--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:28:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/pmmB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2172.20         -2175.96
2      -2172.20         -2176.96
--------------------------------------
TOTAL    -2172.20         -2176.58
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896670    0.086103    0.341832    1.437693    0.859942   1501.00   1501.00    1.000
r(A<->C){all}   0.170076    0.020961    0.000049    0.465492    0.128635    173.62    253.26    1.002
r(A<->G){all}   0.152017    0.016914    0.000076    0.417166    0.116894    215.33    250.25    1.000
r(A<->T){all}   0.170920    0.018844    0.000160    0.434186    0.136403    245.64    247.59    1.000
r(C<->G){all}   0.173273    0.021155    0.000056    0.461528    0.133462    323.71    347.03    1.001
r(C<->T){all}   0.166891    0.020112    0.000030    0.450006    0.131588    148.73    155.18    1.004
r(G<->T){all}   0.166824    0.019726    0.000035    0.445169    0.127449    115.90    201.40    1.000
pi(A){all}      0.189083    0.000092    0.168666    0.206743    0.189065   1188.64   1229.11    1.000
pi(C){all}      0.334412    0.000136    0.312134    0.357660    0.334494   1226.77   1259.57    1.000
pi(G){all}      0.305903    0.000131    0.283304    0.328098    0.305905   1211.01   1273.63    1.000
pi(T){all}      0.170603    0.000088    0.153619    0.189619    0.170383   1249.56   1259.00    1.000
alpha{1,2}      0.424623    0.226167    0.000151    1.398513    0.254721   1150.08   1266.40    1.000
alpha{3}        0.472268    0.253421    0.000272    1.507895    0.304967   1270.79   1315.33    1.000
pinvar{all}     0.999108    0.000001    0.997123    1.000000    0.999422    819.40    851.12    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2094.583036
Model 2: PositiveSelection	-2094.583032
Model 0: one-ratio	-2094.583032
Model 7: beta	-2094.583032
Model 8: beta&w>1	-2094.583032


Model 0 vs 1	7.999999979801942E-6

Model 2 vs 1	7.999999979801942E-6

Model 8 vs 7	0.0
>C1
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C2
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C3
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C4
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C5
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C6
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=538 

C1              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C2              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C3              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C4              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C5              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C6              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
                **************************************************

C1              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C2              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C3              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C4              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C5              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C6              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
                **************************************************

C1              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C2              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C3              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C4              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C5              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C6              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
                **************************************************

C1              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C2              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C3              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C4              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C5              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C6              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
                **************************************************

C1              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C2              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C3              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C4              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C5              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C6              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
                **************************************************

C1              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C2              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C3              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C4              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C5              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C6              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
                **************************************************

C1              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C2              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C3              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C4              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C5              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C6              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
                **************************************************

C1              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C2              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C3              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C4              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C5              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C6              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
                **************************************************

C1              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C2              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C3              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C4              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C5              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C6              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
                **************************************************

C1              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C2              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C3              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C4              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C5              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C6              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
                **************************************************

C1              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C2              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C3              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C4              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C5              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C6              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  538 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  538 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16140]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16140]--->[16140]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.570 Mb, Max= 31.144 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C2              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C3              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C4              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C5              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
C6              LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
                **************************************************

C1              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C2              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C3              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C4              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C5              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
C6              RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
                **************************************************

C1              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C2              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C3              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C4              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C5              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
C6              TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
                **************************************************

C1              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C2              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C3              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C4              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C5              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
C6              YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
                **************************************************

C1              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C2              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C3              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C4              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C5              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
C6              YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
                **************************************************

C1              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C2              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C3              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C4              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C5              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
C6              PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
                **************************************************

C1              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C2              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C3              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C4              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C5              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
C6              NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
                **************************************************

C1              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C2              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C3              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C4              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C5              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
C6              AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
                **************************************************

C1              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C2              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C3              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C4              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C5              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
C6              VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
                **************************************************

C1              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C2              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C3              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C4              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C5              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
C6              VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
                **************************************************

