of split frequencies: 0.009774
765500 -- (-361.741) (-358.990) (-357.854) [-356.677] * (-363.417) (-359.829) [-357.044] (-360.704) -- 0:00:15
766000 -- (-358.862) (-359.081) [-360.249] (-359.917) * [-357.403] (-359.193) (-357.601) (-358.185) -- 0:00:15
766500 -- (-359.614) (-361.200) (-361.007) [-359.459] * (-358.113) [-357.422] (-359.374) (-359.058) -- 0:00:15
767000 -- [-357.917] (-364.153) (-360.477) (-358.167) * (-360.974) (-358.030) [-362.179] (-358.502) -- 0:00:15
767500 -- (-360.074) (-359.279) (-361.441) [-357.720] * (-358.664) [-359.480] (-359.972) (-358.266) -- 0:00:15
768000 -- (-359.257) (-358.103) [-357.953] (-360.230) * (-358.175) (-359.122) [-360.674] (-358.130) -- 0:00:15
768500 -- (-359.370) (-358.113) [-358.116] (-358.630) * (-363.101) [-358.637] (-360.587) (-358.725) -- 0:00:15
769000 -- [-357.687] (-359.571) (-357.487) (-361.230) * (-360.292) [-358.562] (-356.581) (-357.049) -- 0:00:15
769500 -- [-356.780] (-361.720) (-362.082) (-359.485) * (-358.805) (-358.900) [-356.745] (-357.173) -- 0:00:14
770000 -- (-356.635) (-359.945) (-358.761) [-357.479] * [-357.068] (-358.406) (-357.079) (-358.167) -- 0:00:14
Average standard deviation of split frequencies: 0.009535
770500 -- (-359.062) [-357.326] (-359.154) (-357.680) * [-357.931] (-360.785) (-359.932) (-358.715) -- 0:00:14
771000 -- (-361.615) (-357.559) [-357.258] (-362.365) * (-356.343) (-357.707) [-357.084] (-357.194) -- 0:00:14
771500 -- [-361.780] (-359.145) (-360.438) (-357.798) * (-360.863) (-365.818) [-357.045] (-358.047) -- 0:00:14
772000 -- [-358.259] (-359.888) (-358.498) (-357.162) * (-358.086) [-361.487] (-358.400) (-358.863) -- 0:00:14
772500 -- (-358.522) (-358.505) (-359.203) [-360.964] * (-358.338) [-358.684] (-362.083) (-359.419) -- 0:00:14
773000 -- [-358.065] (-360.520) (-357.875) (-358.354) * (-358.547) [-356.689] (-360.010) (-358.944) -- 0:00:14
773500 -- (-359.643) (-357.733) (-356.300) [-356.823] * [-356.710] (-360.550) (-358.345) (-360.283) -- 0:00:14
774000 -- (-361.700) (-360.550) (-358.702) [-360.265] * (-356.771) (-362.581) [-356.850] (-360.113) -- 0:00:14
774500 -- (-360.207) [-361.640] (-357.846) (-358.620) * (-358.222) [-360.715] (-357.319) (-359.422) -- 0:00:14
775000 -- [-359.396] (-361.083) (-357.296) (-360.647) * (-359.606) (-357.762) (-358.337) [-358.062] -- 0:00:14
Average standard deviation of split frequencies: 0.009219
775500 -- [-358.987] (-359.192) (-357.570) (-360.729) * (-357.453) [-358.629] (-361.034) (-357.849) -- 0:00:14
776000 -- (-360.452) (-358.438) [-358.879] (-359.682) * (-359.701) (-358.132) [-359.605] (-357.420) -- 0:00:14
776500 -- (-363.423) (-361.874) (-358.762) [-360.418] * (-364.238) [-357.253] (-358.175) (-357.574) -- 0:00:14
777000 -- (-359.344) (-362.473) [-359.580] (-359.189) * (-357.871) (-357.840) [-358.384] (-357.271) -- 0:00:14
777500 -- [-359.184] (-358.406) (-357.996) (-360.819) * [-360.786] (-357.950) (-364.165) (-359.312) -- 0:00:14
778000 -- (-359.275) (-361.433) [-357.950] (-358.043) * [-356.588] (-363.897) (-363.433) (-360.309) -- 0:00:14
778500 -- [-356.791] (-357.221) (-357.808) (-359.245) * (-360.139) [-362.415] (-362.537) (-360.125) -- 0:00:14
779000 -- (-357.120) [-357.692] (-357.804) (-361.953) * [-357.415] (-359.818) (-356.475) (-358.373) -- 0:00:14
779500 -- (-359.325) [-359.197] (-362.983) (-358.779) * (-358.904) (-358.084) (-359.049) [-359.905] -- 0:00:14
780000 -- (-358.169) (-358.905) [-358.166] (-361.855) * (-359.498) (-363.358) (-360.747) [-361.052] -- 0:00:14
Average standard deviation of split frequencies: 0.009306
780500 -- (-359.532) (-360.230) [-358.424] (-357.992) * (-360.870) (-358.311) (-357.575) [-358.303] -- 0:00:14
781000 -- [-357.353] (-357.509) (-358.033) (-359.503) * (-356.791) (-358.837) [-358.463] (-356.692) -- 0:00:14
781500 -- (-356.998) (-357.365) (-362.181) [-359.025] * (-356.418) [-360.564] (-361.455) (-356.543) -- 0:00:14
782000 -- (-357.121) [-358.485] (-362.030) (-357.406) * [-362.052] (-360.460) (-360.303) (-358.189) -- 0:00:14
782500 -- (-358.161) (-358.689) [-359.852] (-360.525) * (-357.981) (-359.188) [-360.009] (-357.975) -- 0:00:14
