--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:22:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/pknA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1797.71         -1801.49
2      -1797.91         -1802.17
--------------------------------------
TOTAL    -1797.80         -1801.89
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.887368    0.091014    0.345753    1.462270    0.852447   1483.77   1492.39    1.001
r(A<->C){all}   0.147132    0.017190    0.000014    0.420308    0.111717    236.21    278.98    1.000
r(A<->G){all}   0.152265    0.018315    0.000053    0.430569    0.113898    232.88    239.17    1.000
r(A<->T){all}   0.169714    0.019335    0.000120    0.445292    0.134291    206.34    221.23    1.004
r(C<->G){all}   0.146598    0.017100    0.000019    0.410274    0.112289     64.26    260.50    1.000
r(C<->T){all}   0.225726    0.025849    0.000072    0.532883    0.196359    204.69    238.14    1.003
r(G<->T){all}   0.158566    0.018286    0.000006    0.443383    0.121160    234.57    283.44    1.002
pi(A){all}      0.216864    0.000125    0.194201    0.237537    0.216679   1104.94   1165.02    1.000
pi(C){all}      0.322591    0.000161    0.299447    0.349150    0.322222   1402.96   1410.57    1.000
pi(G){all}      0.284015    0.000154    0.260216    0.308954    0.283842   1338.41   1419.70    1.000
pi(T){all}      0.176530    0.000110    0.156122    0.196522    0.176540   1309.80   1357.55    1.000
alpha{1,2}      0.330232    0.165752    0.000209    1.190466    0.198587   1068.87   1228.45    1.000
alpha{3}        0.402583    0.223370    0.000113    1.350632    0.238568   1078.54   1081.96    1.000
pinvar{all}     0.997510    0.000004    0.993603    0.999914    0.998046   1242.07   1330.13    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1759.958961
Model 2: PositiveSelection	-1759.576078
Model 0: one-ratio	-1759.575944
Model 7: beta	-1759.95896
Model 8: beta&w>1	-1759.576078


Model 0 vs 1	0.7660340000002179

Model 2 vs 1	0.7657659999999851

Model 8 vs 7	0.7657639999997627
>C1
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGAIDISPVAGQT
>C2
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C3
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C4
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C5
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C6
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=437 

C1              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C2              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C3              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C4              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C5              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C6              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
                **************************************************

C1              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C2              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C3              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C4              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C5              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C6              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
                **************************************************

C1              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C2              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C3              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C4              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C5              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C6              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
                **************************************************

C1              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C2              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C3              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C4              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C5              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C6              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
                **************************************************

C1              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C2              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C3              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C4              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C5              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C6              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
                **************************************************

C1              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C2              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C3              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C4              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C5              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C6              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
                **************************************************

C1              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C2              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C3              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C4              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C5              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C6              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
                **************************************************

C1              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C2              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C3              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C4              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C5              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C6              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
                **************************************************

C1              RVNWTNHKEISNSGLPKQAARAQLAGAIDISPVAGQT
C2              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C3              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C4              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C5              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C6              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
                *************************** *********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  437 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  437 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13110]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [13110]--->[13110]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.543 Mb, Max= 31.024 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C2              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C3              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C4              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C5              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
C6              MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
                **************************************************

C1              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C2              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C3              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C4              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C5              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
C6              DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
                **************************************************

C1              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C2              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C3              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C4              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C5              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
C6              EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
                **************************************************

C1              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C2              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C3              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C4              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C5              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
C6              PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
                **************************************************

C1              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C2              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C3              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C4              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C5              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
C6              YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
                **************************************************

C1              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C2              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C3              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C4              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C5              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
C6              ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
                **************************************************

C1              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C2              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C3              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C4              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C5              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
C6              TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
                **************************************************

C1              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C2              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C3              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C4              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C5              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
C6              ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
                **************************************************

C1              RVNWTNHKEISNSGLPKQAARAQLAGAIDISPVAGQT
C2              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C3              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C4              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C5              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
C6              RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
                *************************** *********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.77 C1	 C2	 99.77
TOP	    1    0	 99.77 C2	 C1	 99.77
BOT	    0    2	 99.77 C1	 C3	 99.77
TOP	    2    0	 99.77 C3	 C1	 99.77
BOT	    0    3	 99.77 C1	 C4	 99.77
TOP	    3    0	 99.77 C4	 C1	 99.77
BOT	    0    4	 99.77 C1	 C5	 99.77
TOP	    4    0	 99.77 C5	 C1	 99.77
BOT	    0    5	 99.77 C1	 C6	 99.77
TOP	    5    0	 99.77 C6	 C1	 99.77
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.77
AVG	 1	 C2	  *	 99.95
AVG	 2	 C3	  *	 99.95
AVG	 3	 C4	  *	 99.95
AVG	 4	 C5	  *	 99.95
AVG	 5	 C6	  *	 99.95
TOT	 TOT	  *	 99.92
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
C2              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
C3              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
C4              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
C5              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
C6              ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
                **************************************************

C1              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
C2              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
C3              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
C4              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
C5              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
C6              GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
                **************************************************

C1              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
C2              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
C3              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
C4              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
C5              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
C6              GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
                **************************************************

C1              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
C2              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
C3              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
C4              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
C5              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
C6              GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
                **************************************************

C1              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
C2              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
C3              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
C4              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
C5              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
C6              GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
                **************************************************

C1              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
C2              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
C3              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
C4              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
C5              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
C6              TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
                **************************************************

C1              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
C2              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
C3              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
C4              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
C5              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
C6              GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
                **************************************************

C1              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
C2              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
C3              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
C4              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
C5              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
C6              TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
                **************************************************

C1              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
C2              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
C3              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
C4              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
C5              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
C6              CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
                **************************************************

C1              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
C2              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
C3              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
C4              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
C5              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
C6              CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
                **************************************************

C1              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
C2              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
C3              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
C4              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
C5              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
C6              CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
                **************************************************

C1              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
C2              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
C3              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
C4              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
C5              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
C6              TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
                **************************************************

C1              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
C2              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
C3              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
C4              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
C5              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
C6              TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
                **************************************************

C1              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
C2              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
C3              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
C4              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
C5              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
C6              CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
                **************************************************

C1              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
C2              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
C3              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
C4              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
C5              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
C6              CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
                **************************************************

C1              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
C2              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
C3              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
C4              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
C5              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
C6              ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
                **************************************************

C1              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
C2              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
C3              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
C4              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
C5              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
C6              CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
                **************************************************

C1              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
C2              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
C3              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
C4              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
C5              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
C6              ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
                **************************************************

C1              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
C2              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
C3              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
C4              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
C5              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
C6              ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
                **************************************************

C1              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
C2              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
C3              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
C4              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
C5              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
C6              CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
                **************************************************

C1              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
C2              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
C3              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
C4              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
C5              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
C6              CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
                **************************************************

C1              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
C2              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
C3              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
C4              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
C5              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
C6              GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
                **************************************************

C1              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
C2              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
C3              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
C4              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
C5              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
C6              AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
                **************************************************

C1              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
C2              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
C3              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
C4              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
C5              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
C6              CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
                **************************************************

C1              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
C2              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
C3              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
C4              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
C5              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
C6              CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
                **************************************************

C1              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCATTGACATCTCGCCCGTCG
C2              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
C3              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
C4              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
C5              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
C6              GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
                ******************************** *****************

C1              CCGGCCAAACA
C2              CCGGCCAAACA
C3              CCGGCCAAACA
C4              CCGGCCAAACA
C5              CCGGCCAAACA
C6              CCGGCCAAACA
                ***********



>C1
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCATTGACATCTCGCCCGTCG
CCGGCCAAACA
>C2
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
CCGGCCAAACA
>C3
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
CCGGCCAAACA
>C4
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
CCGGCCAAACA
>C5
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
CCGGCCAAACA
>C6
ATGAGTCCGCGAATTGGTGTGATGCTGTCTGGTAGATACCGCCTGCATCG
GCTCATCGCCACCGGTGGCATGGGCCAAGTATGGGAAGCGGTGGACAGTC
GGCTGGGTCGCCGCGTTGCGGTCAAGGTGCTCAAGGGAGAGTTCTCCTCG
GACCCGGAGTTCATTGAGCGGTTCCGCGCTGAGGCACGAACCACCGCGAT
GCTCAACCACCCCGGAATCGCCAGCGTCCATGACTACGGCGAAAGCCATA
TGGACGGGGAGGGCCGCACAGCCTACTTGGTGATGGAACTGGTCAACGGC
GAACCACTGAATTCGGTGCTTAAACGCACCGGCCGGCTGTCGTTGCGGCA
TGCGCTGGACATGCTGGAGCAGACTGGCCGTGCCCTGCAAATTGCTCATG
CCGCTGGCCTGGTACACCGCGACGTCAAACCGGGAAACATCTTAATCACC
CCCACCGGCCAGGTGAAAATCACTGACTTCGGTATCGCCAAGGCAGTCGA
CGCTGCACCAGTGACCCAAACCGGCATGGTTATGGGCACCGCGCAATACA
TCGCGCCCGAACAGGCCTTAGGTCACGACGCGACTCCTGCTAGCGATGTC
TACTCGTTGGGAGTTATTGGGTATGAAGTGGTTTCGGGTAAGCGGCCGTT
CACCGGTGACGGCGCCCTAACGGTAGCGATGAAGCACATCAAGGAACCCC
CGCCGCCGTTGCCCGCGGACTTACCGCCTAATGTACGAGAACTCATCGAG
ATCACATTGGTGAAAAACCCGGGCATGCGCTATCCTAGTGGAGGATTGTT
CGCCGAAGCCGTCGCCGCGGTACGGGCCGGCCATCGGCCCCCGCGGCCCA
ACCAAACACCATCTTCCGGCCGGGCCTCTCCAACGACCATCCCGTCAAGC
ACACAGGCCCGAGCAGCTGTTGCTTGCGGCACCAAGACTCCGGCACCTCG
CCGATCCCGACCGTCAACAAGCGGAAATCGCCCGCCGCCGGCGCGAAACA
CGTTCTCGTCTGGACAACGCGCGTTGCTCTGGGCCGCCGGGATGCTCGGA
GCGCTGGCGATCATCATCGCGGTGCTGATCGTGATCAACTCCTACGCTGG
AAACGAACAGCATCAACCGCCTACTCCAACCGTTACTGACACCGGTACGC
CACCAGCTACCAAAACCCTCAGCGGTTTTCCGGCTGCATATTGCGAATAC
CGAGTCAACTGGACGAATCACAAAGAAATAAGTAATTCTGGACTTCCAAA
GCAGGCCGCTCGAGCTCAACTGGCCGGTGCCACTGACATCTCGCCCGTCG
CCGGCCAAACA
>C1
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGAIDISPVAGQT
>C2
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C3
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C4
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C5
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT
>C6
MSPRIGVMLSGRYRLHRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSS
DPEFIERFRAEARTTAMLNHPGIASVHDYGESHMDGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILIT
PTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDV
YSLGVIGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPADLPPNVRELIE
ITLVKNPGMRYPSGGLFAEAVAAVRAGHRPPRPNQTPSSGRASPTTIPSS
TQARAAVACGTKTPAPRRSRPSTSGNRPPPARNTFSSGQRALLWAAGMLG
ALAIIIAVLIVINSYAGNEQHQPPTPTVTDTGTPPATKTLSGFPAAYCEY
RVNWTNHKEISNSGLPKQAARAQLAGATDISPVAGQT


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1311 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785652
      Setting output file names to "/data/10res/pknA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1005424436
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9457596330
      Seed = 1113515122
      Swapseed = 1579785652
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2937.483721 -- -24.965149
         Chain 2 -- -2937.483721 -- -24.965149
         Chain 3 -- -2937.483207 -- -24.965149
         Chain 4 -- -2937.483721 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2937.483721 -- -24.965149
         Chain 2 -- -2937.483721 -- -24.965149
         Chain 3 -- -2937.482004 -- -24.965149
         Chain 4 -- -2937.483721 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2937.484] (-2937.484) (-2937.483) (-2937.484) * [-2937.484] (-2937.484) (-2937.482) (-2937.484) 
        500 -- [-1806.135] (-1819.353) (-1816.665) (-1826.248) * (-1806.166) [-1801.896] (-1821.098) (-1809.936) -- 0:00:00
       1000 -- [-1800.699] (-1805.840) (-1804.545) (-1811.749) * [-1805.462] (-1802.427) (-1804.586) (-1806.430) -- 0:00:00
       1500 -- [-1800.723] (-1810.426) (-1803.894) (-1811.360) * (-1798.982) (-1809.352) [-1804.057] (-1808.202) -- 0:00:00
       2000 -- (-1807.294) (-1802.411) [-1803.107] (-1809.801) * (-1803.338) [-1805.252] (-1805.472) (-1803.859) -- 0:00:00
       2500 -- [-1803.075] (-1802.450) (-1802.023) (-1806.168) * (-1809.488) [-1807.542] (-1806.374) (-1803.226) -- 0:00:00
       3000 -- (-1804.228) [-1799.399] (-1804.862) (-1802.851) * [-1805.917] (-1812.733) (-1800.817) (-1809.404) -- 0:00:00
       3500 -- (-1808.845) (-1810.352) (-1797.916) [-1800.773] * (-1796.742) (-1799.315) [-1805.150] (-1807.767) -- 0:00:00
       4000 -- (-1804.671) (-1807.348) (-1800.518) [-1799.644] * [-1803.912] (-1810.051) (-1800.801) (-1803.016) -- 0:00:00
       4500 -- (-1799.507) (-1803.610) (-1805.406) [-1801.865] * (-1803.292) [-1809.851] (-1801.495) (-1799.607) -- 0:00:00
       5000 -- [-1795.713] (-1804.104) (-1807.105) (-1805.515) * [-1799.562] (-1810.659) (-1800.786) (-1806.264) -- 0:00:00

      Average standard deviation of split frequencies: 0.088815

       5500 -- (-1801.106) [-1805.575] (-1809.443) (-1805.051) * (-1801.717) [-1804.447] (-1802.564) (-1807.869) -- 0:00:00
       6000 -- (-1798.768) [-1800.601] (-1807.254) (-1808.643) * (-1808.766) (-1805.134) (-1809.608) [-1814.727] -- 0:00:00
       6500 -- (-1806.283) (-1802.736) [-1803.908] (-1809.415) * (-1811.746) (-1802.549) [-1814.569] (-1807.697) -- 0:00:00
       7000 -- (-1805.847) (-1800.191) (-1804.573) [-1805.725] * (-1807.438) [-1807.748] (-1801.817) (-1800.688) -- 0:00:00
       7500 -- (-1801.733) [-1802.499] (-1802.984) (-1806.569) * (-1800.697) [-1802.190] (-1800.193) (-1802.584) -- 0:00:00
       8000 -- (-1797.342) (-1807.676) (-1810.676) [-1803.391] * (-1803.144) [-1803.221] (-1809.425) (-1801.233) -- 0:00:00
       8500 -- (-1800.028) (-1800.756) (-1801.032) [-1807.454] * (-1803.197) (-1810.115) (-1807.203) [-1802.224] -- 0:00:00
       9000 -- [-1800.385] (-1803.003) (-1801.999) (-1806.490) * [-1798.407] (-1801.856) (-1808.727) (-1811.800) -- 0:00:00
       9500 -- (-1799.464) [-1802.331] (-1799.959) (-1807.314) * (-1798.870) (-1803.745) [-1803.465] (-1813.224) -- 0:00:00
      10000 -- [-1806.573] (-1802.534) (-1799.280) (-1804.171) * (-1809.023) (-1799.865) [-1804.671] (-1803.498) -- 0:00:00

      Average standard deviation of split frequencies: 0.084179

      10500 -- [-1803.463] (-1805.179) (-1803.020) (-1805.227) * (-1799.098) (-1804.509) [-1798.499] (-1803.364) -- 0:01:34
      11000 -- (-1806.716) (-1807.188) [-1802.749] (-1804.678) * (-1805.221) [-1805.712] (-1806.483) (-1804.465) -- 0:01:29
      11500 -- [-1799.786] (-1803.268) (-1799.140) (-1801.002) * (-1807.096) [-1801.248] (-1797.639) (-1804.063) -- 0:01:25
      12000 -- (-1804.788) (-1813.135) [-1801.523] (-1810.324) * [-1798.604] (-1819.581) (-1799.645) (-1804.372) -- 0:01:22
      12500 -- (-1796.393) [-1801.854] (-1812.306) (-1809.227) * (-1803.201) (-1801.075) [-1802.704] (-1803.336) -- 0:01:19
      13000 -- [-1806.082] (-1807.765) (-1806.117) (-1808.714) * (-1804.378) (-1823.887) (-1798.570) [-1810.540] -- 0:01:15
      13500 -- (-1802.222) (-1802.579) (-1803.391) [-1797.253] * (-1808.858) (-1797.556) (-1806.010) [-1799.995] -- 0:01:13
      14000 -- (-1804.912) (-1810.834) [-1799.924] (-1803.850) * (-1803.436) (-1801.687) [-1799.811] (-1804.226) -- 0:01:10
      14500 -- (-1798.385) (-1801.557) (-1803.684) [-1803.808] * [-1805.378] (-1799.362) (-1811.197) (-1802.095) -- 0:01:07
      15000 -- (-1809.124) [-1799.842] (-1804.445) (-1803.318) * [-1805.363] (-1797.210) (-1801.148) (-1804.606) -- 0:01:05

      Average standard deviation of split frequencies: 0.073657

      15500 -- (-1801.323) (-1806.413) (-1803.424) [-1799.935] * (-1802.584) [-1797.816] (-1799.436) (-1802.586) -- 0:01:03
      16000 -- (-1800.379) [-1802.863] (-1799.502) (-1804.214) * [-1805.728] (-1800.137) (-1798.342) (-1800.107) -- 0:01:01
      16500 -- (-1800.563) (-1801.904) (-1808.136) [-1799.433] * (-1806.222) (-1797.395) [-1798.940] (-1807.092) -- 0:00:59
      17000 -- (-1805.448) [-1800.372] (-1805.480) (-1804.283) * [-1806.493] (-1799.149) (-1797.021) (-1802.396) -- 0:00:57
      17500 -- (-1803.532) (-1803.972) (-1803.132) [-1800.489] * [-1806.105] (-1798.444) (-1798.284) (-1803.999) -- 0:00:56
      18000 -- (-1803.146) (-1803.799) (-1803.109) [-1802.677] * (-1805.078) (-1797.872) [-1798.039] (-1799.354) -- 0:00:54
      18500 -- (-1800.422) [-1800.511] (-1798.006) (-1803.772) * [-1799.887] (-1796.814) (-1797.904) (-1800.499) -- 0:00:53
      19000 -- (-1809.522) [-1801.937] (-1802.819) (-1804.097) * (-1798.260) [-1795.932] (-1797.934) (-1803.624) -- 0:00:51
      19500 -- (-1801.749) [-1805.434] (-1809.162) (-1802.908) * (-1795.985) (-1796.599) (-1798.385) [-1802.238] -- 0:00:50
      20000 -- (-1805.191) [-1801.134] (-1797.925) (-1798.469) * [-1800.538] (-1797.167) (-1796.666) (-1803.385) -- 0:00:49

      Average standard deviation of split frequencies: 0.060135

      20500 -- (-1803.070) [-1805.724] (-1800.095) (-1797.548) * (-1800.340) (-1798.849) (-1797.976) [-1805.423] -- 0:00:47
      21000 -- (-1803.929) [-1803.390] (-1801.273) (-1799.111) * (-1800.808) [-1797.849] (-1798.011) (-1803.299) -- 0:00:46
      21500 -- [-1798.596] (-1805.302) (-1805.280) (-1799.028) * (-1801.884) (-1799.919) (-1798.607) [-1800.579] -- 0:00:45
      22000 -- (-1803.632) [-1797.428] (-1798.946) (-1804.881) * (-1809.026) (-1799.147) (-1800.135) [-1803.095] -- 0:00:44
      22500 -- (-1805.269) (-1799.427) (-1801.118) [-1801.301] * (-1803.566) (-1802.584) (-1801.485) [-1802.345] -- 0:00:43
      23000 -- (-1808.025) [-1803.546] (-1806.393) (-1801.113) * (-1801.589) [-1801.520] (-1798.704) (-1801.678) -- 0:00:42
      23500 -- (-1813.893) [-1802.879] (-1804.975) (-1800.716) * (-1798.204) (-1802.671) (-1798.290) [-1801.466] -- 0:00:41
      24000 -- (-1801.828) [-1796.026] (-1802.543) (-1799.718) * (-1798.788) (-1798.839) (-1796.429) [-1812.429] -- 0:01:21
      24500 -- (-1800.658) [-1802.699] (-1801.481) (-1796.915) * (-1797.899) (-1800.374) (-1798.687) [-1802.948] -- 0:01:19
      25000 -- (-1805.634) [-1800.483] (-1805.201) (-1797.926) * (-1800.179) [-1798.237] (-1801.434) (-1802.526) -- 0:01:18