C1              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C2              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C3              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C4              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C5              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
C6              PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
C2              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
C3              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
C4              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
C5              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
C6              TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
                **************************************************

C1              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
C2              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
C3              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
C4              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
C5              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
C6              ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
                **************************************************

C1              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
C2              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
C3              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
C4              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
C5              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
C6              GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
                **************************************************

C1              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
C2              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
C3              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
C4              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
C5              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
C6              CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
                **************************************************

C1              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
C2              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
C3              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
C4              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
C5              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
C6              GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
                **************************************************

C1              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
C2              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
C3              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
C4              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
C5              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
C6              TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
                **************************************************

C1              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
C2              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
C3              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
C4              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
C5              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
C6              ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
                **************************************************

C1              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
C2              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
C3              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
C4              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
C5              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
C6              TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
                **************************************************

C1              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
C2              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
C3              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
C4              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
C5              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
C6              CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
                **************************************************

C1              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
C2              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
C3              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
C4              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
C5              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
C6              TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
                **************************************************

C1              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
C2              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
C3              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
C4              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
C5              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
C6              CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
                **************************************************

C1              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
C2              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
C3              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
C4              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
C5              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
C6              GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
                **************************************************

C1              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
C2              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
C3              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
C4              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
C5              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
C6              TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
                **************************************************

C1              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
C2              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
C3              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
C4              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
C5              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
C6              TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
                **************************************************

C1              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
C2              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
C3              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
C4              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
C5              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
C6              TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
                **************************************************

C1              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
C2              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
C3              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
C4              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
C5              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
C6              CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
                **************************************************

C1              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
C2              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
C3              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
C4              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
C5              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
C6              CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
                **************************************************

C1              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
C2              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
C3              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
C4              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
C5              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
C6              CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
                **************************************************

C1              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
C2              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
C3              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
C4              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
C5              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
C6              AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
                **************************************************

C1              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
C2              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
C3              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
C4              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
C5              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
C6              CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
                **************************************************

C1              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
C2              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
C3              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
C4              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
C5              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
C6              GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
                **************************************************

C1              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
C2              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
C3              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
C4              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
C5              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
C6              GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
                **************************************************

C1              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
C2              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
C3              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
C4              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
C5              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
C6              CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
                **************************************************

C1              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
C2              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
C3              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
C4              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
C5              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
C6              ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
                **************************************************

C1              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
C2              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
C3              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
C4              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
C5              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
C6              GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
                **************************************************

C1              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
C2              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
C3              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
C4              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
C5              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
C6              GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
                **************************************************

C1              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
C2              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
C3              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
C4              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
C5              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
C6              CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
                **************************************************

C1              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
C2              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
C3              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
C4              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
C5              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
C6              GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
                **************************************************

C1              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
C2              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
C3              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
C4              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
C5              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
C6              GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
                **************************************************

C1              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
C2              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
C3              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
C4              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
C5              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
C6              GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
                **************************************************

C1              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
C2              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
C3              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
C4              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
C5              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
C6              CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
                **************************************************

C1              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
C2              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
C3              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
C4              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
C5              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
C6              ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
                **************************************************

C1              TGGTGCAGCAGTGG
C2              TGGTGCAGCAGTGG
C3              TGGTGCAGCAGTGG
C4              TGGTGCAGCAGTGG
C5              TGGTGCAGCAGTGG
C6              TGGTGCAGCAGTGG
                **************