783000 -- [-358.721] (-359.678) (-357.069) (-357.950) * (-363.167) (-359.748) [-358.877] (-356.733) -- 0:00:14
783500 -- (-363.847) [-356.839] (-357.634) (-361.128) * (-362.687) (-358.786) [-358.378] (-359.811) -- 0:00:14
784000 -- (-359.635) (-358.666) [-357.722] (-358.671) * (-357.813) (-357.165) (-362.889) [-361.218] -- 0:00:14
784500 -- (-360.050) [-357.687] (-357.703) (-357.987) * [-358.100] (-356.980) (-359.127) (-358.579) -- 0:00:14
785000 -- (-356.793) [-357.585] (-357.261) (-357.345) * [-362.711] (-357.523) (-359.838) (-357.785) -- 0:00:13
Average standard deviation of split frequencies: 0.009173
785500 -- (-360.611) (-357.051) [-357.433] (-360.822) * (-357.250) (-361.336) [-359.999] (-358.112) -- 0:00:13
786000 -- (-365.494) [-359.848] (-357.242) (-359.275) * (-358.410) (-359.075) (-360.276) [-357.106] -- 0:00:13
786500 -- (-356.689) (-357.282) [-356.997] (-358.752) * [-357.760] (-360.322) (-359.714) (-357.878) -- 0:00:13
787000 -- [-357.959] (-356.698) (-357.592) (-357.412) * (-359.517) (-358.619) [-359.399] (-361.629) -- 0:00:13
787500 -- (-358.878) [-356.993] (-358.008) (-359.380) * [-359.793] (-359.228) (-359.401) (-359.353) -- 0:00:13
788000 -- (-363.091) [-358.138] (-358.828) (-362.429) * [-360.686] (-357.714) (-357.485) (-358.024) -- 0:00:13
788500 -- [-362.345] (-361.906) (-361.818) (-359.753) * [-357.411] (-365.875) (-357.933) (-359.384) -- 0:00:13
789000 -- (-357.144) (-360.053) [-359.235] (-361.057) * (-357.574) (-360.248) (-357.132) [-358.445] -- 0:00:13
789500 -- (-358.687) [-359.333] (-359.258) (-357.772) * [-358.979] (-359.566) (-358.749) (-358.822) -- 0:00:13
790000 -- (-358.827) [-356.944] (-358.299) (-359.608) * (-360.460) (-356.894) (-358.261) [-357.498] -- 0:00:13
Average standard deviation of split frequencies: 0.008978
790500 -- (-357.527) (-360.925) [-357.811] (-362.119) * (-363.073) (-359.313) [-359.429] (-360.724) -- 0:00:13
791000 -- (-357.763) [-356.733] (-357.753) (-362.355) * (-361.778) (-359.159) (-358.224) [-358.943] -- 0:00:13
791500 -- (-358.684) (-358.007) (-358.143) [-358.056] * (-363.028) (-359.774) [-358.414] (-358.532) -- 0:00:13
792000 -- (-359.227) (-361.123) [-358.649] (-359.061) * (-361.087) (-356.699) [-358.187] (-360.177) -- 0:00:13
792500 -- (-358.527) [-358.428] (-360.658) (-360.880) * (-358.503) [-356.733] (-357.013) (-357.943) -- 0:00:13
793000 -- (-359.177) (-361.430) (-359.642) [-358.115] * (-356.793) (-358.091) [-360.011] (-358.562) -- 0:00:13
793500 -- [-358.285] (-364.343) (-359.772) (-359.649) * (-356.989) (-358.138) [-362.602] (-358.610) -- 0:00:13
794000 -- (-358.815) (-359.903) (-361.044) [-359.474] * (-359.620) [-357.172] (-361.440) (-357.619) -- 0:00:13
794500 -- [-361.660] (-358.735) (-360.999) (-357.671) * (-357.335) (-357.400) (-356.952) [-356.843] -- 0:00:13
795000 -- (-357.746) (-361.990) (-359.842) [-358.746] * [-357.994] (-361.563) (-358.882) (-358.309) -- 0:00:13
Average standard deviation of split frequencies: 0.009232
795500 -- [-358.862] (-358.473) (-360.706) (-357.413) * (-358.902) [-357.735] (-358.093) (-359.156) -- 0:00:13
796000 -- (-358.791) [-360.113] (-360.121) (-356.697) * (-358.503) [-361.446] (-357.221) (-358.115) -- 0:00:13
796500 -- (-359.853) (-362.148) [-359.342] (-357.332) * (-360.827) [-358.798] (-358.867) (-358.597) -- 0:00:13
797000 -- (-359.971) (-369.429) (-358.428) [-358.530] * (-362.704) (-359.021) (-358.387) [-358.419] -- 0:00:13
797500 -- [-359.298] (-361.404) (-358.854) (-357.946) * (-358.119) (-360.801) [-358.485] (-357.615) -- 0:00:13
798000 -- (-358.910) (-359.218) (-359.083) [-357.009] * (-359.678) (-371.412) (-358.866) [-359.895] -- 0:00:13
798500 -- (-359.632) (-361.595) [-358.855] (-361.620) * (-359.332) (-361.068) [-360.507] (-357.113) -- 0:00:13
799000 -- (-360.825) [-359.258] (-357.546) (-360.098) * (-357.940) (-360.871) (-363.170) [-356.836] -- 0:00:13
799500 -- [-362.178] (-361.700) (-357.476) (-361.303) * (-357.743) (-357.042) (-358.972) [-358.824] -- 0:00:13
800000 -- (-361.984) (-362.738) [-357.050] (-359.681) * [-357.360] (-359.285) (-356.956) (-359.012) -- 0:00:1 