      Average standard deviation of split frequencies: 0.051096

      25500 -- (-1800.476) [-1805.921] (-1800.415) (-1799.716) * (-1797.042) (-1801.779) [-1802.103] (-1800.907) -- 0:01:16
      26000 -- (-1803.602) [-1800.342] (-1799.508) (-1798.302) * (-1798.033) (-1801.835) (-1806.665) [-1810.220] -- 0:01:14
      26500 -- [-1801.280] (-1809.473) (-1801.721) (-1801.678) * [-1796.586] (-1797.244) (-1798.444) (-1814.078) -- 0:01:13
      27000 -- (-1801.996) [-1801.921] (-1801.747) (-1799.048) * (-1798.764) (-1797.408) [-1795.611] (-1808.632) -- 0:01:12
      27500 -- (-1801.360) (-1809.293) [-1800.611] (-1800.671) * (-1798.479) (-1798.294) (-1798.503) [-1800.471] -- 0:01:10
      28000 -- [-1801.687] (-1799.676) (-1797.536) (-1798.437) * [-1797.378] (-1797.917) (-1800.093) (-1804.738) -- 0:01:09
      28500 -- [-1798.850] (-1802.926) (-1798.372) (-1800.239) * (-1797.684) (-1796.692) (-1799.511) [-1798.318] -- 0:01:08
      29000 -- [-1803.274] (-1807.417) (-1799.233) (-1799.258) * (-1798.541) [-1796.650] (-1798.016) (-1804.220) -- 0:01:06
      29500 -- (-1802.886) [-1801.352] (-1798.121) (-1798.463) * (-1795.302) (-1797.536) [-1795.595] (-1804.155) -- 0:01:05
      30000 -- [-1803.915] (-1816.011) (-1799.111) (-1799.699) * (-1797.294) [-1798.744] (-1799.574) (-1800.060) -- 0:01:04

      Average standard deviation of split frequencies: 0.043920

      30500 -- (-1803.355) [-1796.846] (-1797.754) (-1797.686) * (-1797.839) [-1797.846] (-1798.331) (-1803.007) -- 0:01:03
      31000 -- (-1801.613) [-1801.399] (-1799.139) (-1798.858) * [-1796.622] (-1797.144) (-1798.653) (-1804.576) -- 0:01:02
      31500 -- (-1800.256) (-1801.619) [-1798.689] (-1798.414) * (-1799.493) (-1798.186) (-1797.371) [-1806.096] -- 0:01:01
      32000 -- (-1799.746) [-1804.591] (-1800.467) (-1798.190) * (-1802.039) (-1800.038) (-1797.491) [-1798.583] -- 0:01:00
      32500 -- (-1805.345) (-1803.444) [-1799.716] (-1798.715) * (-1800.843) [-1800.000] (-1797.474) (-1798.139) -- 0:00:59
      33000 -- [-1806.694] (-1802.889) (-1799.353) (-1798.310) * (-1795.564) (-1797.771) (-1797.307) [-1799.019] -- 0:00:58
      33500 -- (-1802.596) [-1803.749] (-1798.647) (-1796.993) * [-1801.269] (-1798.082) (-1803.725) (-1798.950) -- 0:00:57
      34000 -- (-1808.469) [-1800.914] (-1798.433) (-1795.972) * (-1797.232) [-1796.593] (-1801.351) (-1802.146) -- 0:00:56
      34500 -- (-1813.037) [-1800.745] (-1798.530) (-1796.283) * (-1798.730) [-1797.834] (-1798.144) (-1799.411) -- 0:00:55
      35000 -- [-1806.130] (-1806.359) (-1799.915) (-1799.326) * (-1800.458) (-1799.706) [-1795.999] (-1799.090) -- 0:00:55

      Average standard deviation of split frequencies: 0.036010

      35500 -- [-1805.009] (-1808.000) (-1798.020) (-1797.054) * (-1797.821) (-1798.932) (-1799.519) [-1799.034] -- 0:00:54
      36000 -- (-1801.236) (-1801.068) (-1797.886) [-1796.529] * (-1799.248) [-1798.440] (-1798.140) (-1797.576) -- 0:00:53
      36500 -- (-1805.329) [-1804.184] (-1797.178) (-1799.692) * (-1801.035) [-1797.827] (-1797.068) (-1798.407) -- 0:00:52
      37000 -- (-1804.057) (-1796.335) (-1799.768) [-1795.526] * (-1799.469) (-1797.368) [-1798.109] (-1798.418) -- 0:00:52
      37500 -- (-1816.906) (-1804.299) [-1800.841] (-1799.597) * (-1797.828) (-1799.139) (-1799.053) [-1801.690] -- 0:00:51
      38000 -- (-1811.485) [-1804.971] (-1801.687) (-1797.958) * (-1797.932) (-1797.942) (-1802.944) [-1801.282] -- 0:00:50
      38500 -- (-1803.388) [-1814.220] (-1796.989) (-1801.407) * (-1799.115) (-1797.510) [-1801.298] (-1801.986) -- 0:01:14
      39000 -- [-1800.824] (-1803.721) (-1798.525) (-1805.412) * (-1801.203) (-1796.941) (-1802.997) [-1800.252] -- 0:01:13
      39500 -- (-1800.966) (-1807.102) (-1799.051) [-1803.631] * (-1801.978) (-1797.544) (-1801.756) [-1798.684] -- 0:01:12
      40000 -- (-1801.329) (-1804.547) [-1797.930] (-1800.075) * (-1799.046) [-1799.387] (-1804.018) (-1799.628) -- 0:01:12

      Average standard deviation of split frequencies: 0.037826

      40500 -- (-1798.424) (-1806.790) (-1798.997) [-1803.103] * (-1797.221) [-1799.336] (-1804.013) (-1800.255) -- 0:01:11
      41000 -- (-1798.913) (-1803.118) [-1797.436] (-1802.040) * [-1797.675] (-1798.797) (-1799.601) (-1800.849) -- 0:01:10
      41500 -- (-1798.306) (-1805.419) (-1797.616) [-1802.142] * [-1798.030] (-1800.124) (-1801.054) (-1796.440) -- 0:01:09
      42000 -- [-1797.659] (-1802.164) (-1799.258) (-1804.415) * [-1797.821] (-1799.789) (-1802.639) (-1799.355) -- 0:01:08
      42500 -- (-1798.144) (-1800.824) (-1801.081) [-1798.977] * [-1798.558] (-1800.854) (-1803.300) (-1798.718) -- 0:01:07
      43000 -- (-1797.874) [-1802.120] (-1802.784) (-1798.721) * (-1800.023) (-1799.028) (-1802.995) [-1798.356] -- 0:01:06
      43500 -- (-1798.093) [-1803.465] (-1804.341) (-1801.843) * (-1799.448) (-1799.382) (-1800.186) [-1798.406] -- 0:01:05
      44000 -- (-1798.453) (-1813.144) (-1804.215) [-1800.894] * (-1801.052) (-1797.772) [-1798.205] (-1797.956) -- 0:01:05
      44500 -- [-1797.724] (-1798.742) (-1800.473) (-1798.204) * (-1800.286) (-1798.657) [-1798.778] (-1798.675) -- 0:01:04
      45000 -- [-1797.794] (-1803.060) (-1798.595) (-1799.829) * (-1798.591) [-1797.697] (-1798.077) (-1799.695) -- 0:01:03

      Average standard deviation of split frequencies: 0.037088

      45500 -- (-1796.386) [-1800.428] (-1798.379) (-1799.309) * (-1798.260) (-1802.384) (-1797.831) [-1799.879] -- 0:01:02
      46000 -- [-1798.270] (-1800.809) (-1798.273) (-1799.878) * (-1798.438) (-1802.317) (-1804.339) [-1802.064] -- 0:01:02
      46500 -- (-1800.020) (-1805.300) (-1797.317) [-1798.806] * (-1798.168) (-1802.965) (-1802.068) [-1801.050] -- 0:01:01
      47000 -- (-1798.746) (-1804.652) (-1795.972) [-1800.163] * [-1801.731] (-1800.325) (-1801.691) (-1800.490) -- 0:01:00
      47500 -- (-1796.105) (-1800.769) (-1796.630) [-1797.228] * (-1798.769) [-1800.193] (-1801.177) (-1800.313) -- 0:01:00
      48000 -- (-1797.711) [-1811.813] (-1799.220) (-1803.180) * (-1802.768) [-1798.907] (-1802.275) (-1799.813) -- 0:00:59
      48500 -- (-1798.345) [-1799.076] (-1800.131) (-1799.141) * [-1800.550] (-1800.374) (-1799.695) (-1799.229) -- 0:00:58
      49000 -- (-1800.090) (-1802.526) [-1796.196] (-1799.591) * (-1803.785) (-1803.972) (-1798.775) [-1798.051] -- 0:00:58
      49500 -- (-1799.630) (-1805.630) (-1795.571) [-1799.195] * (-1799.190) [-1802.696] (-1800.006) (-1797.364) -- 0:00:57
      50000 -- (-1797.239) [-1799.315] (-1801.080) (-1800.642) * (-1798.994) [-1800.423] (-1802.309) (-1796.981) -- 0:00:57

      Average standard deviation of split frequencies: 0.031013

      50500 -- (-1801.816) (-1807.265) [-1798.858] (-1798.914) * (-1798.916) [-1798.873] (-1800.532) (-1798.440) -- 0:00:56
      51000 -- [-1796.620] (-1800.728) (-1799.467) (-1798.850) * (-1801.383) (-1798.516) [-1799.148] (-1797.553) -- 0:00:55
      51500 -- (-1797.195) (-1803.947) (-1800.852) [-1798.415] * (-1797.958) (-1800.297) [-1795.590] (-1796.153) -- 0:00:55
      52000 -- [-1799.349] (-1800.704) (-1797.900) (-1798.037) * (-1800.172) [-1799.255] (-1800.252) (-1798.059) -- 0:00:54
      52500 -- (-1798.722) [-1805.938] (-1801.222) (-1797.594) * (-1801.591) (-1801.215) (-1802.127) [-1798.252] -- 0:00:54
      53000 -- [-1797.287] (-1800.503) (-1797.095) (-1802.028) * (-1797.961) (-1798.664) [-1797.037] (-1798.383) -- 0:01:11
      53500 -- (-1796.933) (-1802.684) (-1798.419) [-1797.764] * (-1798.293) (-1798.519) (-1799.394) [-1798.434] -- 0:01:10
      54000 -- (-1800.049) (-1807.969) (-1799.036) [-1798.429] * (-1797.914) [-1803.058] (-1800.143) (-1798.080) -- 0:01:10
      54500 -- (-1798.936) [-1804.467] (-1798.869) (-1800.010) * (-1801.450) (-1802.115) (-1799.003) [-1798.738] -- 0:01:09
      55000 -- (-1798.067) (-1805.472) [-1798.511] (-1800.048) * (-1800.868) (-1800.501) (-1800.569) [-1799.230] -- 0:01:08

      Average standard deviation of split frequencies: 0.031457

      55500 -- (-1798.793) [-1800.654] (-1800.991) (-1799.756) * (-1804.526) (-1796.386) (-1798.528) [-1798.903] -- 0:01:08
      56000 -- (-1801.170) (-1808.407) [-1799.309] (-1799.682) * (-1798.717) (-1798.268) [-1796.981] (-1798.282) -- 0:01:07
      56500 -- (-1800.662) (-1807.149) (-1799.150) [-1799.348] * [-1798.067] (-1798.867) (-1799.106) (-1795.635) -- 0:01:06
      57000 -- (-1800.134) (-1802.483) (-1800.284) [-1799.349] * (-1800.668) [-1799.094] (-1798.081) (-1798.255) -- 0:01:06
      57500 -- (-1799.023) (-1801.393) [-1798.473] (-1802.556) * (-1801.910) (-1798.223) [-1798.654] (-1798.832) -- 0:01:05
      58000 -- (-1800.068) [-1800.829] (-1797.944) (-1798.260) * (-1804.331) [-1797.904] (-1800.405) (-1797.466) -- 0:01:04
      58500 -- (-1800.068) (-1802.308) [-1797.805] (-1802.562) * (-1797.829) [-1800.041] (-1801.692) (-1796.724) -- 0:01:04
      59000 -- (-1800.195) (-1804.506) (-1798.428) [-1799.898] * [-1796.828] (-1800.380) (-1802.929) (-1800.908) -- 0:01:03
      59500 -- (-1797.534) (-1801.399) [-1797.903] (-1797.550) * (-1798.617) [-1799.112] (-1801.432) (-1800.277) -- 0:01:03
      60000 -- (-1798.136) (-1812.687) (-1797.494) [-1797.984] * (-1798.997) (-1799.698) (-1798.451) [-1804.235] -- 0:01:02

      Average standard deviation of split frequencies: 0.030673

      60500 -- (-1798.736) (-1807.779) [-1798.110] (-1798.544) * [-1798.666] (-1802.160) (-1799.777) (-1801.554) -- 0:01:02
      61000 -- (-1797.538) [-1800.231] (-1800.767) (-1798.905) * (-1799.045) (-1798.554) [-1798.071] (-1797.864) -- 0:01:01
      61500 -- [-1799.929] (-1806.077) (-1800.269) (-1798.764) * (-1801.582) (-1798.606) [-1798.841] (-1799.730) -- 0:01:01
      62000 -- (-1797.539) [-1800.370] (-1799.706) (-1802.385) * [-1801.149] (-1799.101) (-1798.826) (-1800.047) -- 0:01:00
      62500 -- [-1798.472] (-1803.375) (-1798.978) (-1801.520) * (-1801.896) (-1801.223) [-1801.020] (-1799.013) -- 0:01:00
      63000 -- [-1802.411] (-1801.692) (-1799.920) (-1802.876) * (-1798.862) (-1800.200) [-1802.358] (-1798.611) -- 0:00:59
      63500 -- (-1799.687) [-1800.114] (-1800.001) (-1801.663) * [-1798.139] (-1800.828) (-1796.965) (-1803.241) -- 0:00:58
      64000 -- [-1799.402] (-1807.190) (-1801.780) (-1802.197) * (-1798.488) (-1796.613) [-1798.529] (-1798.522) -- 0:00:58
      64500 -- (-1802.515) (-1800.224) (-1800.593) [-1799.195] * (-1800.063) (-1797.400) (-1801.623) [-1805.133] -- 0:00:58
      65000 -- (-1798.699) [-1803.436] (-1801.165) (-1800.111) * [-1798.917] (-1796.243) (-1802.131) (-1799.470) -- 0:00:57

      Average standard deviation of split frequencies: 0.030713

      65500 -- [-1798.804] (-1806.067) (-1798.478) (-1800.703) * (-1805.072) [-1796.746] (-1802.918) (-1801.593) -- 0:00:57
      66000 -- (-1797.751) [-1800.115] (-1800.622) (-1800.575) * (-1797.268) [-1797.285] (-1796.042) (-1801.097) -- 0:00:56
      66500 -- [-1798.271] (-1800.262) (-1798.646) (-1802.319) * (-1796.460) [-1799.121] (-1799.616) (-1800.885) -- 0:00:56
      67000 -- (-1798.279) (-1804.715) (-1798.235) [-1798.338] * (-1796.854) [-1797.006] (-1797.667) (-1799.644) -- 0:01:09
      67500 -- (-1799.658) (-1804.027) (-1798.804) [-1797.233] * (-1800.381) [-1798.857] (-1803.829) (-1799.232) -- 0:01:09
      68000 -- (-1800.777) (-1803.611) (-1800.976) [-1800.316] * (-1798.462) (-1798.658) [-1802.075] (-1799.447) -- 0:01:08
      68500 -- [-1800.368] (-1813.648) (-1800.006) (-1800.313) * [-1796.291] (-1798.834) (-1802.995) (-1800.647) -- 0:01:07
      69000 -- (-1798.902) (-1809.304) (-1799.253) [-1798.389] * (-1801.418) [-1799.647] (-1802.235) (-1798.840) -- 0:01:07
      69500 -- (-1799.201) [-1802.659] (-1799.551) (-1800.873) * (-1798.426) [-1797.405] (-1798.676) (-1799.855) -- 0:01:06
      70000 -- (-1799.758) (-1805.430) (-1798.449) [-1797.881] * (-1798.269) [-1796.746] (-1798.072) (-1798.302) -- 0:01:06

      Average standard deviation of split frequencies: 0.031950

      70500 -- (-1798.559) [-1800.350] (-1798.914) (-1796.110) * [-1798.879] (-1803.037) (-1797.206) (-1800.742) -- 0:01:05
      71000 -- (-1798.207) [-1803.172] (-1798.421) (-1799.138) * (-1796.598) (-1801.593) [-1799.663] (-1801.905) -- 0:01:05
      71500 -- (-1800.313) (-1802.241) [-1797.927] (-1797.141) * (-1800.113) [-1803.880] (-1798.822) (-1800.058) -- 0:01:04
      72000 -- (-1802.114) (-1803.191) [-1799.470] (-1798.015) * (-1796.957) [-1797.908] (-1799.155) (-1799.275) -- 0:01:04
      72500 -- (-1808.418) (-1800.772) [-1796.774] (-1799.905) * [-1798.569] (-1797.581) (-1799.728) (-1799.461) -- 0:01:03
      73000 -- (-1798.869) (-1800.961) [-1797.964] (-1800.263) * [-1797.753] (-1799.019) (-1799.054) (-1799.669) -- 0:01:03
      73500 -- (-1801.877) [-1801.949] (-1796.077) (-1798.685) * (-1800.293) (-1804.164) [-1796.611] (-1799.343) -- 0:01:03
      74000 -- (-1801.815) (-1804.476) [-1802.176] (-1795.497) * (-1801.164) [-1802.661] (-1796.455) (-1799.820) -- 0:01:02
      74500 -- (-1798.460) [-1805.096] (-1803.903) (-1797.661) * (-1801.447) (-1803.566) (-1799.107) [-1798.947] -- 0:01:02
      75000 -- (-1800.733) [-1804.041] (-1803.557) (-1801.304) * (-1801.216) (-1799.890) [-1798.895] (-1802.502) -- 0:01:01

      Average standard deviation of split frequencies: 0.029381

      75500 -- (-1800.192) (-1805.394) (-1798.973) [-1800.388] * (-1799.095) (-1797.942) (-1798.907) [-1798.452] -- 0:01:01
      76000 -- (-1803.035) (-1803.895) (-1799.573) [-1797.442] * [-1798.467] (-1798.582) (-1801.681) (-1798.345) -- 0:01:00
      76500 -- (-1801.528) (-1805.078) (-1798.689) [-1798.817] * (-1798.960) (-1798.549) [-1800.215] (-1798.051) -- 0:01:00
      77000 -- (-1799.402) (-1803.331) [-1799.028] (-1798.743) * (-1798.140) [-1799.279] (-1798.263) (-1796.673) -- 0:00:59
      77500 -- (-1798.692) [-1800.337] (-1800.898) (-1799.165) * (-1800.749) (-1798.248) [-1798.998] (-1797.967) -- 0:00:59
      78000 -- (-1798.548) (-1801.802) [-1800.790] (-1797.518) * (-1798.594) (-1801.392) [-1798.310] (-1798.056) -- 0:00:59
      78500 -- [-1796.998] (-1800.523) (-1805.112) (-1797.772) * [-1800.089] (-1800.333) (-1799.068) (-1798.404) -- 0:00:58
      79000 -- (-1797.449) (-1802.782) (-1799.439) [-1796.682] * [-1797.897] (-1799.596) (-1800.764) (-1800.297) -- 0:00:58
      79500 -- [-1797.897] (-1806.402) (-1798.988) (-1798.457) * (-1798.815) (-1799.695) (-1803.926) [-1798.210] -- 0:00:57
      80000 -- (-1798.283) [-1800.323] (-1798.339) (-1798.300) * [-1802.211] (-1800.071) (-1799.705) (-1798.698) -- 0:00:57