>C1
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C2
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C3
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C4
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C5
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C6
TTGAAGGCTGCCGTGACACCCGAAGAGTGGATCACGCACGATCCCGACCC
ACAGACAGCCGCCGAGCTGGCCGCGTGCGACCCCGATGAACTTGCGGCGC
GGTTCACCCGTGCACTGCGCTTCGGCACGTCGGGCTTGCGCGGACCAGTG
CGCGGCGGCCCCGACGCCATGAACCTAGCGGTGGTGTTGCGAGCGACCTG
GGCCGTGGCACAGGTGCTCCTGCAACGAGCGGGCTCGCGGCCTGCAACCG
TAATCGTCGGGCGCGACTCTCGGCACGGCTCGGCGGCATTCGTCGCTGCG
ACCGCTGAGGTGCTTGCCGCTGAAGGTTTTTCCGTTCTGCTGCTACCCAA
TCCGGCACCCACGCCGGTGGTGGCGTTTGCGGTGCGCAATACCGGCGCCG
CGGCCGGGATCCAGATCACAGCATCGCACAACCCGCCGACCGATAACGGG
TACAAGGTGTATTTCGACGGCGGCATCCAGATCATCTCTCCCATTGACCA
CCAAATCGAAAACGCGATGGCCGCTGCTCCCCTGGCCGACCAGATCACCA
GGAAACCCGTAAACCCCAGTGAAAACAGCGCCTCCGATCTGGTTGACCAT
TATATTCAGCGAGCGGCCGCGGTACGGCGCTCCAACGGTTCAGTTCGGGT
TGCCCTTACACCGATGCACGGAGTGGGCGGTGCGGTAGCCGTCGAGACGC
TGCGGCGCACCGGCTTTGACGACGTGCACACCGTAGCGGCGCAGTTCGAG
CCCGACCCCGACTTTCCAACCGTCGCGTTCCCAAACCCGGAGGAGCCCGG
CGCCACCGACGCATTGCTGGCCCTGGCCGCCCATGTCGGGGCCGACGTCG
CGATAGCACTGGACCCCGACGCCGACCGCTGCGCCGTTGGTATACCCACC
AACTCGGGATGGCGGATGCTGTCCGGAGACGAAACCGGTTGGCTGCTAGG
CGATTACATTTTGTCGCAAACCGACAAGCCGGAAACCGCCGTGGTAGCCA
GTACCGTGGTGTCGTCGCGTATGTTGCCAGCAATCGCCACACACTACAAC
GCGGTCCACGTCGAGACCCTCACCGGCTTCAAGTGGCTGGCGCGCGCCGA
CGCAAACCTGCCGGGCACTCTTGTGTACGCCTATGAGGAAGCTATCGGGC
ATTGTGTCGACCCCACTGCCGTACGCGACAAAGACGGCATCAGCGCCGCG
GTGTTAGTGTGCGATCTGGTTGCCGCACTGCACAAGCAGGGCCGCTCGGT
GCCCGACATGCTTGACCAACTCGCCCTACGCCACGGCGTGCACGACGTTA
CAGCAATATCACGTCGCATTGGCCCCAAACAAACGGGAGTTGACGAGGCT
GTCGACCTGATTCAGCGGCTACGCGCAGCCCCGCCGAGTCAGCTGGCCGG
GTTCACCGCGACCACTACCGATATCACCGACGCGCTAATCTTCACCGGCG
GTGATGATGACACGTGGGTCCGGGTAGTGGTGCGGCTATCAGGAACCGAA
CCGAAGTTAAAGTGCTACTTGGAAGTTCGCTGCTCGGTGGCTGGCAACCT
ACCATCCACCCGACAACGGGCCAGGGTGCTGCGCGACGAGCTAGTCACCT
TGGTGCAGCAGTGG
>C1
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C2
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C3
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C4
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C5
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
>C6
LKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPV
RGGPDAMNLAVVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAA
TAEVLAAEGFSVLLLPNPAPTPVVAFAVRNTGAAAGIQITASHNPPTDNG
YKVYFDGGIQIISPIDHQIENAMAAAPLADQITRKPVNPSENSASDLVDH
YIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFDDVHTVAAQFE
PDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYN
AVHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAA
VLVCDLVAALHKQGRSVPDMLDQLALRHGVHDVTAISRRIGPKQTGVDEA
VDLIQRLRAAPPSQLAGFTATTTDITDALIFTGGDDDTWVRVVVRLSGTE
PKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1614 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785990
      Setting output file names to "/data/10res/pmmB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2052398344
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9897596899
      Seed = 988461388
      Swapseed = 1579785990
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3612.209177 -- -24.965149
         Chain 2 -- -3612.209383 -- -24.965149
         Chain 3 -- -3612.209383 -- -24.965149
         Chain 4 -- -3612.209383 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3612.209383 -- -24.965149
         Chain 2 -- -3612.209177 -- -24.965149
         Chain 3 -- -3612.209383 -- -24.965149
         Chain 4 -- -3612.209383 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3612.209] (-3612.209) (-3612.209) (-3612.209) * [-3612.209] (-3612.209) (-3612.209) (-3612.209) 
        500 -- (-2240.501) (-2247.120) [-2179.825] (-2195.788) * (-2238.573) [-2186.759] (-2198.784) (-2202.391) -- 0:00:00
       1000 -- (-2205.335) (-2204.055) [-2180.583] (-2185.075) * (-2179.347) [-2178.175] (-2196.182) (-2187.958) -- 0:00:00
       1500 -- (-2185.431) (-2180.927) (-2179.447) [-2182.121] * [-2176.729] (-2181.086) (-2198.785) (-2181.189) -- 0:00:00
       2000 -- [-2178.359] (-2184.346) (-2180.856) (-2179.478) * (-2185.207) [-2179.427] (-2184.673) (-2188.708) -- 0:00:00
       2500 -- (-2186.711) [-2177.844] (-2181.535) (-2191.125) * (-2181.005) (-2185.093) (-2183.952) [-2176.048] -- 0:00:00
       3000 -- (-2180.506) (-2178.694) (-2181.396) [-2179.334] * (-2191.375) [-2181.090] (-2183.654) (-2178.907) -- 0:00:00
       3500 -- (-2180.180) (-2183.188) [-2177.395] (-2183.269) * [-2181.724] (-2181.216) (-2183.490) (-2182.179) -- 0:00:00
       4000 -- [-2180.645] (-2177.588) (-2185.730) (-2180.105) * (-2192.861) (-2195.581) [-2182.945] (-2184.862) -- 0:00:00
       4500 -- [-2184.393] (-2187.552) (-2175.897) (-2178.907) * (-2182.516) (-2182.205) [-2178.658] (-2177.555) -- 0:03:41
       5000 -- (-2188.423) (-2180.586) [-2181.469] (-2188.098) * [-2180.445] (-2180.612) (-2179.062) (-2182.937) -- 0:03:19

      Average standard deviation of split frequencies: 0.104757

       5500 -- [-2177.198] (-2185.759) (-2178.933) (-2179.019) * (-2179.554) (-2185.931) [-2178.207] (-2182.455) -- 0:03:00
       6000 -- [-2176.220] (-2187.309) (-2188.776) (-2180.624) * [-2182.202] (-2183.982) (-2185.642) (-2188.033) -- 0:02:45
       6500 -- (-2177.712) [-2178.203] (-2182.111) (-2189.706) * (-2184.323) (-2183.280) (-2183.004) [-2178.402] -- 0:02:32
       7000 -- [-2179.306] (-2181.840) (-2191.340) (-2177.940) * (-2181.970) [-2181.779] (-2180.265) (-2182.057) -- 0:02:21
       7500 -- (-2180.925) (-2183.264) [-2181.469] (-2178.944) * (-2179.171) (-2178.507) [-2183.465] (-2185.876) -- 0:02:12
       8000 -- (-2180.469) (-2182.950) (-2182.179) [-2189.116] * [-2178.807] (-2184.897) (-2182.613) (-2177.651) -- 0:02:04
       8500 -- [-2179.134] (-2179.090) (-2180.309) (-2181.631) * (-2184.482) (-2184.959) (-2184.324) [-2182.436] -- 0:01:56
       9000 -- (-2181.961) [-2185.329] (-2182.532) (-2186.994) * (-2180.049) [-2181.710] (-2182.907) (-2180.142) -- 0:01:50
       9500 -- [-2178.640] (-2181.751) (-2181.661) (-2181.265) * (-2184.776) [-2182.744] (-2190.225) (-2193.504) -- 0:01:44
      10000 -- (-2178.320) [-2180.610] (-2178.720) (-2180.617) * (-2183.526) [-2186.323] (-2182.898) (-2182.576) -- 0:01:39