      Average standard deviation of split frequencies: 0.026813

      80500 -- (-1798.437) [-1812.449] (-1800.001) (-1799.618) * (-1799.678) [-1799.212] (-1798.965) (-1799.252) -- 0:00:57
      81000 -- (-1801.969) (-1801.170) [-1799.866] (-1797.982) * [-1802.000] (-1801.275) (-1799.449) (-1799.444) -- 0:00:56
      81500 -- (-1800.488) [-1799.775] (-1798.940) (-1799.246) * (-1802.894) [-1795.937] (-1798.792) (-1799.295) -- 0:01:07
      82000 -- (-1798.512) (-1805.926) [-1796.788] (-1800.985) * (-1797.425) (-1796.572) (-1798.448) [-1801.271] -- 0:01:07
      82500 -- (-1800.753) [-1804.520] (-1797.340) (-1798.722) * [-1798.732] (-1799.082) (-1799.460) (-1799.432) -- 0:01:06
      83000 -- (-1800.917) (-1813.752) (-1802.317) [-1801.596] * (-1796.739) (-1801.103) [-1799.729] (-1798.354) -- 0:01:06
      83500 -- (-1801.692) (-1805.931) [-1798.534] (-1800.114) * (-1798.164) [-1798.655] (-1799.739) (-1798.906) -- 0:01:05
      84000 -- (-1799.426) [-1805.283] (-1800.054) (-1796.332) * (-1798.771) (-1799.168) (-1802.003) [-1799.237] -- 0:01:05
      84500 -- (-1799.078) [-1799.065] (-1799.751) (-1799.166) * (-1799.556) (-1798.095) (-1798.651) [-1796.495] -- 0:01:05
      85000 -- (-1798.200) [-1808.877] (-1800.429) (-1796.297) * (-1799.228) (-1799.465) (-1798.390) [-1797.349] -- 0:01:04

      Average standard deviation of split frequencies: 0.028930

      85500 -- [-1800.774] (-1801.827) (-1799.867) (-1797.082) * (-1801.231) (-1797.977) (-1798.471) [-1801.541] -- 0:01:04
      86000 -- (-1800.070) (-1798.064) (-1799.701) [-1798.035] * (-1798.275) (-1795.793) [-1798.482] (-1800.674) -- 0:01:03
      86500 -- (-1800.758) (-1802.405) (-1799.506) [-1799.572] * (-1800.066) (-1799.787) (-1797.613) [-1797.129] -- 0:01:03
      87000 -- [-1797.691] (-1805.430) (-1801.210) (-1797.701) * (-1798.022) (-1801.562) (-1799.496) [-1798.269] -- 0:01:02
      87500 -- (-1798.367) (-1804.474) (-1799.216) [-1799.809] * (-1799.135) (-1798.665) [-1799.817] (-1797.159) -- 0:01:02
      88000 -- (-1797.446) [-1803.792] (-1798.823) (-1799.338) * (-1800.862) (-1797.466) [-1799.184] (-1798.934) -- 0:01:02
      88500 -- (-1801.018) (-1798.816) (-1800.487) [-1798.390] * (-1800.427) (-1799.401) (-1800.792) [-1798.923] -- 0:01:01
      89000 -- (-1798.672) (-1796.072) [-1802.488] (-1802.048) * (-1799.189) [-1800.716] (-1802.419) (-1800.051) -- 0:01:01
      89500 -- (-1799.795) (-1801.303) (-1798.693) [-1798.362] * (-1801.196) [-1800.856] (-1798.037) (-1802.788) -- 0:01:01
      90000 -- (-1799.705) [-1799.202] (-1799.229) (-1796.308) * (-1800.248) (-1797.870) (-1801.376) [-1797.719] -- 0:01:00

      Average standard deviation of split frequencies: 0.023975

      90500 -- [-1799.247] (-1798.174) (-1800.531) (-1799.161) * (-1798.787) [-1797.461] (-1804.103) (-1799.263) -- 0:01:00
      91000 -- (-1799.257) [-1798.447] (-1798.953) (-1798.704) * (-1798.868) [-1797.874] (-1802.851) (-1798.778) -- 0:00:59
      91500 -- [-1797.476] (-1798.842) (-1796.733) (-1799.629) * (-1798.922) (-1798.449) [-1797.124] (-1797.969) -- 0:00:59
      92000 -- (-1798.244) (-1802.440) [-1797.787] (-1796.456) * (-1798.216) (-1797.113) [-1797.247] (-1799.735) -- 0:00:59
      92500 -- (-1800.061) (-1801.545) (-1801.006) [-1796.747] * (-1797.510) [-1799.873] (-1798.114) (-1798.156) -- 0:00:58
      93000 -- [-1797.727] (-1798.954) (-1801.032) (-1799.403) * (-1799.621) [-1797.755] (-1802.634) (-1800.465) -- 0:00:58
      93500 -- (-1798.120) [-1798.273] (-1799.719) (-1799.045) * (-1800.601) [-1798.798] (-1802.240) (-1798.132) -- 0:00:58
      94000 -- (-1797.681) (-1795.060) (-1798.213) [-1797.955] * (-1799.112) (-1797.404) (-1800.167) [-1800.219] -- 0:00:57
      94500 -- (-1800.086) [-1799.132] (-1798.147) (-1796.604) * (-1799.372) (-1798.804) [-1797.139] (-1798.323) -- 0:00:57
      95000 -- [-1802.681] (-1801.622) (-1797.649) (-1797.669) * (-1797.752) (-1799.788) [-1798.650] (-1797.924) -- 0:00:57

      Average standard deviation of split frequencies: 0.022643

      95500 -- (-1803.466) (-1802.121) (-1798.368) [-1797.387] * [-1798.636] (-1796.697) (-1799.706) (-1798.796) -- 0:00:56
      96000 -- (-1802.263) [-1800.134] (-1798.904) (-1798.360) * [-1797.166] (-1799.867) (-1797.129) (-1799.056) -- 0:01:05
      96500 -- [-1799.504] (-1797.200) (-1799.589) (-1800.818) * (-1799.966) [-1796.349] (-1799.509) (-1795.686) -- 0:01:05
      97000 -- (-1798.662) (-1798.644) (-1798.276) [-1801.076] * (-1799.073) (-1796.212) [-1802.288] (-1799.260) -- 0:01:05
      97500 -- (-1801.438) (-1796.130) (-1805.890) [-1800.511] * (-1801.441) (-1798.181) (-1802.253) [-1797.171] -- 0:01:04
      98000 -- (-1799.614) (-1798.704) [-1804.834] (-1798.451) * (-1799.363) (-1800.231) (-1797.684) [-1799.347] -- 0:01:04
      98500 -- (-1800.590) [-1796.957] (-1801.508) (-1801.086) * (-1800.174) (-1797.980) [-1797.289] (-1802.343) -- 0:01:04
      99000 -- [-1800.412] (-1798.977) (-1798.104) (-1800.622) * [-1799.480] (-1797.712) (-1798.884) (-1802.205) -- 0:01:03
      99500 -- (-1799.631) [-1797.864] (-1799.671) (-1800.965) * (-1798.713) [-1795.874] (-1796.175) (-1801.812) -- 0:01:03
      100000 -- [-1798.482] (-1797.208) (-1798.561) (-1803.001) * (-1798.998) (-1798.209) [-1799.170] (-1798.533) -- 0:01:02

      Average standard deviation of split frequencies: 0.021761

      100500 -- (-1798.156) (-1796.389) (-1801.070) [-1801.522] * (-1799.228) (-1800.229) [-1800.105] (-1798.098) -- 0:01:02
      101000 -- (-1799.236) [-1798.658] (-1802.912) (-1798.980) * (-1797.974) [-1798.638] (-1798.508) (-1802.612) -- 0:01:02
      101500 -- [-1798.616] (-1799.848) (-1801.722) (-1798.231) * (-1800.115) (-1800.889) [-1798.894] (-1799.054) -- 0:01:01
      102000 -- (-1799.083) (-1797.855) (-1802.240) [-1799.053] * (-1800.266) (-1801.485) [-1799.354] (-1797.526) -- 0:01:01
      102500 -- (-1798.158) [-1797.123] (-1802.568) (-1798.017) * (-1798.265) (-1800.800) [-1798.540] (-1796.891) -- 0:01:01
      103000 -- (-1798.144) (-1800.840) [-1800.145] (-1800.605) * [-1797.462] (-1798.546) (-1798.351) (-1797.812) -- 0:01:00
      103500 -- (-1799.720) [-1795.297] (-1798.280) (-1799.955) * [-1798.120] (-1798.968) (-1800.305) (-1797.344) -- 0:01:00
      104000 -- [-1798.103] (-1796.249) (-1797.628) (-1799.982) * (-1798.104) (-1797.910) (-1799.394) [-1797.495] -- 0:01:00
      104500 -- (-1798.728) (-1794.895) (-1800.015) [-1799.793] * (-1797.982) [-1796.626] (-1798.080) (-1800.250) -- 0:00:59
      105000 -- (-1800.041) [-1795.652] (-1798.040) (-1803.350) * [-1799.655] (-1799.187) (-1803.109) (-1798.160) -- 0:00:59

      Average standard deviation of split frequencies: 0.019620

      105500 -- (-1799.506) (-1798.147) [-1799.003] (-1803.192) * (-1797.119) (-1798.912) (-1798.193) [-1799.555] -- 0:00:59
      106000 -- [-1801.389] (-1796.565) (-1800.515) (-1797.813) * (-1798.212) [-1797.058] (-1798.039) (-1798.637) -- 0:00:59
      106500 -- (-1798.371) [-1797.322] (-1801.612) (-1800.511) * (-1797.850) [-1799.807] (-1801.006) (-1799.841) -- 0:00:58
      107000 -- (-1798.625) [-1796.467] (-1803.338) (-1798.468) * (-1797.679) (-1800.228) (-1801.966) [-1798.824] -- 0:00:58
      107500 -- [-1799.610] (-1798.768) (-1798.753) (-1797.745) * (-1797.347) (-1806.001) (-1802.033) [-1798.583] -- 0:00:58
      108000 -- (-1799.459) (-1798.246) [-1798.094] (-1798.325) * (-1798.021) (-1805.234) (-1801.780) [-1797.551] -- 0:00:57
      108500 -- (-1799.005) (-1798.839) (-1800.052) [-1797.487] * (-1799.151) (-1796.395) [-1799.153] (-1800.409) -- 0:00:57
      109000 -- (-1799.588) (-1796.219) (-1801.206) [-1795.703] * [-1798.039] (-1796.492) (-1798.320) (-1799.965) -- 0:00:57
      109500 -- (-1799.048) (-1795.694) (-1801.171) [-1797.823] * (-1800.967) [-1798.763] (-1798.861) (-1799.705) -- 0:00:56
      110000 -- (-1799.253) [-1796.118] (-1802.401) (-1798.334) * (-1800.785) (-1800.542) (-1798.088) [-1800.038] -- 0:00:56

      Average standard deviation of split frequencies: 0.020825

      110500 -- (-1798.970) (-1796.062) (-1801.330) [-1797.736] * (-1798.715) [-1797.857] (-1799.165) (-1797.354) -- 0:01:04
      111000 -- (-1798.582) [-1801.814] (-1800.788) (-1798.192) * (-1797.936) [-1797.516] (-1800.672) (-1802.193) -- 0:01:04
      111500 -- (-1798.530) (-1802.227) (-1798.362) [-1800.422] * (-1798.761) [-1795.747] (-1801.096) (-1800.434) -- 0:01:03
      112000 -- (-1799.204) [-1797.516] (-1797.506) (-1798.803) * (-1798.956) [-1797.086] (-1797.918) (-1799.491) -- 0:01:03
      112500 -- (-1802.250) (-1796.995) (-1798.097) [-1798.338] * (-1800.064) (-1796.900) (-1797.730) [-1798.873] -- 0:01:03
      113000 -- (-1799.145) (-1797.809) [-1799.531] (-1798.875) * (-1799.809) [-1797.397] (-1800.713) (-1799.490) -- 0:01:02
      113500 -- (-1798.194) (-1799.607) (-1797.452) [-1798.696] * (-1801.219) (-1798.566) [-1796.744] (-1796.654) -- 0:01:02
      114000 -- (-1798.373) [-1797.073] (-1797.231) (-1801.105) * (-1801.401) [-1796.983] (-1797.754) (-1796.487) -- 0:01:02
      114500 -- (-1800.668) (-1800.938) [-1799.844] (-1799.485) * (-1797.944) (-1796.693) [-1797.350] (-1798.433) -- 0:01:01
      115000 -- (-1797.208) [-1800.742] (-1797.526) (-1798.388) * (-1798.695) (-1797.942) [-1795.614] (-1797.022) -- 0:01:01

      Average standard deviation of split frequencies: 0.021448

      115500 -- (-1797.372) [-1801.364] (-1797.551) (-1800.659) * (-1797.779) (-1797.538) [-1798.700] (-1798.922) -- 0:01:01
      116000 -- (-1800.323) (-1802.046) [-1798.659] (-1799.605) * (-1798.975) [-1800.929] (-1802.073) (-1801.248) -- 0:01:00
      116500 -- (-1797.150) [-1799.050] (-1801.777) (-1799.148) * (-1799.804) [-1799.398] (-1801.243) (-1799.822) -- 0:01:00
      117000 -- (-1798.095) (-1798.734) [-1796.021] (-1801.406) * (-1798.925) (-1798.937) [-1799.322] (-1799.047) -- 0:01:00
      117500 -- (-1798.642) [-1800.153] (-1798.507) (-1800.710) * (-1797.902) (-1799.555) [-1795.844] (-1801.877) -- 0:01:00
      118000 -- (-1797.894) (-1800.493) (-1799.845) [-1799.527] * (-1798.864) [-1798.289] (-1801.965) (-1803.048) -- 0:00:59
      118500 -- (-1798.767) [-1797.369] (-1796.990) (-1799.266) * (-1800.331) (-1800.489) (-1797.257) [-1800.776] -- 0:00:59
      119000 -- (-1798.352) [-1801.342] (-1799.114) (-1798.924) * (-1798.442) (-1799.427) (-1797.126) [-1796.873] -- 0:00:59
      119500 -- (-1800.210) (-1796.998) [-1798.879] (-1799.279) * (-1798.683) [-1800.526] (-1797.502) (-1800.030) -- 0:00:58
      120000 -- (-1798.272) (-1802.876) [-1798.837] (-1798.925) * (-1798.995) (-1798.358) [-1798.433] (-1798.036) -- 0:00:58

      Average standard deviation of split frequencies: 0.019750

      120500 -- (-1798.663) (-1799.194) [-1797.323] (-1798.496) * (-1797.769) (-1798.110) [-1797.805] (-1798.819) -- 0:00:58
      121000 -- (-1797.708) [-1799.078] (-1801.487) (-1800.789) * [-1797.895] (-1798.827) (-1798.491) (-1797.010) -- 0:00:58
      121500 -- (-1797.773) [-1796.942] (-1797.176) (-1806.725) * (-1798.304) (-1796.778) (-1799.259) [-1799.033] -- 0:00:57
      122000 -- (-1800.045) (-1796.102) [-1797.737] (-1803.347) * (-1799.205) (-1796.724) (-1797.631) [-1795.800] -- 0:00:57
      122500 -- (-1801.199) (-1798.952) [-1798.331] (-1799.630) * (-1798.985) [-1796.668] (-1798.671) (-1797.566) -- 0:00:57
      123000 -- [-1804.438] (-1797.745) (-1799.518) (-1800.005) * (-1798.783) [-1796.730] (-1799.906) (-1798.280) -- 0:00:57
      123500 -- (-1799.771) [-1798.306] (-1798.810) (-1798.866) * [-1799.896] (-1798.373) (-1799.892) (-1796.486) -- 0:00:56
      124000 -- (-1803.596) (-1798.550) (-1799.748) [-1799.786] * [-1803.457] (-1800.680) (-1801.958) (-1797.657) -- 0:00:56
      124500 -- (-1806.278) (-1797.575) (-1800.092) [-1799.350] * (-1801.181) (-1798.396) (-1800.192) [-1800.575] -- 0:01:03
      125000 -- [-1798.432] (-1799.337) (-1798.257) (-1798.044) * (-1799.656) (-1798.858) [-1798.638] (-1800.274) -- 0:01:03

      Average standard deviation of split frequencies: 0.019746

      125500 -- (-1800.097) [-1798.268] (-1798.624) (-1799.291) * (-1801.437) (-1799.765) (-1797.352) [-1798.964] -- 0:01:02
      126000 -- (-1800.152) (-1804.493) [-1798.638] (-1799.712) * (-1798.114) (-1798.746) [-1798.445] (-1797.011) -- 0:01:02
      126500 -- (-1800.391) (-1802.563) (-1801.093) [-1798.904] * (-1798.403) (-1802.280) [-1799.269] (-1798.977) -- 0:01:02
      127000 -- (-1799.317) (-1799.530) (-1801.254) [-1797.490] * (-1800.379) (-1802.882) (-1797.146) [-1799.951] -- 0:01:01
      127500 -- (-1802.610) (-1798.124) (-1799.969) [-1798.893] * (-1800.471) [-1799.564] (-1797.209) (-1799.951) -- 0:01:01
      128000 -- (-1797.948) (-1797.627) (-1799.512) [-1799.850] * (-1800.093) (-1798.468) [-1797.747] (-1799.905) -- 0:01:01
      128500 -- [-1799.456] (-1799.192) (-1800.785) (-1798.317) * (-1797.812) [-1802.160] (-1797.711) (-1801.449) -- 0:01:01
      129000 -- (-1798.774) (-1801.313) [-1802.864] (-1802.322) * (-1798.603) (-1800.413) (-1801.400) [-1803.615] -- 0:01:00
      129500 -- (-1796.704) (-1799.377) (-1802.655) [-1800.577] * (-1797.755) (-1799.142) (-1799.803) [-1802.845] -- 0:01:00
      130000 -- (-1797.046) [-1798.294] (-1798.819) (-1799.841) * [-1797.671] (-1800.379) (-1798.975) (-1799.590) -- 0:01:00

      Average standard deviation of split frequencies: 0.018640

      130500 -- (-1799.647) (-1797.080) [-1797.851] (-1799.380) * (-1796.529) [-1798.843] (-1801.338) (-1797.682) -- 0:00:59
      131000 -- [-1799.140] (-1797.580) (-1802.659) (-1801.474) * (-1797.652) (-1796.763) [-1799.856] (-1803.392) -- 0:00:59
      131500 -- (-1798.896) (-1796.805) [-1799.696] (-1800.028) * (-1797.321) [-1798.493] (-1801.426) (-1797.865) -- 0:00:59
      132000 -- (-1799.618) [-1805.197] (-1800.100) (-1799.049) * (-1798.549) [-1802.857] (-1798.658) (-1797.878) -- 0:00:59
      132500 -- (-1796.987) (-1799.925) [-1799.255] (-1798.573) * (-1796.343) (-1798.639) [-1797.733] (-1797.411) -- 0:00:58
      133000 -- (-1798.384) (-1798.549) (-1801.838) [-1801.008] * [-1800.356] (-1798.160) (-1798.867) (-1799.813) -- 0:00:58
      133500 -- (-1799.614) [-1798.182] (-1801.340) (-1799.169) * (-1799.007) [-1801.653] (-1804.279) (-1797.686) -- 0:00:58
      134000 -- (-1799.578) (-1796.654) [-1798.077] (-1798.038) * (-1798.794) (-1797.680) [-1797.421] (-1798.436) -- 0:00:58
      134500 -- (-1797.726) (-1797.047) [-1797.030] (-1798.690) * (-1798.204) (-1796.951) (-1796.165) [-1797.221] -- 0:00:57
      135000 -- [-1797.181] (-1803.157) (-1799.583) (-1799.301) * (-1800.368) [-1796.404] (-1799.797) (-1798.504) -- 0:00:57

      Average standard deviation of split frequencies: 0.017138

      135500 -- (-1798.677) (-1802.152) (-1797.358) [-1798.484] * (-1798.236) [-1797.496] (-1797.472) (-1798.083) -- 0:00:57
      136000 -- (-1801.512) [-1798.428] (-1797.108) (-1798.255) * (-1801.705) [-1797.180] (-1802.147) (-1798.026) -- 0:00:57
      136500 -- (-1801.720) (-1798.684) [-1798.245] (-1798.196) * [-1798.043] (-1797.224) (-1801.612) (-1796.801) -- 0:00:56
      137000 -- [-1798.102] (-1799.817) (-1798.195) (-1798.657) * (-1799.607) [-1801.549] (-1798.118) (-1797.054) -- 0:00:56
      137500 -- [-1798.343] (-1798.717) (-1798.618) (-1799.377) * (-1796.387) [-1799.430] (-1800.804) (-1800.324) -- 0:00:56
      138000 -- (-1799.643) (-1798.007) (-1799.607) [-1799.816] * [-1799.704] (-1797.316) (-1797.521) (-1800.135) -- 0:00:56
      138500 -- (-1799.934) [-1798.334] (-1801.295) (-1798.904) * (-1799.756) (-1796.198) [-1796.966] (-1801.062) -- 0:00:55
      139000 -- [-1797.876] (-1799.330) (-1802.069) (-1799.916) * (-1800.742) (-1797.028) (-1799.938) [-1799.585] -- 0:01:01
      139500 -- (-1798.142) (-1799.396) (-1803.036) [-1798.092] * [-1798.656] (-1799.395) (-1797.717) (-1799.318) -- 0:01:01
      140000 -- [-1797.198] (-1799.396) (-1803.082) (-1801.897) * (-1801.158) (-1796.475) (-1797.437) [-1799.968] -- 0:01:01