      Average standard deviation of split frequencies: 0.059662

      10500 -- (-2192.693) [-2183.818] (-2179.030) (-2179.580) * [-2178.859] (-2178.604) (-2201.246) (-2181.976) -- 0:01:34
      11000 -- (-2187.376) [-2181.659] (-2182.652) (-2180.137) * (-2187.067) (-2183.910) (-2186.075) [-2180.111] -- 0:01:29
      11500 -- (-2185.878) (-2183.948) [-2181.116] (-2183.431) * [-2188.468] (-2185.215) (-2181.713) (-2190.039) -- 0:01:25
      12000 -- (-2183.007) [-2177.526] (-2179.836) (-2183.074) * (-2178.075) (-2179.925) [-2176.037] (-2176.968) -- 0:01:22
      12500 -- (-2186.280) (-2193.485) (-2181.710) [-2176.330] * (-2184.795) (-2186.289) (-2184.312) [-2181.241] -- 0:01:19
      13000 -- (-2178.291) [-2181.703] (-2191.016) (-2180.914) * [-2176.474] (-2184.935) (-2184.278) (-2183.692) -- 0:01:15
      13500 -- (-2179.287) (-2182.473) [-2184.397] (-2181.282) * (-2182.863) (-2181.088) [-2177.787] (-2182.660) -- 0:01:13
      14000 -- (-2185.479) (-2182.310) (-2185.540) [-2176.518] * (-2175.244) (-2184.330) [-2178.239] (-2187.411) -- 0:01:10
      14500 -- [-2189.080] (-2183.721) (-2182.352) (-2181.015) * [-2177.766] (-2181.409) (-2180.281) (-2182.645) -- 0:01:07
      15000 -- (-2181.381) (-2182.848) (-2184.589) [-2183.574] * [-2182.334] (-2185.401) (-2179.146) (-2178.277) -- 0:01:05

      Average standard deviation of split frequencies: 0.046520

      15500 -- [-2183.103] (-2181.566) (-2197.276) (-2190.069) * [-2175.539] (-2180.303) (-2184.970) (-2177.969) -- 0:01:03
      16000 -- (-2184.552) (-2177.219) [-2177.773] (-2186.801) * (-2180.615) [-2178.713] (-2172.450) (-2184.296) -- 0:01:01
      16500 -- (-2176.375) (-2175.173) [-2174.369] (-2182.609) * (-2181.503) (-2181.177) (-2174.647) [-2176.731] -- 0:00:59
      17000 -- (-2176.222) (-2179.292) [-2179.992] (-2183.841) * (-2183.445) [-2183.012] (-2174.196) (-2177.377) -- 0:00:57
      17500 -- (-2173.140) [-2177.156] (-2177.365) (-2182.103) * (-2183.755) [-2187.770] (-2172.297) (-2185.464) -- 0:00:56
      18000 -- (-2172.782) [-2179.783] (-2180.014) (-2179.856) * (-2182.296) [-2179.459] (-2173.178) (-2185.473) -- 0:00:54
      18500 -- (-2171.612) (-2182.795) (-2176.788) [-2186.415] * (-2183.234) [-2180.200] (-2173.785) (-2182.700) -- 0:01:46
      19000 -- (-2172.818) (-2182.211) [-2177.626] (-2181.208) * (-2185.609) (-2179.739) [-2172.891] (-2184.913) -- 0:01:43
      19500 -- (-2172.517) (-2181.418) (-2180.932) [-2180.538] * (-2178.008) (-2188.072) [-2172.410] (-2182.889) -- 0:01:40
      20000 -- [-2172.462] (-2183.210) (-2178.011) (-2184.469) * (-2184.274) (-2178.817) [-2173.438] (-2180.741) -- 0:01:38