      Average standard deviation of split frequencies: 0.016942

      140500 -- (-1799.211) (-1799.833) [-1798.151] (-1799.182) * (-1802.624) (-1797.027) [-1797.940] (-1798.617) -- 0:01:01
      141000 -- (-1799.802) [-1798.523] (-1798.282) (-1799.939) * [-1800.052] (-1799.438) (-1799.122) (-1799.431) -- 0:01:00
      141500 -- (-1801.148) [-1798.313] (-1798.711) (-1800.986) * (-1797.907) (-1797.567) [-1798.012] (-1798.497) -- 0:01:00
      142000 -- [-1796.750] (-1797.057) (-1799.839) (-1800.809) * (-1797.944) [-1796.615] (-1799.630) (-1800.621) -- 0:01:00
      142500 -- (-1797.934) [-1798.160] (-1799.791) (-1797.960) * (-1803.031) [-1795.448] (-1800.000) (-1802.217) -- 0:01:00
      143000 -- (-1798.795) [-1796.666] (-1804.180) (-1797.979) * (-1800.127) [-1796.524] (-1798.084) (-1808.206) -- 0:00:59
      143500 -- [-1801.828] (-1798.736) (-1801.890) (-1800.141) * (-1798.950) (-1797.311) (-1798.158) [-1802.203] -- 0:00:59
      144000 -- [-1800.435] (-1800.853) (-1798.132) (-1802.023) * (-1797.195) (-1797.128) (-1798.065) [-1802.581] -- 0:00:59
      144500 -- (-1799.263) [-1800.383] (-1795.588) (-1801.350) * [-1798.935] (-1798.625) (-1804.671) (-1798.222) -- 0:00:59
      145000 -- (-1798.385) (-1798.404) [-1797.501] (-1802.607) * (-1802.148) (-1798.337) [-1799.920] (-1798.872) -- 0:00:58

      Average standard deviation of split frequencies: 0.017579

      145500 -- [-1798.194] (-1797.185) (-1798.426) (-1803.247) * (-1802.142) (-1799.405) [-1798.868] (-1798.554) -- 0:00:58
      146000 -- (-1798.869) [-1799.608] (-1797.037) (-1798.488) * (-1799.003) [-1799.257] (-1801.231) (-1797.377) -- 0:00:58
      146500 -- (-1799.541) (-1798.838) (-1797.076) [-1798.155] * [-1798.882] (-1796.310) (-1799.612) (-1797.561) -- 0:00:58
      147000 -- [-1796.929] (-1799.192) (-1796.324) (-1798.276) * (-1802.008) (-1797.297) [-1798.188] (-1799.090) -- 0:00:58
      147500 -- (-1796.992) (-1799.343) (-1801.000) [-1798.665] * (-1801.509) [-1799.146] (-1798.128) (-1799.585) -- 0:00:57
      148000 -- [-1801.410] (-1798.566) (-1797.433) (-1799.175) * (-1798.230) [-1798.825] (-1801.623) (-1800.620) -- 0:00:57
      148500 -- [-1802.800] (-1798.957) (-1800.678) (-1797.193) * (-1803.102) (-1799.622) (-1800.655) [-1800.642] -- 0:00:57
      149000 -- (-1802.547) (-1799.987) [-1799.473] (-1798.367) * [-1799.578] (-1800.289) (-1798.004) (-1800.823) -- 0:00:57
      149500 -- (-1797.684) (-1799.709) [-1800.220] (-1799.913) * (-1805.613) [-1797.386] (-1799.712) (-1801.322) -- 0:00:56
      150000 -- (-1798.449) (-1797.549) [-1796.426] (-1799.137) * [-1800.003] (-1796.525) (-1797.626) (-1800.502) -- 0:00:56

      Average standard deviation of split frequencies: 0.017904

      150500 -- (-1797.808) [-1795.861] (-1796.862) (-1800.560) * (-1799.553) (-1796.214) (-1798.733) [-1799.441] -- 0:00:56
      151000 -- [-1798.636] (-1806.247) (-1797.248) (-1800.649) * (-1798.778) [-1795.773] (-1801.000) (-1797.576) -- 0:00:56
      151500 -- (-1798.686) (-1799.779) (-1796.025) [-1798.314] * (-1800.014) (-1797.897) (-1796.938) [-1797.984] -- 0:00:56
      152000 -- (-1797.880) (-1796.652) [-1798.784] (-1799.686) * (-1799.973) (-1800.272) [-1797.703] (-1800.839) -- 0:00:55
      152500 -- (-1808.028) (-1797.907) (-1797.308) [-1799.389] * (-1800.475) (-1799.110) [-1799.045] (-1800.608) -- 0:00:55
      153000 -- [-1798.950] (-1799.191) (-1799.288) (-1797.138) * [-1798.845] (-1800.067) (-1802.537) (-1802.895) -- 0:01:00
      153500 -- [-1797.908] (-1798.851) (-1800.705) (-1797.687) * (-1800.288) (-1808.203) (-1798.938) [-1803.593] -- 0:01:00
      154000 -- (-1798.285) [-1796.752] (-1800.937) (-1797.831) * (-1800.217) [-1796.304] (-1799.024) (-1799.333) -- 0:01:00
      154500 -- (-1799.370) (-1798.450) [-1796.256] (-1800.776) * [-1799.696] (-1797.228) (-1799.207) (-1798.031) -- 0:01:00
      155000 -- (-1798.523) (-1801.240) [-1797.243] (-1798.201) * (-1799.696) (-1796.612) (-1798.125) [-1797.446] -- 0:00:59

      Average standard deviation of split frequencies: 0.017459

      155500 -- (-1801.534) (-1800.138) [-1796.569] (-1796.154) * (-1799.387) (-1797.970) [-1796.365] (-1797.627) -- 0:00:59
      156000 -- (-1801.281) (-1800.426) [-1801.833] (-1796.468) * (-1799.186) (-1796.633) [-1795.569] (-1797.684) -- 0:00:59
      156500 -- (-1799.711) (-1797.421) (-1796.417) [-1798.492] * (-1799.919) (-1800.087) [-1797.797] (-1798.926) -- 0:00:59
      157000 -- (-1798.592) (-1798.213) [-1796.429] (-1798.974) * (-1799.086) (-1803.048) [-1797.950] (-1797.639) -- 0:00:59
      157500 -- (-1798.080) (-1797.175) (-1795.444) [-1795.644] * [-1800.713] (-1804.659) (-1797.427) (-1798.089) -- 0:00:58
      158000 -- (-1799.602) (-1800.830) (-1797.400) [-1798.261] * (-1800.368) (-1798.562) (-1800.445) [-1797.598] -- 0:00:58
      158500 -- (-1801.102) (-1803.196) [-1799.580] (-1798.700) * (-1806.354) (-1798.287) (-1799.410) [-1798.955] -- 0:00:58
      159000 -- (-1802.055) (-1802.275) (-1800.394) [-1795.650] * [-1800.129] (-1797.177) (-1799.055) (-1800.339) -- 0:00:58
      159500 -- (-1805.230) (-1798.538) [-1797.673] (-1800.357) * (-1799.848) [-1799.546] (-1798.753) (-1800.163) -- 0:00:57
      160000 -- (-1801.628) (-1800.501) (-1797.737) [-1796.523] * [-1799.008] (-1800.169) (-1799.803) (-1799.967) -- 0:00:57

      Average standard deviation of split frequencies: 0.016626

      160500 -- (-1801.058) [-1797.757] (-1797.978) (-1796.629) * (-1799.608) (-1800.468) (-1797.672) [-1799.952] -- 0:00:57
      161000 -- (-1800.356) [-1796.718] (-1797.701) (-1797.842) * (-1799.325) [-1799.885] (-1799.557) (-1801.710) -- 0:00:57
      161500 -- [-1800.990] (-1797.607) (-1798.188) (-1797.823) * (-1800.914) (-1798.220) [-1799.843] (-1798.921) -- 0:00:57
      162000 -- (-1796.918) (-1799.365) (-1797.661) [-1797.738] * (-1800.102) [-1799.681] (-1798.259) (-1802.124) -- 0:00:56
      162500 -- (-1797.148) (-1800.608) [-1797.801] (-1796.925) * (-1800.723) (-1799.765) [-1799.334] (-1804.890) -- 0:00:56
      163000 -- [-1800.328] (-1798.816) (-1798.800) (-1798.463) * [-1799.804] (-1801.882) (-1799.334) (-1798.589) -- 0:00:56
      163500 -- (-1798.753) (-1800.080) (-1797.605) [-1798.281] * (-1797.491) [-1796.873] (-1798.353) (-1800.567) -- 0:00:56
      164000 -- [-1800.652] (-1796.290) (-1799.159) (-1807.954) * [-1797.498] (-1798.444) (-1797.715) (-1800.383) -- 0:00:56
      164500 -- (-1799.309) [-1798.503] (-1797.178) (-1799.016) * (-1800.336) (-1797.716) [-1799.428] (-1799.681) -- 0:00:55
      165000 -- (-1797.656) (-1800.557) (-1799.865) [-1799.231] * [-1799.856] (-1798.598) (-1801.067) (-1803.922) -- 0:00:55

      Average standard deviation of split frequencies: 0.018683

      165500 -- (-1797.074) [-1799.224] (-1798.623) (-1801.703) * [-1800.361] (-1799.466) (-1799.245) (-1800.351) -- 0:00:55
      166000 -- [-1800.139] (-1797.952) (-1799.374) (-1800.260) * (-1802.512) (-1802.740) (-1799.288) [-1798.759] -- 0:00:55
      166500 -- [-1797.290] (-1798.022) (-1800.025) (-1801.091) * [-1798.659] (-1802.357) (-1797.595) (-1798.751) -- 0:00:55
      167000 -- (-1799.734) (-1797.804) (-1798.625) [-1798.931] * (-1797.901) (-1798.487) [-1798.819] (-1800.278) -- 0:00:54
      167500 -- (-1799.831) [-1798.631] (-1797.634) (-1800.419) * [-1798.422] (-1799.967) (-1798.812) (-1798.019) -- 0:00:59
      168000 -- (-1801.172) (-1799.389) (-1796.635) [-1798.569] * (-1801.306) [-1799.930] (-1799.004) (-1802.050) -- 0:00:59
      168500 -- (-1802.870) [-1797.860] (-1797.127) (-1799.257) * [-1799.871] (-1799.042) (-1798.882) (-1801.915) -- 0:00:59
      169000 -- (-1799.713) [-1796.975] (-1798.594) (-1798.103) * (-1805.808) (-1799.405) (-1799.810) [-1802.149] -- 0:00:59
      169500 -- (-1798.486) [-1797.750] (-1799.610) (-1800.410) * (-1800.376) (-1799.669) (-1800.403) [-1799.639] -- 0:00:58
      170000 -- (-1798.423) [-1798.215] (-1798.620) (-1800.125) * [-1800.839] (-1798.460) (-1800.713) (-1800.384) -- 0:00:58

      Average standard deviation of split frequencies: 0.018753

      170500 -- (-1804.723) (-1799.731) (-1797.684) [-1799.601] * [-1800.748] (-1798.506) (-1802.238) (-1800.029) -- 0:00:58
      171000 -- (-1801.704) (-1798.445) [-1798.675] (-1799.273) * [-1803.071] (-1799.851) (-1804.599) (-1799.345) -- 0:00:58
      171500 -- (-1797.449) (-1800.792) [-1799.703] (-1799.155) * (-1800.299) [-1797.773] (-1799.600) (-1800.646) -- 0:00:57
      172000 -- (-1798.953) (-1799.745) (-1798.128) [-1797.495] * [-1803.785] (-1799.520) (-1800.066) (-1802.517) -- 0:00:57
      172500 -- (-1798.099) (-1800.349) [-1798.963] (-1801.877) * (-1798.730) [-1799.382] (-1800.302) (-1800.353) -- 0:00:57
      173000 -- (-1797.188) (-1798.875) (-1808.695) [-1800.217] * [-1798.122] (-1804.206) (-1801.824) (-1798.768) -- 0:00:57
      173500 -- (-1796.603) (-1799.288) [-1796.821] (-1798.616) * (-1799.814) (-1798.932) (-1799.063) [-1799.150] -- 0:00:57
      174000 -- [-1797.302] (-1801.019) (-1800.222) (-1797.063) * (-1800.589) (-1797.733) [-1799.001] (-1803.366) -- 0:00:56
      174500 -- (-1796.471) [-1798.903] (-1797.933) (-1797.166) * (-1799.815) (-1798.641) (-1799.739) [-1801.883] -- 0:00:56
      175000 -- [-1797.624] (-1800.045) (-1797.013) (-1797.750) * (-1799.319) (-1799.777) (-1797.780) [-1797.001] -- 0:00:56

      Average standard deviation of split frequencies: 0.019791

      175500 -- [-1796.996] (-1798.483) (-1796.148) (-1800.517) * (-1802.580) (-1803.472) [-1797.700] (-1797.403) -- 0:00:56
      176000 -- [-1798.317] (-1798.168) (-1796.831) (-1805.613) * (-1800.514) (-1799.732) (-1801.310) [-1796.754] -- 0:00:56
      176500 -- (-1799.610) [-1798.167] (-1798.589) (-1801.510) * (-1798.706) (-1800.336) [-1798.620] (-1798.767) -- 0:00:55
      177000 -- [-1797.799] (-1799.167) (-1797.741) (-1798.017) * [-1800.551] (-1799.554) (-1799.122) (-1798.853) -- 0:00:55
      177500 -- [-1798.380] (-1800.036) (-1799.642) (-1797.885) * (-1799.323) [-1801.773] (-1801.056) (-1805.776) -- 0:00:55
      178000 -- (-1799.289) (-1800.821) (-1798.711) [-1803.082] * (-1805.162) [-1797.338] (-1800.826) (-1799.461) -- 0:00:55
      178500 -- (-1800.359) (-1798.457) (-1799.298) [-1799.219] * (-1800.246) (-1799.380) [-1799.809] (-1803.732) -- 0:00:55
      179000 -- (-1807.069) [-1798.209] (-1798.636) (-1798.966) * (-1800.720) (-1799.454) [-1799.219] (-1800.682) -- 0:00:55
      179500 -- (-1803.237) (-1800.397) (-1798.904) [-1797.312] * (-1798.202) [-1798.617] (-1799.919) (-1797.067) -- 0:00:54
      180000 -- (-1805.680) (-1798.809) [-1798.204] (-1800.294) * (-1799.502) [-1796.587] (-1799.669) (-1799.106) -- 0:00:54

      Average standard deviation of split frequencies: 0.020439

      180500 -- (-1801.024) (-1798.818) (-1799.007) [-1797.934] * [-1798.107] (-1797.977) (-1800.314) (-1797.243) -- 0:00:54
      181000 -- (-1801.015) [-1798.897] (-1797.854) (-1798.316) * (-1800.728) (-1797.216) (-1799.202) [-1796.854] -- 0:00:54
      181500 -- (-1802.227) (-1799.166) [-1799.641] (-1799.600) * (-1803.557) (-1799.171) (-1799.444) [-1800.558] -- 0:00:54
      182000 -- (-1798.584) (-1799.673) [-1799.895] (-1798.384) * [-1800.018] (-1799.040) (-1800.657) (-1798.125) -- 0:00:58
      182500 -- (-1798.646) (-1801.372) (-1798.213) [-1796.668] * [-1799.749] (-1797.521) (-1801.910) (-1799.689) -- 0:00:58
      183000 -- (-1802.723) (-1797.097) (-1797.230) [-1798.839] * (-1802.248) [-1797.843] (-1798.389) (-1801.515) -- 0:00:58
      183500 -- [-1801.863] (-1800.936) (-1796.379) (-1802.422) * (-1802.049) (-1801.513) (-1798.777) [-1798.938] -- 0:00:57
      184000 -- (-1801.948) (-1801.040) (-1797.739) [-1798.052] * [-1801.228] (-1797.337) (-1798.384) (-1798.107) -- 0:00:57
      184500 -- (-1798.477) [-1802.419] (-1796.408) (-1799.050) * (-1802.653) (-1799.845) [-1797.722] (-1801.715) -- 0:00:57
      185000 -- (-1800.293) (-1799.116) [-1797.668] (-1798.622) * (-1799.650) (-1800.031) (-1799.275) [-1796.535] -- 0:00:57

      Average standard deviation of split frequencies: 0.020809

      185500 -- (-1802.315) (-1802.428) [-1799.890] (-1798.875) * (-1804.029) [-1804.766] (-1799.160) (-1798.915) -- 0:00:57
      186000 -- (-1805.160) (-1800.375) (-1799.772) [-1800.377] * (-1803.441) (-1800.634) (-1799.097) [-1803.456] -- 0:00:56
      186500 -- (-1800.101) (-1801.660) [-1797.943] (-1798.795) * [-1799.867] (-1797.553) (-1800.198) (-1805.201) -- 0:00:56
      187000 -- (-1801.842) [-1797.613] (-1796.210) (-1795.940) * [-1799.366] (-1801.455) (-1799.714) (-1797.121) -- 0:00:56
      187500 -- (-1798.465) [-1801.290] (-1797.328) (-1798.319) * (-1798.815) [-1795.822] (-1797.467) (-1796.663) -- 0:00:56
      188000 -- (-1799.264) (-1797.800) (-1796.751) [-1797.215] * (-1800.527) [-1800.698] (-1801.911) (-1798.583) -- 0:00:56
      188500 -- (-1799.597) (-1797.792) [-1796.601] (-1797.801) * [-1800.168] (-1803.004) (-1801.022) (-1798.120) -- 0:00:55
      189000 -- (-1798.966) (-1798.276) (-1798.630) [-1799.920] * (-1802.957) (-1799.515) [-1798.434] (-1800.087) -- 0:00:55
      189500 -- [-1798.368] (-1800.913) (-1802.618) (-1799.053) * (-1799.331) [-1799.546] (-1799.615) (-1798.575) -- 0:00:55
      190000 -- (-1797.685) [-1798.217] (-1798.529) (-1799.813) * (-1799.184) [-1797.427] (-1801.165) (-1800.093) -- 0:00:55

      Average standard deviation of split frequencies: 0.018543

      190500 -- [-1798.816] (-1798.081) (-1796.942) (-1799.110) * [-1798.961] (-1798.463) (-1798.910) (-1807.917) -- 0:00:55
      191000 -- [-1797.830] (-1796.858) (-1799.945) (-1800.879) * [-1798.175] (-1799.077) (-1796.829) (-1804.624) -- 0:00:55
      191500 -- (-1798.192) [-1802.295] (-1801.343) (-1798.759) * (-1800.798) (-1799.367) [-1798.532] (-1798.922) -- 0:00:54
      192000 -- (-1797.951) (-1797.707) (-1798.464) [-1797.647] * (-1800.159) (-1800.428) (-1797.541) [-1799.685] -- 0:00:54
      192500 -- (-1798.287) (-1797.917) (-1800.472) [-1798.940] * (-1799.953) (-1799.607) (-1797.879) [-1797.027] -- 0:00:54
      193000 -- (-1799.027) (-1799.688) [-1800.163] (-1797.764) * (-1798.482) (-1798.404) (-1797.564) [-1800.648] -- 0:00:54
      193500 -- (-1798.828) (-1798.508) (-1800.546) [-1796.409] * (-1800.456) (-1798.401) [-1798.573] (-1798.798) -- 0:00:54
      194000 -- (-1799.901) (-1798.472) [-1798.755] (-1796.899) * (-1801.299) (-1795.485) (-1798.618) [-1797.508] -- 0:00:54
      194500 -- (-1800.917) (-1800.819) (-1798.583) [-1797.333] * (-1798.052) (-1799.560) [-1798.110] (-1798.409) -- 0:00:53
      195000 -- (-1803.748) [-1798.760] (-1800.845) (-1797.133) * (-1798.322) (-1799.213) [-1797.896] (-1801.903) -- 0:00:53

      Average standard deviation of split frequencies: 0.017197

      195500 -- (-1806.539) (-1797.688) (-1801.959) [-1798.635] * (-1798.200) (-1801.044) [-1798.651] (-1798.929) -- 0:00:53
      196000 -- (-1798.453) (-1802.706) (-1797.676) [-1799.888] * (-1798.441) (-1805.903) [-1797.896] (-1796.505) -- 0:00:57
      196500 -- [-1798.483] (-1798.549) (-1796.829) (-1799.109) * [-1796.419] (-1797.051) (-1797.684) (-1798.779) -- 0:00:57
      197000 -- (-1800.487) (-1800.357) [-1797.699] (-1799.352) * (-1797.198) [-1800.606] (-1805.164) (-1798.765) -- 0:00:57
      197500 -- (-1803.200) [-1798.506] (-1798.282) (-1798.142) * (-1797.128) (-1797.902) [-1802.392] (-1805.851) -- 0:00:56
      198000 -- (-1800.453) [-1797.234] (-1798.596) (-1802.317) * (-1796.756) (-1796.152) [-1800.866] (-1805.978) -- 0:00:56
      198500 -- (-1800.604) [-1798.947] (-1799.952) (-1799.182) * (-1796.920) (-1798.235) [-1800.728] (-1801.661) -- 0:00:56
      199000 -- [-1798.587] (-1800.479) (-1807.964) (-1801.038) * (-1798.495) [-1798.127] (-1798.546) (-1799.511) -- 0:00:56
      199500 -- [-1798.560] (-1798.782) (-1800.981) (-1802.371) * (-1799.761) (-1797.720) (-1800.114) [-1797.778] -- 0:00:56
      200000 -- (-1798.724) (-1800.018) (-1799.828) [-1798.213] * (-1799.715) [-1797.052] (-1801.275) (-1798.656) -- 0:00:55

      Average standard deviation of split frequencies: 0.018206

      200500 -- (-1798.178) [-1797.828] (-1799.538) (-1801.325) * (-1798.399) (-1797.208) [-1798.250] (-1799.087) -- 0:00:55
      201000 -- (-1801.385) [-1802.225] (-1797.200) (-1799.731) * (-1798.648) (-1798.132) (-1796.851) [-1798.048] -- 0:00:55
      201500 -- (-1798.510) [-1797.203] (-1798.473) (-1799.337) * (-1798.331) [-1798.300] (-1797.751) (-1800.093) -- 0:00:55
      202000 -- (-1797.429) [-1797.727] (-1798.068) (-1798.016) * (-1797.999) [-1797.144] (-1799.588) (-1802.402) -- 0:00:55
      202500 -- [-1798.672] (-1797.882) (-1798.534) (-1797.054) * (-1801.826) [-1798.195] (-1800.109) (-1800.072) -- 0:00:55
      203000 -- [-1797.824] (-1798.616) (-1800.683) (-1799.400) * (-1798.295) (-1797.455) [-1801.410] (-1799.896) -- 0:00:54
      203500 -- (-1799.382) (-1800.234) (-1799.110) [-1798.296] * [-1798.834] (-1796.561) (-1798.464) (-1800.707) -- 0:00:54
      204000 -- (-1798.508) [-1799.750] (-1798.806) (-1799.244) * [-1800.512] (-1799.875) (-1797.163) (-1799.347) -- 0:00:54
      204500 -- (-1800.263) [-1801.803] (-1799.614) (-1799.052) * [-1798.734] (-1803.748) (-1798.503) (-1799.758) -- 0:00:54
      205000 -- (-1799.314) [-1799.482] (-1800.282) (-1799.355) * (-1797.183) [-1802.791] (-1797.870) (-1797.904) -- 0:00:54

      Average standard deviation of split frequencies: 0.018548

      205500 -- [-1797.580] (-1802.014) (-1797.752) (-1798.382) * (-1797.175) (-1803.287) (-1798.353) [-1797.982] -- 0:00:54
      206000 -- [-1798.617] (-1797.291) (-1799.841) (-1799.078) * (-1799.134) (-1799.680) (-1798.913) [-1799.137] -- 0:00:53
      206500 -- (-1799.661) (-1798.155) [-1799.432] (-1800.724) * (-1799.016) [-1799.521] (-1799.253) (-1800.429) -- 0:00:53
      207000 -- (-1799.736) [-1799.931] (-1798.640) (-1799.175) * (-1798.055) (-1801.446) (-1799.033) [-1798.014] -- 0:00:53
      207500 -- (-1797.256) (-1803.431) (-1798.003) [-1797.950] * (-1800.107) [-1801.356] (-1799.318) (-1800.953) -- 0:00:53
      208000 -- (-1798.823) (-1801.054) [-1799.550] (-1798.601) * [-1799.774] (-1797.870) (-1801.839) (-1799.330) -- 0:00:53
      208500 -- [-1799.272] (-1800.584) (-1800.091) (-1801.928) * (-1803.339) (-1798.205) (-1800.509) [-1799.234] -- 0:00:53
      209000 -- (-1799.645) [-1798.446] (-1800.613) (-1797.652) * (-1802.550) (-1798.317) [-1799.206] (-1799.821) -- 0:00:52
      209500 -- (-1799.199) [-1799.265] (-1800.425) (-1800.026) * (-1801.166) (-1797.795) [-1799.307] (-1802.015) -- 0:00:52
      210000 -- [-1798.940] (-1799.217) (-1797.984) (-1802.362) * (-1800.168) (-1802.305) [-1798.476] (-1802.442) -- 0:00:52

      Average standard deviation of split frequencies: 0.018255

      210500 -- [-1801.658] (-1800.458) (-1799.390) (-1798.619) * (-1800.808) [-1798.305] (-1799.662) (-1800.868) -- 0:00:56
      211000 -- (-1799.423) (-1801.160) (-1798.209) [-1797.704] * (-1798.092) [-1797.851] (-1801.705) (-1798.331) -- 0:00:56
      211500 -- (-1798.940) (-1799.426) (-1799.282) [-1799.430] * [-1797.166] (-1798.630) (-1805.140) (-1800.888) -- 0:00:55
      212000 -- (-1798.621) (-1798.970) (-1797.575) [-1799.952] * (-1797.916) (-1799.065) (-1799.878) [-1803.004] -- 0:00:55
      212500 -- (-1797.794) [-1798.236] (-1798.792) (-1798.479) * (-1799.049) [-1797.531] (-1798.207) (-1801.031) -- 0:00:55
      213000 -- (-1798.117) [-1799.941] (-1800.478) (-1799.130) * [-1797.660] (-1800.169) (-1799.838) (-1798.815) -- 0:00:55
      213500 -- (-1800.169) (-1799.142) [-1797.957] (-1797.503) * (-1799.073) [-1798.134] (-1798.026) (-1799.490) -- 0:00:55
      214000 -- [-1801.758] (-1797.954) (-1798.469) (-1797.547) * (-1798.322) [-1796.883] (-1801.556) (-1802.237) -- 0:00:55
      214500 -- (-1804.400) (-1796.342) (-1802.771) [-1798.781] * (-1796.695) (-1798.281) (-1799.749) [-1801.232] -- 0:00:54
      215000 -- (-1801.923) (-1799.499) [-1800.678] (-1797.989) * [-1798.131] (-1800.810) (-1802.316) (-1797.808) -- 0:00:54

      Average standard deviation of split frequencies: 0.018608

      215500 -- (-1799.663) [-1799.572] (-1797.141) (-1800.792) * (-1796.745) (-1801.712) (-1799.335) [-1798.244] -- 0:00:54
      216000 -- (-1799.515) [-1800.198] (-1799.250) (-1800.560) * (-1797.540) (-1800.492) (-1798.901) [-1797.254] -- 0:00:54
      216500 -- (-1801.854) [-1800.168] (-1801.984) (-1801.123) * (-1796.109) [-1799.276] (-1797.750) (-1796.547) -- 0:00:54
      217000 -- (-1800.958) [-1798.873] (-1799.330) (-1801.485) * (-1794.832) [-1798.005] (-1797.589) (-1799.454) -- 0:00:54
      217500 -- (-1799.771) (-1800.174) (-1799.498) [-1796.513] * (-1796.418) (-1797.748) [-1798.798] (-1800.518) -- 0:00:53
      218000 -- (-1799.184) (-1803.709) [-1799.337] (-1800.626) * (-1797.534) (-1798.891) (-1809.163) [-1801.907] -- 0:00:53
      218500 -- (-1800.199) (-1797.841) (-1799.167) [-1800.596] * [-1797.513] (-1801.660) (-1803.182) (-1800.529) -- 0:00:53
      219000 -- (-1799.990) [-1799.728] (-1798.272) (-1800.546) * (-1795.886) [-1797.756] (-1803.220) (-1797.864) -- 0:00:53
      219500 -- (-1799.049) (-1799.321) [-1796.291] (-1800.781) * (-1797.152) (-1799.295) (-1799.077) [-1799.975] -- 0:00:53
      220000 -- [-1798.693] (-1798.403) (-1799.330) (-1797.180) * [-1796.642] (-1799.469) (-1800.115) (-1799.001) -- 0:00:53

      Average standard deviation of split frequencies: 0.018989

      220500 -- (-1799.797) (-1799.321) [-1796.221] (-1799.677) * (-1799.370) (-1799.555) (-1798.147) [-1798.175] -- 0:00:53
      221000 -- (-1800.599) [-1797.676] (-1801.916) (-1798.333) * (-1797.520) (-1800.066) (-1799.974) [-1798.316] -- 0:00:52
      221500 -- [-1799.490] (-1797.089) (-1797.253) (-1797.462) * (-1799.161) [-1804.157] (-1800.084) (-1799.250) -- 0:00:52
      222000 -- (-1799.530) [-1800.993] (-1798.010) (-1798.985) * [-1795.686] (-1800.800) (-1804.279) (-1804.966) -- 0:00:52
      222500 -- (-1800.691) (-1798.494) (-1802.369) [-1796.647] * [-1798.783] (-1801.566) (-1797.873) (-1801.009) -- 0:00:52
      223000 -- [-1799.469] (-1798.215) (-1801.533) (-1797.573) * (-1797.933) (-1798.570) [-1797.718] (-1800.068) -- 0:00:52
      223500 -- [-1799.460] (-1797.814) (-1799.934) (-1798.205) * (-1797.378) (-1799.163) (-1798.242) [-1802.407] -- 0:00:52
      224000 -- (-1798.882) (-1798.840) (-1798.784) [-1798.224] * (-1800.071) (-1798.088) (-1796.078) [-1801.343] -- 0:00:51
      224500 -- (-1800.276) (-1798.223) [-1798.357] (-1798.121) * (-1797.650) (-1798.738) (-1797.134) [-1798.383] -- 0:00:51
      225000 -- (-1801.446) (-1798.480) [-1799.263] (-1798.443) * (-1800.804) (-1798.972) (-1799.761) [-1799.540] -- 0:00:55

      Average standard deviation of split frequencies: 0.018553

      225500 -- (-1798.049) (-1800.845) (-1798.865) [-1801.137] * (-1800.546) (-1800.483) [-1797.822] (-1798.119) -- 0:00:54
      226000 -- (-1796.980) [-1797.871] (-1797.442) (-1799.662) * [-1797.706] (-1798.855) (-1797.057) (-1797.644) -- 0:00:54
      226500 -- (-1798.157) (-1797.197) [-1797.908] (-1799.252) * (-1796.478) (-1801.107) (-1800.650) [-1797.753] -- 0:00:54
      227000 -- (-1798.261) [-1797.104] (-1800.779) (-1801.018) * [-1799.085] (-1801.004) (-1802.322) (-1798.733) -- 0:00:54
      227500 -- (-1798.755) [-1797.475] (-1799.252) (-1800.932) * (-1797.819) [-1800.409] (-1797.037) (-1798.503) -- 0:00:54
      228000 -- (-1798.502) (-1800.195) (-1798.233) [-1799.071] * (-1798.702) [-1800.231] (-1798.836) (-1797.420) -- 0:00:54
      228500 -- (-1800.151) (-1798.802) [-1797.918] (-1803.338) * (-1800.011) [-1798.370] (-1798.328) (-1804.199) -- 0:00:54
      229000 -- [-1799.998] (-1798.379) (-1798.714) (-1798.294) * (-1800.862) (-1801.591) [-1799.744] (-1801.799) -- 0:00:53
      229500 -- (-1799.568) (-1797.872) (-1798.166) [-1798.900] * (-1798.068) [-1801.002] (-1801.884) (-1800.029) -- 0:00:53
      230000 -- [-1798.731] (-1802.147) (-1800.197) (-1800.530) * [-1796.619] (-1798.714) (-1798.373) (-1799.464) -- 0:00:53

      Average standard deviation of split frequencies: 0.017532

      230500 -- (-1799.527) (-1799.513) (-1802.171) [-1799.375] * [-1797.473] (-1797.693) (-1798.863) (-1800.400) -- 0:00:53
      231000 -- (-1799.113) (-1800.643) (-1799.220) [-1794.736] * (-1799.635) (-1799.704) (-1799.802) [-1800.776] -- 0:00:53
      231500 -- [-1800.213] (-1798.004) (-1800.848) (-1795.806) * (-1798.351) (-1798.836) [-1799.011] (-1799.397) -- 0:00:53
      232000 -- (-1799.627) (-1801.262) (-1798.514) [-1797.957] * (-1795.741) (-1799.256) (-1797.944) [-1797.484] -- 0:00:52
      232500 -- [-1799.779] (-1800.337) (-1800.305) (-1798.611) * (-1797.014) (-1800.311) (-1797.918) [-1799.586] -- 0:00:52
      233000 -- (-1800.116) [-1802.400] (-1798.887) (-1799.115) * (-1803.031) (-1800.545) [-1798.504] (-1799.987) -- 0:00:52
      233500 -- (-1806.964) [-1800.631] (-1801.008) (-1797.622) * (-1801.626) (-1798.095) [-1799.232] (-1800.797) -- 0:00:52
      234000 -- [-1805.213] (-1800.166) (-1803.844) (-1798.886) * (-1800.711) [-1798.279] (-1799.984) (-1797.887) -- 0:00:52
      234500 -- (-1798.280) (-1797.933) (-1802.840) [-1801.058] * (-1800.506) (-1798.264) (-1798.940) [-1800.557] -- 0:00:52
      235000 -- (-1799.718) [-1798.436] (-1798.878) (-1801.630) * (-1798.134) (-1802.960) [-1798.149] (-1802.884) -- 0:00:52

      Average standard deviation of split frequencies: 0.015980

      235500 -- [-1798.457] (-1799.764) (-1800.235) (-1798.947) * (-1797.667) (-1799.328) (-1798.174) [-1800.264] -- 0:00:51
      236000 -- [-1799.308] (-1799.043) (-1798.725) (-1797.472) * [-1799.658] (-1799.370) (-1797.802) (-1800.117) -- 0:00:51
      236500 -- (-1799.127) (-1798.105) [-1797.966] (-1798.009) * (-1805.004) [-1801.773] (-1798.343) (-1802.316) -- 0:00:51
      237000 -- [-1798.674] (-1799.506) (-1799.455) (-1796.433) * (-1803.649) (-1805.473) (-1799.135) [-1797.068] -- 0:00:51
      237500 -- (-1797.866) (-1800.055) [-1800.439] (-1798.303) * (-1805.969) (-1802.330) (-1797.949) [-1799.833] -- 0:00:51
      238000 -- (-1797.840) (-1797.298) [-1800.714] (-1798.844) * [-1798.478] (-1797.941) (-1797.840) (-1798.403) -- 0:00:51
      238500 -- (-1799.226) [-1798.847] (-1797.955) (-1798.656) * (-1801.374) (-1797.281) [-1797.180] (-1799.403) -- 0:00:51
      239000 -- (-1799.447) (-1797.367) (-1797.268) [-1800.917] * (-1800.945) (-1800.726) (-1802.102) [-1800.804] -- 0:00:54
      239500 -- [-1799.738] (-1797.685) (-1798.441) (-1798.568) * (-1800.669) [-1799.042] (-1799.635) (-1797.806) -- 0:00:53
      240000 -- (-1798.749) (-1801.392) [-1800.214] (-1798.912) * (-1799.141) [-1799.877] (-1798.071) (-1801.507) -- 0:00:53

      Average standard deviation of split frequencies: 0.015670

      240500 -- [-1798.300] (-1799.714) (-1800.022) (-1798.500) * (-1799.586) (-1799.281) [-1797.413] (-1799.083) -- 0:00:53
      241000 -- (-1802.788) (-1799.901) [-1799.475] (-1797.801) * (-1800.981) (-1799.767) [-1798.318] (-1798.239) -- 0:00:53
      241500 -- (-1798.737) (-1798.309) [-1797.266] (-1797.805) * [-1798.492] (-1801.521) (-1797.608) (-1798.386) -- 0:00:53
      242000 -- (-1801.667) (-1799.641) (-1798.556) [-1797.747] * (-1803.491) (-1797.453) (-1796.971) [-1799.001] -- 0:00:53
      242500 -- (-1798.817) [-1799.088] (-1799.533) (-1797.195) * (-1798.472) [-1798.276] (-1798.966) (-1798.812) -- 0:00:53
      243000 -- (-1798.151) [-1798.548] (-1799.531) (-1797.127) * [-1799.425] (-1798.806) (-1798.371) (-1799.151) -- 0:00:52
      243500 -- (-1799.798) (-1800.734) (-1800.144) [-1800.039] * (-1801.609) (-1800.151) [-1797.737] (-1797.914) -- 0:00:52
      244000 -- (-1800.685) (-1800.044) [-1798.199] (-1799.706) * (-1801.543) [-1798.045] (-1797.833) (-1801.533) -- 0:00:52
      244500 -- (-1798.843) (-1797.252) (-1801.237) [-1799.117] * (-1802.126) (-1798.850) (-1798.567) [-1799.898] -- 0:00:52
      245000 -- [-1797.680] (-1799.458) (-1797.614) (-1800.275) * (-1803.569) (-1800.725) (-1799.285) [-1799.953] -- 0:00:52

      Average standard deviation of split frequencies: 0.015431

      245500 -- (-1798.806) [-1798.509] (-1797.916) (-1800.356) * (-1799.113) (-1798.323) (-1799.603) [-1799.198] -- 0:00:52
      246000 -- (-1798.829) (-1803.502) (-1797.930) [-1802.135] * (-1800.469) (-1798.255) (-1801.379) [-1801.876] -- 0:00:52
      246500 -- (-1798.543) (-1801.124) (-1798.326) [-1798.914] * [-1801.641] (-1799.868) (-1798.412) (-1800.929) -- 0:00:51
      247000 -- (-1798.609) (-1797.697) (-1797.167) [-1798.905] * (-1800.321) (-1799.208) [-1797.121] (-1800.900) -- 0:00:51
      247500 -- [-1801.834] (-1797.860) (-1799.007) (-1798.104) * [-1798.969] (-1799.085) (-1797.995) (-1799.302) -- 0:00:51
      248000 -- (-1802.995) [-1798.586] (-1798.631) (-1798.412) * (-1798.390) (-1799.223) [-1798.575] (-1798.453) -- 0:00:51
      248500 -- (-1805.406) (-1800.276) [-1798.721] (-1799.964) * (-1798.706) [-1798.592] (-1799.895) (-1797.256) -- 0:00:51
      249000 -- (-1798.372) (-1799.135) (-1797.185) [-1797.712] * (-1798.160) [-1799.347] (-1798.851) (-1800.908) -- 0:00:51
      249500 -- (-1801.925) (-1799.818) (-1799.385) [-1798.272] * (-1801.817) [-1799.485] (-1798.479) (-1797.253) -- 0:00:51
      250000 -- [-1798.513] (-1803.174) (-1801.503) (-1799.816) * (-1800.086) (-1799.773) [-1799.290] (-1800.587) -- 0:00:51

      Average standard deviation of split frequencies: 0.015672

      250500 -- (-1801.231) (-1799.532) [-1799.472] (-1799.845) * (-1801.476) (-1799.699) [-1800.616] (-1798.077) -- 0:00:50
      251000 -- (-1800.479) (-1798.152) [-1800.389] (-1803.906) * (-1798.049) (-1802.415) [-1798.597] (-1798.103) -- 0:00:50
      251500 -- (-1802.424) (-1798.198) [-1799.598] (-1806.189) * (-1798.383) (-1800.317) (-1798.170) [-1798.585] -- 0:00:50
      252000 -- (-1796.509) (-1799.922) (-1799.309) [-1800.776] * (-1798.676) [-1799.313] (-1797.574) (-1801.340) -- 0:00:50
      252500 -- [-1798.281] (-1798.598) (-1799.148) (-1798.829) * (-1798.208) (-1797.299) (-1800.418) [-1802.571] -- 0:00:50
      253000 -- [-1797.206] (-1800.355) (-1799.305) (-1798.796) * (-1801.463) [-1798.186] (-1796.143) (-1799.651) -- 0:00:50
      253500 -- (-1798.249) [-1797.506] (-1799.115) (-1800.551) * (-1802.737) (-1799.426) (-1797.246) [-1797.818] -- 0:00:53
      254000 -- (-1803.139) (-1798.189) [-1799.325] (-1799.988) * (-1800.309) (-1800.408) [-1800.133] (-1799.347) -- 0:00:52
      254500 -- (-1800.570) (-1802.493) [-1798.861] (-1799.032) * (-1801.014) [-1798.684] (-1798.430) (-1798.631) -- 0:00:52
      255000 -- (-1800.117) [-1798.817] (-1798.194) (-1798.604) * (-1799.622) (-1798.252) [-1797.884] (-1798.073) -- 0:00:52

      Average standard deviation of split frequencies: 0.015959

      255500 -- [-1800.597] (-1798.125) (-1800.819) (-1802.572) * (-1797.145) [-1799.900] (-1798.727) (-1799.517) -- 0:00:52
      256000 -- (-1798.928) (-1798.179) (-1799.410) [-1800.156] * [-1797.536] (-1800.899) (-1797.857) (-1797.752) -- 0:00:52
      256500 -- [-1799.217] (-1798.029) (-1798.175) (-1806.233) * (-1797.239) (-1798.756) (-1798.831) [-1798.486] -- 0:00:52
      257000 -- [-1798.965] (-1800.860) (-1799.092) (-1798.590) * [-1798.562] (-1799.814) (-1799.245) (-1800.801) -- 0:00:52
      257500 -- (-1798.955) [-1798.483] (-1799.762) (-1798.976) * (-1798.804) (-1801.917) [-1799.172] (-1799.619) -- 0:00:51
      258000 -- (-1801.810) [-1802.202] (-1799.761) (-1798.328) * (-1799.376) [-1800.071] (-1801.040) (-1798.133) -- 0:00:51
      258500 -- (-1799.741) (-1798.849) (-1796.811) [-1796.988] * [-1796.357] (-1803.740) (-1798.864) (-1797.537) -- 0:00:51
      259000 -- (-1797.724) [-1800.696] (-1799.743) (-1799.157) * [-1801.718] (-1800.555) (-1798.915) (-1798.406) -- 0:00:51
      259500 -- (-1799.004) (-1801.464) (-1799.918) [-1800.545] * [-1800.529] (-1796.632) (-1798.754) (-1798.202) -- 0:00:51
      260000 -- (-1799.299) (-1801.409) [-1802.337] (-1798.104) * (-1798.974) [-1796.569] (-1799.087) (-1799.438) -- 0:00:51

      Average standard deviation of split frequencies: 0.016562

      260500 -- (-1798.014) (-1803.506) [-1803.399] (-1798.954) * (-1797.463) [-1797.494] (-1799.698) (-1799.869) -- 0:00:51
      261000 -- [-1800.509] (-1801.462) (-1797.536) (-1799.306) * [-1798.620] (-1801.395) (-1799.639) (-1798.902) -- 0:00:50
      261500 -- (-1799.659) (-1798.423) (-1799.061) [-1799.272] * (-1804.182) (-1798.150) (-1798.432) [-1797.685] -- 0:00:50
      262000 -- (-1800.418) (-1800.066) (-1801.205) [-1797.845] * [-1800.824] (-1796.291) (-1800.994) (-1802.408) -- 0:00:50
      262500 -- [-1799.387] (-1798.553) (-1798.427) (-1800.782) * (-1806.893) (-1795.630) [-1798.033] (-1797.164) -- 0:00:50
      263000 -- (-1800.014) [-1798.665] (-1798.551) (-1805.147) * (-1803.080) (-1803.473) (-1801.000) [-1798.687] -- 0:00:50
      263500 -- [-1797.381] (-1798.509) (-1799.114) (-1798.947) * (-1798.917) (-1798.726) (-1805.806) [-1797.393] -- 0:00:50
      264000 -- (-1797.977) (-1798.915) [-1798.810] (-1797.955) * (-1799.722) [-1808.854] (-1803.180) (-1803.117) -- 0:00:50
      264500 -- (-1799.115) (-1796.520) [-1801.558] (-1797.057) * [-1800.381] (-1805.141) (-1801.625) (-1799.397) -- 0:00:50
      265000 -- [-1798.445] (-1797.764) (-1800.602) (-1797.774) * [-1798.482] (-1796.981) (-1802.933) (-1800.216) -- 0:00:49

      Average standard deviation of split frequencies: 0.016976

      265500 -- (-1804.646) (-1799.160) [-1799.000] (-1797.259) * (-1797.591) (-1795.375) (-1798.802) [-1797.084] -- 0:00:49
      266000 -- (-1801.134) (-1799.232) (-1798.359) [-1797.454] * [-1798.809] (-1798.680) (-1799.907) (-1798.689) -- 0:00:49
      266500 -- (-1798.677) [-1799.100] (-1798.263) (-1800.282) * (-1800.624) [-1797.990] (-1800.572) (-1804.349) -- 0:00:49
      267000 -- (-1796.739) [-1797.348] (-1799.629) (-1795.841) * (-1799.418) [-1797.468] (-1798.878) (-1801.226) -- 0:00:49
      267500 -- (-1803.306) (-1798.919) (-1798.179) [-1799.679] * (-1800.164) (-1798.284) [-1800.023] (-1801.193) -- 0:00:49
      268000 -- [-1798.663] (-1799.115) (-1798.919) (-1799.862) * [-1797.275] (-1801.404) (-1800.661) (-1800.710) -- 0:00:51
      268500 -- (-1800.380) (-1800.430) [-1798.094] (-1800.601) * (-1799.265) [-1800.849] (-1800.134) (-1797.751) -- 0:00:51
      269000 -- (-1799.490) (-1803.537) [-1798.327] (-1802.721) * [-1796.437] (-1805.086) (-1803.003) (-1797.708) -- 0:00:51
      269500 -- [-1797.730] (-1803.922) (-1799.330) (-1803.477) * (-1799.305) [-1797.297] (-1800.097) (-1799.530) -- 0:00:51
      270000 -- (-1800.430) (-1802.280) [-1796.876] (-1802.955) * [-1798.703] (-1800.561) (-1800.668) (-1797.795) -- 0:00:51

      Average standard deviation of split frequencies: 0.016958

      270500 -- (-1806.099) (-1798.923) [-1797.839] (-1797.561) * [-1797.561] (-1801.677) (-1800.101) (-1797.873) -- 0:00:51
      271000 -- [-1798.664] (-1800.232) (-1797.721) (-1796.738) * (-1799.257) (-1803.044) (-1798.839) [-1797.519] -- 0:00:51
      271500 -- [-1796.652] (-1800.126) (-1799.078) (-1798.911) * (-1797.777) [-1799.233] (-1804.377) (-1801.382) -- 0:00:50
      272000 -- (-1799.298) (-1798.815) (-1800.110) [-1801.313] * (-1796.969) [-1798.579] (-1799.757) (-1802.833) -- 0:00:50
      272500 -- [-1798.185] (-1798.266) (-1797.732) (-1801.902) * [-1798.119] (-1796.185) (-1798.000) (-1803.004) -- 0:00:50
      273000 -- (-1799.419) [-1798.001] (-1799.266) (-1801.551) * (-1797.364) [-1796.810] (-1797.891) (-1801.637) -- 0:00:50
      273500 -- (-1799.843) (-1804.298) (-1799.311) [-1803.762] * (-1797.923) [-1797.999] (-1801.407) (-1797.992) -- 0:00:50
      274000 -- (-1799.333) (-1798.242) (-1799.340) [-1800.339] * (-1797.121) [-1797.253] (-1801.130) (-1798.080) -- 0:00:50
      274500 -- (-1799.453) (-1795.701) (-1800.608) [-1801.601] * (-1798.575) (-1798.042) (-1798.626) [-1799.497] -- 0:00:50
      275000 -- (-1797.928) (-1799.893) (-1800.608) [-1799.233] * [-1799.328] (-1799.371) (-1797.859) (-1798.935) -- 0:00:50

      Average standard deviation of split frequencies: 0.017529

      275500 -- (-1798.665) (-1801.388) (-1805.904) [-1800.523] * [-1800.329] (-1801.378) (-1798.629) (-1797.245) -- 0:00:49
      276000 -- (-1799.114) (-1798.514) [-1806.069] (-1797.562) * (-1797.670) (-1801.379) (-1799.521) [-1797.565] -- 0:00:49
      276500 -- (-1798.573) (-1798.653) [-1801.497] (-1797.358) * [-1797.511] (-1801.275) (-1799.425) (-1797.858) -- 0:00:49
      277000 -- (-1800.564) [-1798.753] (-1802.015) (-1797.710) * (-1798.632) (-1799.772) [-1799.452] (-1803.128) -- 0:00:49
      277500 -- (-1802.342) (-1797.875) [-1801.467] (-1803.583) * [-1801.097] (-1798.461) (-1800.547) (-1799.865) -- 0:00:49
      278000 -- (-1802.883) (-1799.793) (-1800.345) [-1798.946] * (-1798.294) [-1801.927] (-1801.064) (-1801.907) -- 0:00:49
      278500 -- (-1799.149) (-1799.452) (-1799.200) [-1798.481] * (-1798.342) [-1799.245] (-1799.717) (-1798.815) -- 0:00:49
      279000 -- (-1800.609) (-1798.901) [-1800.109] (-1798.841) * [-1799.809] (-1802.938) (-1803.251) (-1799.256) -- 0:00:49
      279500 -- [-1799.241] (-1799.165) (-1798.293) (-1798.426) * [-1799.330] (-1797.006) (-1800.092) (-1801.687) -- 0:00:48
      280000 -- (-1800.241) (-1802.860) (-1797.642) [-1798.988] * (-1800.654) (-1800.688) [-1798.352] (-1798.306) -- 0:00:48

      Average standard deviation of split frequencies: 0.016796

      280500 -- (-1799.275) (-1798.451) [-1797.868] (-1800.073) * [-1798.627] (-1801.577) (-1800.151) (-1799.872) -- 0:00:48
      281000 -- (-1803.519) (-1798.792) [-1797.058] (-1799.084) * (-1798.198) (-1797.839) (-1798.793) [-1796.607] -- 0:00:48
      281500 -- (-1803.055) (-1800.063) (-1798.599) [-1797.618] * (-1797.279) (-1797.827) (-1798.414) [-1800.028] -- 0:00:48
      282000 -- (-1800.994) (-1797.793) [-1801.557] (-1804.938) * [-1796.192] (-1800.282) (-1799.630) (-1801.377) -- 0:00:48
      282500 -- (-1799.718) [-1801.012] (-1800.761) (-1801.618) * [-1797.834] (-1798.600) (-1798.979) (-1801.187) -- 0:00:50
      283000 -- (-1806.211) (-1802.041) [-1798.870] (-1803.366) * [-1799.316] (-1801.571) (-1801.516) (-1798.602) -- 0:00:50
      283500 -- (-1800.991) (-1800.980) (-1797.515) [-1799.087] * (-1797.939) (-1797.815) (-1801.596) [-1801.706] -- 0:00:50
      284000 -- (-1801.087) (-1801.036) (-1799.081) [-1798.783] * (-1800.970) (-1798.214) [-1798.698] (-1799.381) -- 0:00:50
      284500 -- (-1802.977) (-1801.942) (-1798.829) [-1797.382] * (-1798.823) (-1800.118) [-1799.878] (-1799.332) -- 0:00:50
      285000 -- (-1797.868) (-1801.595) (-1798.455) [-1802.384] * (-1797.101) (-1798.297) [-1798.090] (-1802.915) -- 0:00:50

      Average standard deviation of split frequencies: 0.016318

      285500 -- (-1799.856) (-1801.994) [-1802.282] (-1798.891) * (-1800.093) (-1798.234) [-1798.399] (-1802.667) -- 0:00:50
      286000 -- (-1799.311) (-1801.098) (-1799.607) [-1796.431] * (-1802.275) [-1801.463] (-1799.438) (-1798.393) -- 0:00:49
      286500 -- [-1797.478] (-1805.114) (-1800.053) (-1796.523) * (-1798.469) [-1799.375] (-1799.624) (-1799.939) -- 0:00:49
      287000 -- (-1801.712) (-1804.872) [-1797.089] (-1799.641) * (-1800.339) (-1797.794) (-1803.891) [-1799.641] -- 0:00:49
      287500 -- [-1800.775] (-1805.979) (-1802.005) (-1802.697) * (-1802.702) [-1798.325] (-1800.230) (-1801.197) -- 0:00:49
      288000 -- (-1800.486) (-1803.359) (-1802.425) [-1798.200] * (-1799.368) (-1802.192) [-1800.403] (-1797.990) -- 0:00:49
      288500 -- [-1798.360] (-1798.023) (-1799.133) (-1802.291) * [-1797.365] (-1798.885) (-1797.138) (-1800.991) -- 0:00:49
      289000 -- (-1803.849) (-1799.915) [-1800.348] (-1798.415) * (-1798.804) (-1798.697) [-1796.952] (-1799.412) -- 0:00:49
      289500 -- [-1798.564] (-1801.930) (-1801.325) (-1799.604) * (-1799.091) (-1801.184) (-1801.560) [-1799.787] -- 0:00:49
      290000 -- [-1799.451] (-1798.835) (-1800.857) (-1797.578) * (-1798.687) [-1797.976] (-1801.376) (-1799.729) -- 0:00:48

      Average standard deviation of split frequencies: 0.016488

      290500 -- [-1800.633] (-1801.685) (-1802.418) (-1798.879) * (-1796.539) (-1802.951) (-1799.740) [-1798.551] -- 0:00:48
      291000 -- (-1799.668) (-1798.060) (-1800.113) [-1797.655] * (-1796.827) [-1799.254] (-1800.804) (-1799.995) -- 0:00:48
      291500 -- (-1801.679) [-1798.550] (-1802.635) (-1797.726) * (-1797.722) (-1800.403) (-1798.056) [-1802.816] -- 0:00:48
      292000 -- (-1800.346) (-1798.910) [-1799.013] (-1799.985) * (-1802.372) (-1798.323) [-1799.007] (-1801.212) -- 0:00:48
      292500 -- (-1799.398) (-1797.648) [-1801.719] (-1801.386) * (-1800.689) (-1797.526) (-1798.809) [-1798.861] -- 0:00:48
      293000 -- (-1799.443) [-1800.522] (-1797.585) (-1799.603) * [-1797.360] (-1800.375) (-1800.134) (-1800.031) -- 0:00:48
      293500 -- (-1798.227) (-1799.779) [-1796.814] (-1797.584) * (-1796.185) (-1800.859) (-1799.351) [-1798.973] -- 0:00:48
      294000 -- (-1800.319) (-1797.946) (-1796.997) [-1797.102] * (-1796.622) [-1804.425] (-1796.284) (-1799.486) -- 0:00:48
      294500 -- [-1800.114] (-1797.525) (-1801.470) (-1799.297) * (-1797.969) [-1799.579] (-1804.350) (-1799.541) -- 0:00:47
      295000 -- (-1798.807) [-1797.731] (-1801.823) (-1799.612) * (-1795.696) [-1799.435] (-1799.881) (-1800.110) -- 0:00:47

      Average standard deviation of split frequencies: 0.015926

      295500 -- [-1798.523] (-1798.727) (-1797.497) (-1800.917) * (-1801.061) [-1798.819] (-1797.983) (-1798.379) -- 0:00:47
      296000 -- (-1799.526) (-1799.635) [-1799.205] (-1799.963) * (-1802.525) (-1799.232) [-1798.724] (-1797.922) -- 0:00:47
      296500 -- [-1798.949] (-1800.592) (-1799.564) (-1806.037) * (-1797.222) (-1801.628) [-1798.011] (-1797.998) -- 0:00:47
      297000 -- (-1798.958) [-1801.737] (-1801.458) (-1802.927) * (-1802.687) (-1799.699) (-1799.360) [-1799.714] -- 0:00:49
      297500 -- [-1797.961] (-1796.709) (-1798.943) (-1803.702) * [-1799.247] (-1802.086) (-1798.620) (-1800.359) -- 0:00:49
      298000 -- (-1798.781) [-1798.346] (-1797.955) (-1797.000) * (-1799.961) (-1800.707) (-1797.587) [-1804.662] -- 0:00:49
      298500 -- (-1798.494) (-1798.963) (-1797.454) [-1798.004] * (-1801.661) (-1800.261) [-1798.849] (-1798.489) -- 0:00:49
      299000 -- (-1799.426) (-1798.575) [-1796.945] (-1798.125) * (-1800.307) (-1800.643) (-1800.021) [-1800.701] -- 0:00:49
      299500 -- (-1798.842) (-1796.496) (-1798.412) [-1799.375] * (-1799.978) (-1800.478) (-1799.894) [-1798.777] -- 0:00:49
      300000 -- (-1798.666) [-1797.807] (-1797.176) (-1798.682) * (-1796.576) (-1798.426) [-1798.607] (-1801.922) -- 0:00:48

      Average standard deviation of split frequencies: 0.015156

      300500 -- [-1795.732] (-1802.411) (-1798.851) (-1802.245) * (-1798.497) (-1797.089) [-1799.301] (-1802.124) -- 0:00:48
      301000 -- (-1798.101) (-1801.183) [-1798.758] (-1799.541) * (-1798.707) (-1797.340) [-1799.717] (-1801.762) -- 0:00:48
      301500 -- (-1801.694) (-1799.338) (-1800.551) [-1799.273] * (-1796.734) (-1799.482) [-1801.253] (-1801.070) -- 0:00:48
      302000 -- (-1800.653) (-1801.144) (-1801.235) [-1798.930] * (-1801.707) (-1798.516) [-1798.474] (-1804.146) -- 0:00:48
      302500 -- (-1799.410) (-1804.084) (-1799.506) [-1799.400] * [-1798.007] (-1798.604) (-1797.818) (-1805.326) -- 0:00:48
      303000 -- [-1796.831] (-1800.678) (-1798.887) (-1800.241) * (-1798.250) [-1800.771] (-1798.801) (-1802.005) -- 0:00:48
      303500 -- (-1797.940) (-1800.962) (-1798.577) [-1799.998] * [-1797.396] (-1801.133) (-1799.649) (-1801.079) -- 0:00:48
      304000 -- [-1797.711] (-1800.694) (-1799.712) (-1797.428) * [-1798.656] (-1799.848) (-1798.659) (-1799.998) -- 0:00:48
      304500 -- (-1801.104) [-1799.376] (-1800.373) (-1797.890) * (-1798.933) (-1798.838) [-1803.936] (-1798.361) -- 0:00:47
      305000 -- (-1796.940) (-1799.929) [-1799.251] (-1799.217) * (-1799.835) (-1799.271) (-1800.207) [-1797.835] -- 0:00:47

      Average standard deviation of split frequencies: 0.015662

      305500 -- (-1799.890) (-1797.777) (-1799.092) [-1799.221] * [-1801.490] (-1799.342) (-1802.502) (-1801.013) -- 0:00:47
      306000 -- (-1798.541) (-1797.893) [-1796.160] (-1800.340) * (-1799.202) (-1800.823) [-1798.848] (-1800.346) -- 0:00:47
      306500 -- (-1797.406) (-1798.351) [-1798.185] (-1799.222) * (-1798.094) (-1799.850) [-1798.562] (-1799.456) -- 0:00:47
      307000 -- (-1797.231) [-1799.505] (-1798.505) (-1799.668) * (-1798.665) (-1800.246) [-1798.471] (-1802.859) -- 0:00:47
      307500 -- (-1799.539) (-1797.567) (-1800.148) [-1799.435] * (-1801.262) (-1801.747) [-1797.600] (-1801.225) -- 0:00:47
      308000 -- (-1801.869) [-1798.598] (-1800.379) (-1798.918) * [-1797.253] (-1800.374) (-1796.540) (-1799.396) -- 0:00:47
      308500 -- (-1803.501) (-1801.615) (-1798.406) [-1799.097] * (-1799.012) (-1797.903) (-1798.121) [-1799.392] -- 0:00:47
      309000 -- [-1800.656] (-1798.264) (-1797.931) (-1800.311) * (-1800.708) (-1799.626) [-1798.767] (-1797.220) -- 0:00:46
      309500 -- (-1803.170) (-1797.461) [-1798.956] (-1798.876) * (-1798.117) (-1801.922) (-1798.774) [-1800.069] -- 0:00:46
      310000 -- (-1803.907) (-1796.900) (-1799.066) [-1799.818] * (-1798.050) [-1798.290] (-1801.841) (-1798.154) -- 0:00:46

      Average standard deviation of split frequencies: 0.016691

      310500 -- (-1801.409) [-1797.328] (-1797.961) (-1800.467) * [-1798.821] (-1796.841) (-1799.764) (-1799.883) -- 0:00:46
      311000 -- [-1800.864] (-1798.603) (-1799.124) (-1799.717) * (-1799.332) (-1798.113) (-1798.315) [-1796.901] -- 0:00:48
      311500 -- (-1804.441) (-1800.486) [-1797.083] (-1797.868) * (-1797.979) [-1802.352] (-1800.813) (-1797.313) -- 0:00:48
      312000 -- (-1799.892) [-1799.086] (-1798.814) (-1800.051) * (-1798.753) (-1804.226) [-1800.280] (-1797.946) -- 0:00:48
      312500 -- (-1799.701) (-1799.642) [-1798.545] (-1798.024) * (-1798.053) (-1799.684) (-1799.604) [-1799.281] -- 0:00:48
      313000 -- (-1800.098) (-1799.779) (-1797.996) [-1798.280] * (-1799.029) (-1800.319) [-1798.304] (-1800.599) -- 0:00:48
      313500 -- (-1800.720) [-1797.734] (-1799.626) (-1798.474) * (-1798.290) (-1800.621) (-1801.957) [-1800.141] -- 0:00:48
      314000 -- (-1800.141) (-1796.074) (-1799.688) [-1799.500] * (-1798.537) (-1799.846) [-1800.236] (-1798.800) -- 0:00:48
      314500 -- (-1801.940) (-1801.040) [-1798.158] (-1799.505) * [-1797.713] (-1798.619) (-1800.587) (-1797.593) -- 0:00:47
      315000 -- (-1802.409) (-1800.365) [-1796.968] (-1799.826) * (-1797.813) [-1799.579] (-1803.098) (-1797.730) -- 0:00:47

      Average standard deviation of split frequencies: 0.016724

      315500 -- (-1797.744) [-1798.263] (-1797.479) (-1798.479) * (-1800.062) [-1800.146] (-1802.344) (-1798.852) -- 0:00:47
      316000 -- (-1800.033) (-1798.011) [-1797.908] (-1800.954) * [-1798.652] (-1800.331) (-1800.369) (-1798.013) -- 0:00:47
      316500 -- (-1800.456) (-1799.893) [-1797.523] (-1798.764) * (-1803.496) (-1800.545) (-1797.708) [-1798.118] -- 0:00:47
      317000 -- (-1798.308) [-1797.780] (-1797.055) (-1796.941) * (-1801.473) (-1798.204) [-1800.361] (-1796.584) -- 0:00:47
      317500 -- [-1796.814] (-1799.480) (-1798.670) (-1800.033) * [-1799.530] (-1798.984) (-1801.655) (-1797.770) -- 0:00:47
      318000 -- (-1798.090) [-1800.185] (-1797.296) (-1801.663) * (-1798.836) (-1800.351) (-1802.079) [-1798.372] -- 0:00:47
      318500 -- (-1798.222) [-1795.277] (-1798.230) (-1800.706) * [-1797.917] (-1799.082) (-1798.526) (-1797.894) -- 0:00:47
      319000 -- (-1797.606) (-1797.288) (-1805.311) [-1799.325] * (-1796.769) (-1799.912) (-1798.266) [-1803.626] -- 0:00:46
      319500 -- (-1796.609) (-1797.325) [-1798.620] (-1799.521) * (-1796.682) (-1803.945) [-1801.522] (-1798.607) -- 0:00:46
      320000 -- (-1797.919) (-1798.167) (-1795.897) [-1797.641] * [-1796.615] (-1800.826) (-1801.244) (-1806.470) -- 0:00:46

      Average standard deviation of split frequencies: 0.015681

      320500 -- (-1801.688) (-1801.240) (-1798.631) [-1800.188] * (-1799.131) [-1800.999] (-1801.590) (-1801.829) -- 0:00:46
      321000 -- (-1799.925) (-1796.337) (-1796.431) [-1798.876] * [-1801.185] (-1799.888) (-1802.533) (-1798.757) -- 0:00:46
      321500 -- (-1799.422) [-1800.708] (-1801.148) (-1798.547) * (-1800.472) (-1797.713) [-1799.959] (-1797.790) -- 0:00:46
      322000 -- (-1804.217) (-1798.830) (-1802.043) [-1797.129] * [-1801.151] (-1800.298) (-1805.247) (-1799.280) -- 0:00:46
      322500 -- (-1799.884) [-1797.529] (-1801.075) (-1797.917) * [-1800.105] (-1805.820) (-1798.964) (-1800.250) -- 0:00:46
      323000 -- (-1799.835) (-1797.364) (-1796.781) [-1799.279] * (-1802.287) (-1798.918) (-1797.481) [-1796.115] -- 0:00:46
      323500 -- [-1801.982] (-1796.562) (-1798.581) (-1802.945) * (-1801.329) (-1798.189) (-1797.939) [-1798.785] -- 0:00:46
      324000 -- (-1796.580) (-1798.024) (-1800.851) [-1800.160] * (-1799.371) [-1800.100] (-1798.565) (-1796.920) -- 0:00:45
      324500 -- [-1795.495] (-1800.738) (-1797.911) (-1799.157) * (-1799.930) (-1798.963) (-1800.204) [-1798.845] -- 0:00:45
      325000 -- (-1797.573) (-1800.884) [-1795.904] (-1798.646) * (-1800.871) [-1803.317] (-1805.267) (-1801.586) -- 0:00:45

      Average standard deviation of split frequencies: 0.014621

      325500 -- [-1798.041] (-1798.413) (-1800.172) (-1798.878) * (-1800.096) (-1798.448) (-1799.598) [-1798.313] -- 0:00:47
      326000 -- (-1796.579) (-1799.189) [-1797.842] (-1798.088) * [-1798.265] (-1800.521) (-1799.783) (-1797.732) -- 0:00:47
      326500 -- [-1800.239] (-1796.471) (-1799.040) (-1801.772) * (-1797.798) (-1799.303) [-1798.949] (-1797.884) -- 0:00:47
      327000 -- (-1800.153) (-1802.298) (-1797.251) [-1797.908] * [-1798.480] (-1798.285) (-1801.914) (-1799.070) -- 0:00:47
      327500 -- (-1800.164) (-1797.396) (-1796.051) [-1800.806] * (-1802.324) (-1799.381) [-1802.581] (-1799.670) -- 0:00:47
      328000 -- (-1798.325) (-1797.203) (-1797.069) [-1798.803] * [-1800.693] (-1800.440) (-1800.568) (-1799.998) -- 0:00:47
      328500 -- (-1798.365) (-1797.223) [-1798.571] (-1801.127) * (-1798.875) (-1798.462) (-1799.336) [-1800.849] -- 0:00:47
      329000 -- [-1797.614] (-1798.899) (-1799.119) (-1798.527) * (-1799.646) [-1799.468] (-1796.971) (-1796.594) -- 0:00:46
      329500 -- (-1796.987) (-1795.216) [-1797.729] (-1797.591) * (-1799.144) [-1799.329] (-1803.150) (-1798.363) -- 0:00:46
      330000 -- (-1798.561) (-1795.462) [-1798.541] (-1798.248) * (-1800.043) (-1799.359) [-1796.185] (-1798.044) -- 0:00:46

      Average standard deviation of split frequencies: 0.014335

      330500 -- (-1797.545) [-1796.430] (-1798.766) (-1799.619) * (-1800.035) (-1801.793) (-1797.570) [-1798.166] -- 0:00:46
      331000 -- (-1797.483) (-1795.586) (-1798.322) [-1798.281] * [-1803.137] (-1798.164) (-1801.072) (-1799.031) -- 0:00:46
      331500 -- [-1795.136] (-1799.075) (-1797.816) (-1797.480) * (-1799.300) (-1800.872) (-1798.825) [-1797.676] -- 0:00:46
      332000 -- (-1804.185) (-1804.728) [-1795.729] (-1799.567) * [-1797.363] (-1800.384) (-1802.087) (-1799.644) -- 0:00:46
      332500 -- (-1803.031) [-1797.685] (-1802.332) (-1800.640) * (-1797.762) (-1798.572) [-1798.796] (-1797.594) -- 0:00:46
      333000 -- (-1798.686) [-1798.192] (-1801.401) (-1797.772) * (-1802.918) [-1799.532] (-1797.495) (-1797.856) -- 0:00:46
      333500 -- (-1795.791) (-1799.721) [-1798.903] (-1798.312) * (-1800.013) (-1801.744) (-1798.608) [-1799.265] -- 0:00:45
      334000 -- (-1799.725) (-1797.693) [-1796.257] (-1799.636) * [-1797.174] (-1798.742) (-1799.611) (-1802.063) -- 0:00:45
      334500 -- (-1798.205) [-1799.332] (-1795.766) (-1798.225) * [-1799.677] (-1799.575) (-1803.169) (-1803.126) -- 0:00:45
      335000 -- (-1800.016) (-1798.493) [-1796.490] (-1800.632) * [-1798.860] (-1798.378) (-1800.807) (-1802.336) -- 0:00:45

      Average standard deviation of split frequencies: 0.014186

      335500 -- [-1799.395] (-1798.314) (-1799.286) (-1802.874) * [-1797.059] (-1798.450) (-1801.121) (-1798.712) -- 0:00:45
      336000 -- (-1799.284) (-1803.160) (-1802.725) [-1798.462] * (-1795.973) [-1797.059] (-1800.059) (-1796.821) -- 0:00:45
      336500 -- [-1799.200] (-1797.209) (-1798.503) (-1798.669) * (-1798.340) (-1796.193) (-1802.213) [-1798.509] -- 0:00:45
      337000 -- (-1798.265) (-1801.905) (-1799.014) [-1797.889] * (-1798.995) [-1797.657] (-1800.132) (-1799.331) -- 0:00:45
      337500 -- (-1799.013) [-1799.644] (-1798.101) (-1797.716) * [-1800.172] (-1801.422) (-1799.600) (-1796.752) -- 0:00:45
      338000 -- (-1804.748) [-1800.560] (-1799.290) (-1797.860) * (-1801.427) (-1799.857) [-1798.485] (-1803.510) -- 0:00:45
      338500 -- (-1803.265) (-1799.530) (-1799.833) [-1800.513] * (-1799.745) (-1800.331) (-1798.649) [-1796.095] -- 0:00:44
      339000 -- [-1801.443] (-1798.889) (-1797.821) (-1800.186) * (-1804.546) (-1801.952) (-1802.981) [-1797.321] -- 0:00:44
      339500 -- (-1797.987) [-1801.693] (-1801.608) (-1798.461) * (-1801.073) [-1801.717] (-1801.594) (-1797.331) -- 0:00:44
      340000 -- (-1804.060) [-1799.186] (-1798.266) (-1797.628) * (-1798.781) (-1803.212) [-1802.149] (-1797.042) -- 0:00:46

      Average standard deviation of split frequencies: 0.013761

      340500 -- (-1800.493) [-1799.424] (-1806.766) (-1797.979) * (-1800.342) (-1800.785) (-1800.220) [-1795.718] -- 0:00:46
      341000 -- (-1802.021) (-1799.486) (-1800.304) [-1799.395] * (-1802.567) [-1800.183] (-1799.429) (-1798.803) -- 0:00:46
      341500 -- (-1798.765) [-1797.802] (-1795.652) (-1797.844) * (-1799.710) (-1800.626) (-1799.667) [-1797.033] -- 0:00:46
      342000 -- (-1801.161) (-1798.674) [-1798.519] (-1798.500) * [-1798.441] (-1798.124) (-1799.891) (-1796.977) -- 0:00:46
      342500 -- [-1798.772] (-1797.779) (-1799.796) (-1798.674) * [-1799.612] (-1799.784) (-1798.945) (-1798.598) -- 0:00:46
      343000 -- (-1798.497) (-1797.746) [-1798.590] (-1797.830) * (-1799.529) (-1797.617) [-1801.242] (-1798.900) -- 0:00:45
      343500 -- (-1798.348) [-1797.767] (-1801.495) (-1799.595) * (-1800.428) (-1797.094) (-1799.158) [-1800.009] -- 0:00:45
      344000 -- (-1798.807) (-1797.824) [-1800.419] (-1798.903) * (-1800.568) [-1798.660] (-1801.610) (-1801.292) -- 0:00:45
      344500 -- (-1800.920) [-1801.250] (-1798.956) (-1799.255) * [-1799.164] (-1802.790) (-1799.324) (-1798.468) -- 0:00:45
      345000 -- (-1802.419) (-1795.910) [-1796.867] (-1801.967) * [-1798.551] (-1797.559) (-1798.443) (-1802.554) -- 0:00:45

      Average standard deviation of split frequencies: 0.013700

      345500 -- [-1798.994] (-1797.081) (-1798.238) (-1800.107) * (-1798.683) (-1800.509) (-1798.453) [-1799.493] -- 0:00:45
      346000 -- (-1798.433) (-1799.579) [-1795.634] (-1799.079) * [-1799.034] (-1800.340) (-1800.045) (-1799.224) -- 0:00:45
      346500 -- (-1801.115) (-1796.517) [-1795.898] (-1799.931) * [-1796.465] (-1797.269) (-1799.001) (-1801.265) -- 0:00:45
      347000 -- (-1798.485) (-1796.417) (-1797.507) [-1800.519] * (-1799.352) (-1796.995) (-1801.759) [-1800.814] -- 0:00:45
      347500 -- (-1799.313) [-1799.324] (-1799.477) (-1803.094) * [-1799.137] (-1797.497) (-1805.381) (-1805.699) -- 0:00:45
      348000 -- (-1798.060) (-1800.416) (-1797.947) [-1800.049] * (-1798.535) (-1796.869) [-1796.447] (-1798.524) -- 0:00:44
      348500 -- (-1798.004) [-1800.134] (-1799.221) (-1798.354) * (-1798.657) (-1798.223) [-1799.706] (-1799.294) -- 0:00:44
      349000 -- (-1799.517) (-1798.910) (-1797.279) [-1799.727] * (-1798.031) (-1796.843) (-1803.473) [-1801.691] -- 0:00:44
      349500 -- (-1797.772) (-1798.661) [-1798.314] (-1798.220) * (-1801.138) (-1797.569) (-1801.252) [-1798.312] -- 0:00:44
      350000 -- (-1798.175) (-1798.525) (-1800.025) [-1799.466] * [-1797.731] (-1798.985) (-1799.515) (-1800.748) -- 0:00:44

      Average standard deviation of split frequencies: 0.014009

      350500 -- (-1802.935) [-1798.661] (-1801.364) (-1802.540) * (-1798.079) (-1798.700) [-1799.484] (-1806.698) -- 0:00:44
      351000 -- (-1799.057) [-1798.931] (-1799.392) (-1800.963) * (-1801.776) [-1801.103] (-1799.058) (-1799.296) -- 0:00:44
      351500 -- [-1796.564] (-1799.555) (-1798.794) (-1800.944) * (-1802.337) (-1800.811) [-1800.450] (-1798.940) -- 0:00:44
      352000 -- (-1799.347) [-1798.612] (-1797.636) (-1801.087) * (-1798.674) (-1800.813) (-1799.742) [-1799.091] -- 0:00:44
      352500 -- (-1802.760) [-1801.403] (-1797.436) (-1797.302) * [-1799.146] (-1798.573) (-1805.074) (-1798.494) -- 0:00:44
      353000 -- (-1800.307) (-1799.805) (-1798.545) [-1799.532] * (-1799.620) (-1800.780) (-1801.080) [-1797.054] -- 0:00:43
      353500 -- (-1798.979) [-1797.187] (-1798.447) (-1798.055) * (-1800.272) (-1797.700) (-1800.031) [-1798.303] -- 0:00:43
      354000 -- (-1803.989) [-1797.150] (-1797.544) (-1799.735) * (-1799.175) [-1797.179] (-1801.876) (-1800.024) -- 0:00:43
      354500 -- (-1799.000) (-1798.526) [-1798.484] (-1797.767) * (-1802.079) (-1800.272) [-1798.328] (-1797.950) -- 0:00:45
      355000 -- (-1799.066) (-1799.617) (-1798.902) [-1797.588] * (-1799.256) [-1799.343] (-1799.375) (-1796.879) -- 0:00:45

      Average standard deviation of split frequencies: 0.014287

      355500 -- (-1799.053) (-1799.866) (-1798.431) [-1800.861] * (-1799.320) (-1803.135) (-1798.115) [-1800.730] -- 0:00:45
      356000 -- (-1801.222) (-1800.086) [-1797.249] (-1799.274) * [-1801.417] (-1803.871) (-1797.961) (-1798.914) -- 0:00:45
      356500 -- (-1797.789) (-1796.725) (-1801.438) [-1798.754] * (-1799.811) (-1801.240) [-1798.356] (-1797.165) -- 0:00:45
      357000 -- (-1799.253) [-1798.851] (-1798.805) (-1798.218) * (-1800.346) [-1799.614] (-1797.906) (-1797.994) -- 0:00:45
      357500 -- (-1799.829) (-1799.641) (-1798.762) [-1799.722] * (-1800.162) (-1798.811) [-1800.020] (-1804.401) -- 0:00:44
      358000 -- (-1802.439) (-1800.076) [-1799.199] (-1800.098) * [-1798.564] (-1798.599) (-1797.691) (-1797.970) -- 0:00:44
      358500 -- (-1800.347) (-1798.945) [-1800.992] (-1799.793) * (-1797.875) [-1798.077] (-1799.120) (-1802.119) -- 0:00:44
      359000 -- [-1796.362] (-1796.180) (-1804.237) (-1796.634) * (-1799.010) [-1800.835] (-1801.289) (-1801.818) -- 0:00:44
      359500 -- (-1798.222) (-1798.621) (-1801.515) [-1797.039] * [-1801.122] (-1798.280) (-1800.762) (-1800.571) -- 0:00:44
      360000 -- (-1797.689) (-1797.958) (-1801.454) [-1795.885] * [-1797.783] (-1798.111) (-1799.896) (-1798.663) -- 0:00:44

      Average standard deviation of split frequencies: 0.013216

      360500 -- (-1805.102) (-1797.880) [-1800.169] (-1797.685) * (-1798.153) [-1796.724] (-1796.825) (-1798.933) -- 0:00:44
      361000 -- (-1801.509) (-1798.564) (-1803.057) [-1797.322] * (-1799.120) (-1798.543) (-1802.557) [-1800.026] -- 0:00:44
      361500 -- (-1800.863) (-1800.794) (-1799.135) [-1796.384] * (-1799.609) (-1798.360) (-1799.374) [-1798.678] -- 0:00:44
      362000 -- (-1798.042) (-1799.067) (-1799.038) [-1795.989] * (-1799.080) (-1799.119) (-1800.938) [-1804.318] -- 0:00:44
      362500 -- [-1798.342] (-1797.955) (-1797.639) (-1796.748) * [-1798.750] (-1798.898) (-1799.229) (-1799.176) -- 0:00:43
      363000 -- [-1798.611] (-1801.434) (-1799.070) (-1796.879) * (-1799.050) (-1799.937) (-1800.229) [-1799.612] -- 0:00:43
      363500 -- (-1797.774) [-1800.975] (-1800.128) (-1796.853) * (-1800.047) [-1798.348] (-1798.453) (-1799.681) -- 0:00:43
      364000 -- (-1799.106) (-1799.292) (-1800.788) [-1799.558] * [-1798.348] (-1797.621) (-1799.858) (-1797.685) -- 0:00:43
      364500 -- [-1796.247] (-1799.277) (-1799.980) (-1802.662) * (-1798.491) (-1799.107) (-1801.111) [-1798.976] -- 0:00:43
      365000 -- [-1797.546] (-1799.287) (-1797.313) (-1797.968) * (-1800.760) [-1798.933] (-1798.341) (-1797.460) -- 0:00:43

      Average standard deviation of split frequencies: 0.013910

      365500 -- (-1797.052) [-1800.611] (-1803.836) (-1798.889) * (-1799.949) (-1801.294) [-1801.140] (-1800.782) -- 0:00:43
      366000 -- (-1801.670) (-1801.292) [-1803.642] (-1798.606) * (-1801.688) [-1800.258] (-1799.930) (-1799.008) -- 0:00:43
      366500 -- (-1808.695) (-1799.029) (-1799.738) [-1797.786] * (-1799.594) (-1799.188) (-1799.625) [-1802.581] -- 0:00:43
      367000 -- [-1799.559] (-1800.055) (-1800.142) (-1796.847) * (-1798.466) (-1799.921) [-1797.895] (-1800.710) -- 0:00:43
      367500 -- [-1796.767] (-1798.949) (-1799.166) (-1797.660) * (-1798.316) [-1798.856] (-1798.775) (-1798.069) -- 0:00:43
      368000 -- [-1797.923] (-1798.687) (-1798.508) (-1798.758) * (-1799.880) (-1797.649) [-1798.353] (-1796.857) -- 0:00:42
      368500 -- [-1798.109] (-1797.469) (-1809.365) (-1799.718) * [-1800.143] (-1798.277) (-1798.803) (-1800.028) -- 0:00:44
      369000 -- (-1797.138) [-1796.945] (-1798.704) (-1798.911) * (-1800.143) [-1798.887] (-1798.759) (-1799.655) -- 0:00:44
      369500 -- (-1797.839) (-1797.110) [-1800.240] (-1800.234) * (-1802.262) (-1798.986) (-1798.126) [-1799.546] -- 0:00:44
      370000 -- (-1798.288) (-1796.957) [-1799.705] (-1799.498) * (-1800.128) [-1798.360] (-1798.915) (-1796.266) -- 0:00:44

      Average standard deviation of split frequencies: 0.013672

      370500 -- [-1798.166] (-1797.051) (-1798.631) (-1804.140) * (-1802.324) [-1798.797] (-1802.765) (-1796.802) -- 0:00:44
      371000 -- (-1798.089) (-1797.790) [-1798.130] (-1804.320) * (-1800.669) (-1802.077) (-1798.159) [-1799.781] -- 0:00:44
      371500 -- (-1798.178) [-1797.893] (-1805.606) (-1800.807) * (-1802.293) (-1799.374) [-1797.976] (-1799.482) -- 0:00:43
      372000 -- (-1800.934) [-1799.267] (-1799.471) (-1797.286) * (-1806.658) (-1798.709) (-1797.705) [-1798.265] -- 0:00:43
      372500 -- (-1800.727) (-1801.162) (-1799.820) [-1797.702] * [-1801.004] (-1799.209) (-1800.448) (-1802.092) -- 0:00:43
      373000 -- (-1798.157) (-1797.071) (-1803.053) [-1798.450] * (-1803.642) (-1800.022) (-1799.432) [-1800.479] -- 0:00:43
      373500 -- (-1800.215) [-1795.320] (-1797.863) (-1795.826) * (-1801.715) [-1798.306] (-1799.266) (-1796.900) -- 0:00:43
      374000 -- [-1803.483] (-1796.348) (-1801.770) (-1798.296) * (-1800.646) (-1797.871) [-1797.930] (-1795.755) -- 0:00:43
      374500 -- (-1800.241) [-1798.222] (-1802.432) (-1798.769) * (-1799.652) (-1800.715) (-1797.538) [-1797.404] -- 0:00:43
      375000 -- [-1799.860] (-1800.335) (-1797.855) (-1800.463) * (-1798.185) (-1800.531) [-1799.267] (-1800.218) -- 0:00:43

      Average standard deviation of split frequencies: 0.013395

      375500 -- [-1802.536] (-1799.391) (-1799.085) (-1800.668) * [-1798.307] (-1798.175) (-1796.879) (-1801.762) -- 0:00:43
      376000 -- (-1797.144) (-1799.376) [-1799.684] (-1800.059) * (-1799.684) (-1798.994) [-1797.437] (-1797.852) -- 0:00:43
      376500 -- (-1799.722) (-1801.453) [-1798.785] (-1797.263) * (-1798.315) [-1800.168] (-1799.130) (-1798.822) -- 0:00:43
      377000 -- (-1798.165) [-1798.425] (-1802.008) (-1798.287) * (-1800.618) (-1799.651) (-1798.252) [-1797.013] -- 0:00:42
      377500 -- (-1800.583) (-1798.975) [-1798.693] (-1799.295) * (-1800.738) (-1800.120) (-1800.643) [-1797.245] -- 0:00:42
      378000 -- [-1799.493] (-1804.231) (-1798.841) (-1800.697) * (-1802.088) [-1798.588] (-1800.338) (-1799.152) -- 0:00:42
      378500 -- [-1796.708] (-1802.139) (-1800.315) (-1799.304) * (-1799.167) [-1797.831] (-1801.196) (-1796.158) -- 0:00:42
      379000 -- [-1797.434] (-1801.174) (-1798.700) (-1797.807) * (-1798.700) [-1800.263] (-1798.516) (-1798.841) -- 0:00:42
      379500 -- (-1797.939) (-1799.431) [-1797.441] (-1798.604) * (-1800.897) (-1801.053) [-1796.856] (-1805.962) -- 0:00:42
      380000 -- (-1797.724) (-1800.723) [-1796.957] (-1796.439) * (-1800.747) (-1800.504) [-1799.172] (-1798.471) -- 0:00:42

      Average standard deviation of split frequencies: 0.011993

      380500 -- (-1797.866) [-1804.202] (-1800.731) (-1797.667) * [-1801.472] (-1798.582) (-1798.047) (-1802.848) -- 0:00:42
      381000 -- (-1798.611) [-1798.841] (-1797.494) (-1798.929) * (-1798.682) [-1800.093] (-1799.585) (-1800.691) -- 0:00:42
      381500 -- (-1798.209) (-1799.117) (-1799.166) [-1800.689] * (-1798.592) (-1798.773) [-1795.475] (-1800.859) -- 0:00:42
      382000 -- (-1798.099) [-1797.012] (-1801.020) (-1799.690) * (-1799.084) [-1800.030] (-1798.699) (-1797.692) -- 0:00:42
      382500 -- (-1799.939) [-1798.976] (-1799.658) (-1799.030) * (-1800.940) (-1798.655) [-1797.970] (-1799.260) -- 0:00:41
      383000 -- (-1800.247) (-1799.462) (-1798.985) [-1798.073] * (-1801.202) [-1797.574] (-1799.340) (-1798.176) -- 0:00:43
      383500 -- [-1797.594] (-1798.241) (-1801.223) (-1799.721) * (-1800.099) (-1799.901) (-1801.905) [-1797.809] -- 0:00:43
      384000 -- [-1794.681] (-1799.650) (-1798.339) (-1799.052) * (-1799.246) (-1799.692) (-1800.381) [-1799.708] -- 0:00:43
      384500 -- (-1798.921) [-1798.768] (-1798.908) (-1800.061) * (-1799.752) [-1800.544] (-1798.287) (-1797.289) -- 0:00:43
      385000 -- (-1797.336) (-1800.826) (-1798.081) [-1799.361] * (-1799.019) [-1799.664] (-1800.028) (-1800.404) -- 0:00:43

      Average standard deviation of split frequencies: 0.011248

      385500 -- [-1799.067] (-1804.466) (-1801.852) (-1803.471) * (-1799.571) (-1799.705) [-1798.813] (-1799.364) -- 0:00:43
      386000 -- (-1801.107) [-1799.886] (-1798.065) (-1799.288) * [-1800.334] (-1802.019) (-1796.325) (-1797.459) -- 0:00:42
      386500 -- [-1804.662] (-1798.099) (-1798.985) (-1799.105) * (-1799.060) (-1801.896) [-1795.940] (-1797.098) -- 0:00:42
      387000 -- (-1801.340) (-1801.899) (-1801.336) [-1799.327] * (-1799.253) (-1799.323) (-1799.451) [-1800.443] -- 0:00:42
      387500 -- (-1799.423) (-1797.278) [-1798.569] (-1798.156) * (-1798.433) [-1799.086] (-1801.622) (-1799.160) -- 0:00:42
      388000 -- [-1797.352] (-1799.494) (-1797.713) (-1805.526) * [-1799.636] (-1798.767) (-1799.170) (-1797.850) -- 0:00:42
      388500 -- (-1801.943) (-1799.139) [-1797.576] (-1801.613) * (-1799.825) (-1798.836) (-1797.901) [-1796.879] -- 0:00:42
      389000 -- (-1802.111) [-1799.643] (-1796.455) (-1798.133) * (-1799.692) [-1798.121] (-1799.217) (-1798.169) -- 0:00:42
      389500 -- (-1797.939) (-1799.241) (-1798.190) [-1797.863] * (-1800.872) [-1797.710] (-1797.714) (-1797.270) -- 0:00:42
      390000 -- (-1797.871) [-1800.723] (-1798.495) (-1796.668) * (-1798.850) [-1798.047] (-1796.887) (-1799.651) -- 0:00:42

      Average standard deviation of split frequencies: 0.011178

      390500 -- (-1802.087) (-1799.409) (-1797.707) [-1797.446] * (-1798.769) (-1797.918) (-1798.725) [-1796.290] -- 0:00:42
      391000 -- (-1800.093) (-1798.918) [-1799.993] (-1796.946) * [-1797.292] (-1796.018) (-1800.198) (-1801.938) -- 0:00:42
      391500 -- [-1797.652] (-1798.040) (-1800.136) (-1795.962) * (-1798.646) [-1799.286] (-1797.033) (-1802.926) -- 0:00:41
      392000 -- (-1796.028) (-1800.082) (-1803.312) [-1796.051] * (-1803.754) (-1796.348) (-1797.007) [-1799.095] -- 0:00:41
      392500 -- (-1798.497) [-1802.824] (-1798.740) (-1798.610) * [-1800.439] (-1797.734) (-1798.994) (-1797.174) -- 0:00:41
      393000 -- (-1800.789) [-1797.486] (-1799.511) (-1798.905) * (-1797.649) (-1797.972) [-1797.630] (-1798.836) -- 0:00:41
      393500 -- [-1797.559] (-1801.667) (-1797.720) (-1809.970) * (-1798.851) [-1796.999] (-1796.553) (-1801.549) -- 0:00:41
      394000 -- (-1799.385) (-1799.424) [-1798.609] (-1807.511) * (-1799.186) [-1796.486] (-1796.633) (-1800.047) -- 0:00:41
      394500 -- [-1799.362] (-1799.448) (-1799.255) (-1802.287) * (-1799.907) (-1798.336) [-1796.246] (-1797.191) -- 0:00:41
      395000 -- (-1798.337) (-1801.243) [-1800.577] (-1801.609) * (-1801.781) (-1796.901) (-1802.884) [-1796.923] -- 0:00:41

      Average standard deviation of split frequencies: 0.011309

      395500 -- (-1797.551) [-1797.063] (-1800.492) (-1796.734) * (-1801.076) (-1797.148) [-1798.665] (-1801.018) -- 0:00:41
      396000 -- (-1798.178) (-1800.057) (-1799.849) [-1798.926] * (-1801.037) (-1801.460) (-1798.206) [-1802.999] -- 0:00:41
      396500 -- (-1799.011) (-1798.152) [-1802.769] (-1801.953) * [-1797.564] (-1799.772) (-1797.544) (-1803.657) -- 0:00:41
      397000 -- (-1797.356) (-1799.697) [-1798.188] (-1802.012) * [-1798.177] (-1798.325) (-1800.702) (-1799.714) -- 0:00:41
      397500 -- (-1797.017) (-1801.723) [-1797.197] (-1799.291) * (-1798.553) [-1797.901] (-1798.587) (-1797.572) -- 0:00:42
      398000 -- (-1802.618) (-1802.100) (-1797.191) [-1800.653] * [-1798.004] (-1798.681) (-1800.540) (-1800.137) -- 0:00:42
      398500 -- (-1800.188) (-1801.016) (-1798.175) [-1797.938] * (-1799.361) (-1800.435) (-1796.877) [-1797.906] -- 0:00:42
      399000 -- (-1797.312) (-1800.196) (-1796.148) [-1798.238] * [-1796.968] (-1798.013) (-1799.334) (-1797.385) -- 0:00:42
      399500 -- (-1799.505) (-1802.897) (-1796.680) [-1796.046] * [-1796.407] (-1799.393) (-1798.786) (-1797.076) -- 0:00:42
      400000 -- [-1799.032] (-1797.081) (-1797.924) (-1797.146) * (-1797.946) [-1797.170] (-1797.983) (-1797.704) -- 0:00:41

      Average standard deviation of split frequencies: 0.012571

      400500 -- [-1796.985] (-1797.675) (-1801.925) (-1802.155) * (-1799.999) (-1797.144) (-1800.522) [-1797.444] -- 0:00:41
      401000 -- (-1797.615) (-1797.275) [-1799.397] (-1798.446) * (-1799.625) (-1802.421) (-1799.182) [-1796.168] -- 0:00:41
      401500 -- [-1798.246] (-1801.802) (-1798.450) (-1797.634) * (-1797.136) [-1799.212] (-1799.657) (-1805.000) -- 0:00:41
      402000 -- (-1799.514) (-1804.004) (-1795.863) [-1799.824] * [-1795.951] (-1798.226) (-1798.339) (-1798.058) -- 0:00:41
      402500 -- (-1799.378) (-1800.339) [-1805.833] (-1800.557) * (-1798.253) (-1798.848) (-1801.023) [-1802.429] -- 0:00:41
      403000 -- (-1801.978) (-1800.673) [-1798.279] (-1799.043) * (-1799.097) (-1798.602) (-1801.750) [-1799.799] -- 0:00:41
      403500 -- (-1804.255) [-1797.615] (-1803.195) (-1799.438) * [-1799.057] (-1801.189) (-1798.176) (-1800.486) -- 0:00:41
      404000 -- (-1803.365) (-1799.319) [-1800.461] (-1799.707) * (-1798.638) [-1798.065] (-1803.247) (-1797.352) -- 0:00:41
      404500 -- (-1803.111) [-1797.959] (-1797.630) (-1801.498) * (-1801.818) (-1799.121) (-1801.574) [-1797.646] -- 0:00:41
      405000 -- (-1799.162) (-1798.941) [-1801.387] (-1799.683) * [-1800.260] (-1798.567) (-1802.277) (-1797.606) -- 0:00:41

      Average standard deviation of split frequencies: 0.012528

      405500 -- (-1799.241) (-1801.267) [-1798.993] (-1802.671) * (-1800.160) [-1798.547] (-1799.366) (-1803.413) -- 0:00:41
      406000 -- (-1800.045) [-1799.755] (-1798.279) (-1797.645) * [-1799.511] (-1797.926) (-1798.980) (-1797.137) -- 0:00:40
      406500 -- (-1802.023) (-1798.644) (-1796.893) [-1797.848] * [-1798.384] (-1799.397) (-1799.570) (-1798.451) -- 0:00:40
      407000 -- (-1797.963) (-1796.657) [-1796.208] (-1798.820) * (-1798.216) [-1801.050] (-1797.852) (-1804.814) -- 0:00:40
      407500 -- (-1800.621) (-1796.955) [-1797.868] (-1803.094) * (-1800.961) (-1798.633) [-1798.655] (-1799.201) -- 0:00:40
      408000 -- (-1797.977) (-1799.109) [-1798.750] (-1800.685) * [-1800.425] (-1800.356) (-1799.265) (-1797.472) -- 0:00:40
      408500 -- [-1799.416] (-1801.098) (-1801.289) (-1801.282) * (-1796.535) (-1806.055) (-1798.544) [-1796.843] -- 0:00:40
      409000 -- (-1798.437) [-1799.125] (-1798.926) (-1798.969) * [-1800.896] (-1798.681) (-1801.040) (-1798.705) -- 0:00:40
      409500 -- (-1798.821) (-1798.985) (-1800.923) [-1798.977] * (-1799.109) (-1798.832) (-1798.911) [-1796.846] -- 0:00:40
      410000 -- [-1796.265] (-1800.902) (-1801.924) (-1798.319) * [-1797.328] (-1798.676) (-1799.687) (-1796.246) -- 0:00:40

      Average standard deviation of split frequencies: 0.013029

      410500 -- (-1797.446) (-1799.507) [-1800.904] (-1798.563) * [-1797.834] (-1797.311) (-1800.176) (-1798.652) -- 0:00:40
      411000 -- [-1801.934] (-1799.033) (-1800.682) (-1797.833) * (-1800.874) (-1798.104) (-1799.430) [-1798.144] -- 0:00:40
      411500 -- (-1801.882) [-1801.540] (-1798.878) (-1798.313) * [-1797.876] (-1798.279) (-1801.890) (-1800.855) -- 0:00:41
      412000 -- (-1799.751) (-1796.921) [-1797.879] (-1797.081) * (-1799.999) (-1797.955) (-1800.548) [-1798.588] -- 0:00:41
      412500 -- (-1799.985) [-1799.932] (-1799.368) (-1799.215) * (-1799.464) [-1798.955] (-1800.418) (-1800.284) -- 0:00:41
      413000 -- (-1799.821) [-1798.174] (-1799.432) (-1798.990) * (-1798.788) [-1800.185] (-1798.628) (-1797.271) -- 0:00:41
      413500 -- (-1797.779) (-1798.908) (-1800.087) [-1797.689] * (-1796.211) (-1799.867) [-1798.840] (-1800.287) -- 0:00:41
      414000 -- (-1798.169) (-1797.785) (-1797.106) [-1798.047] * (-1796.731) (-1799.598) [-1798.398] (-1798.258) -- 0:00:41
      414500 -- (-1801.431) [-1797.825] (-1799.982) (-1799.364) * (-1798.654) [-1798.870] (-1796.982) (-1801.882) -- 0:00:40
      415000 -- (-1797.753) (-1800.912) (-1803.165) [-1799.269] * (-1800.342) (-1801.145) (-1800.054) [-1797.533] -- 0:00:40

      Average standard deviation of split frequencies: 0.011511

      415500 -- (-1799.566) [-1800.452] (-1799.851) (-1800.784) * (-1798.523) (-1801.250) (-1805.620) [-1797.724] -- 0:00:40
      416000 -- (-1799.033) [-1801.075] (-1799.239) (-1803.704) * (-1802.595) (-1799.557) [-1798.393] (-1799.287) -- 0:00:40
      416500 -- (-1800.063) (-1799.409) (-1799.947) [-1805.417] * [-1796.727] (-1799.120) (-1800.133) (-1799.791) -- 0:00:40
      417000 -- [-1799.850] (-1799.625) (-1798.706) (-1799.976) * (-1798.843) (-1798.362) (-1799.533) [-1798.773] -- 0:00:40
      417500 -- [-1797.180] (-1797.787) (-1799.109) (-1798.182) * (-1800.668) [-1799.074] (-1800.854) (-1798.492) -- 0:00:40
      418000 -- [-1798.275] (-1798.540) (-1798.955) (-1802.086) * (-1804.800) (-1797.557) [-1801.127] (-1799.694) -- 0:00:40
      418500 -- (-1800.617) (-1798.052) [-1801.180] (-1799.282) * (-1800.373) (-1799.336) (-1799.554) [-1797.410] -- 0:00:40
      419000 -- (-1802.809) (-1798.131) (-1798.863) [-1798.277] * [-1800.000] (-1800.368) (-1804.234) (-1799.318) -- 0:00:40
      419500 -- (-1796.504) (-1798.765) [-1798.881] (-1799.118) * (-1800.166) (-1801.389) (-1798.123) [-1799.786] -- 0:00:40
      420000 -- [-1796.536] (-1798.469) (-1799.665) (-1797.853) * (-1802.935) [-1800.573] (-1796.950) (-1800.520) -- 0:00:40

      Average standard deviation of split frequencies: 0.011580

      420500 -- [-1797.795] (-1798.361) (-1800.564) (-1804.784) * [-1799.806] (-1797.663) (-1797.140) (-1800.526) -- 0:00:39
      421000 -- [-1796.321] (-1798.897) (-1800.999) (-1798.818) * (-1801.526) [-1797.991] (-1798.167) (-1798.332) -- 0:00:39
      421500 -- (-1796.877) (-1799.323) [-1798.482] (-1800.011) * (-1797.829) (-1798.370) [-1797.540] (-1798.619) -- 0:00:39
      422000 -- [-1799.013] (-1800.195) (-1799.015) (-1801.731) * (-1797.888) (-1798.059) [-1797.820] (-1797.507) -- 0:00:39
      422500 -- (-1796.597) (-1801.856) [-1798.889] (-1801.195) * (-1799.558) (-1796.568) [-1798.070] (-1796.273) -- 0:00:39
      423000 -- (-1797.384) (-1799.516) [-1797.821] (-1800.628) * (-1799.443) (-1807.768) (-1799.088) [-1796.837] -- 0:00:39
      423500 -- (-1798.382) (-1800.537) (-1800.367) [-1798.697] * (-1799.583) [-1798.159] (-1796.699) (-1801.025) -- 0:00:39
      424000 -- (-1798.982) (-1798.624) (-1800.114) [-1798.930] * (-1800.650) [-1795.945] (-1797.655) (-1799.183) -- 0:00:39
      424500 -- (-1800.265) (-1799.558) [-1799.131] (-1799.296) * (-1805.036) [-1797.022] (-1801.079) (-1799.786) -- 0:00:39
      425000 -- [-1800.908] (-1798.768) (-1801.819) (-1802.307) * (-1801.290) (-1800.306) (-1804.891) [-1800.360] -- 0:00:39

      Average standard deviation of split frequencies: 0.012580

      425500 -- (-1803.235) (-1799.483) [-1801.590] (-1799.069) * (-1797.653) [-1799.451] (-1800.009) (-1802.750) -- 0:00:39
      426000 -- (-1797.488) [-1798.695] (-1799.442) (-1802.047) * (-1796.383) (-1798.866) (-1802.185) [-1802.394] -- 0:00:40
      426500 -- (-1796.389) [-1798.429] (-1798.996) (-1799.486) * (-1798.001)