      Average standard deviation of split frequencies: 0.053670

      20500 -- (-2172.493) (-2182.907) (-2183.245) [-2189.462] * (-2182.579) (-2179.626) (-2172.953) [-2175.814] -- 0:01:35
      21000 -- [-2172.792] (-2184.120) (-2187.631) (-2178.751) * [-2177.948] (-2186.570) (-2172.357) (-2180.309) -- 0:01:33
      21500 -- (-2173.220) (-2184.984) [-2179.853] (-2191.333) * (-2184.539) [-2178.477] (-2173.362) (-2184.542) -- 0:01:31
      22000 -- [-2172.134] (-2180.835) (-2182.320) (-2183.235) * (-2183.718) (-2180.247) [-2175.031] (-2183.817) -- 0:01:28
      22500 -- (-2173.429) (-2187.363) [-2179.325] (-2183.941) * (-2183.093) (-2182.364) (-2175.834) [-2180.421] -- 0:01:26
      23000 -- (-2172.809) [-2186.168] (-2182.763) (-2183.282) * (-2176.885) (-2185.316) [-2174.041] (-2185.864) -- 0:01:24
      23500 -- (-2172.053) [-2182.591] (-2184.364) (-2180.944) * (-2179.926) (-2180.121) [-2173.417] (-2187.241) -- 0:01:23
      24000 -- (-2172.139) (-2186.944) [-2184.299] (-2183.034) * (-2180.519) (-2178.495) (-2172.639) [-2179.727] -- 0:01:21
      24500 -- (-2171.841) (-2181.233) [-2180.291] (-2180.020) * [-2182.818] (-2180.121) (-2175.554) (-2181.725) -- 0:01:19
      25000 -- (-2171.449) [-2176.192] (-2183.101) (-2179.349) * [-2175.513] (-2181.492) (-2174.811) (-2176.728) -- 0:01:18

      Average standard deviation of split frequencies: 0.048875

      25500 -- (-2171.497) (-2180.154) (-2191.909) [-2181.215] * [-2177.219] (-2186.300) (-2172.168) (-2185.228) -- 0:01:16
      26000 -- (-2171.564) [-2185.087] (-2182.015) (-2189.034) * (-2180.745) (-2182.972) (-2174.672) [-2180.815] -- 0:01:14
      26500 -- (-2171.465) [-2182.670] (-2181.165) (-2187.189) * (-2177.280) (-2184.269) (-2174.859) [-2177.753] -- 0:01:13
      27000 -- (-2171.302) (-2182.489) [-2185.035] (-2186.548) * [-2178.200] (-2182.523) (-2176.164) (-2179.160) -- 0:01:12
      27500 -- (-2171.388) (-2182.818) (-2181.011) [-2183.734] * (-2181.561) (-2191.447) [-2172.495] (-2179.956) -- 0:01:10
      28000 -- (-2172.662) (-2180.577) (-2192.683) [-2181.030] * (-2186.345) (-2185.693) (-2171.975) [-2180.746] -- 0:01:09
      28500 -- (-2172.382) (-2181.023) (-2183.626) [-2177.673] * (-2183.227) (-2181.075) (-2171.767) [-2181.338] -- 0:01:08
      29000 -- (-2173.497) (-2178.774) [-2176.310] (-2187.187) * [-2177.249] (-2178.572) (-2174.574) (-2177.040) -- 0:01:06
      29500 -- (-2172.552) [-2181.612] (-2183.666) (-2181.383) * (-2180.966) (-2177.596) (-2174.014) [-2176.399] -- 0:01:05
      30000 -- [-2171.988] (-2186.998) (-2186.560) (-2185.849) * [-2176.949] (-2184.296) (-2171.795) (-2178.681) -- 0:01:04

      Average standard deviation of split frequencies: 0.048911

      30500 -- [-2172.759] (-2182.061) (-2180.362) (-2192.536) * (-2186.712) (-2179.952) [-2173.221] (-2180.351) -- 0:01:03
      31000 -- (-2171.784) [-2184.253] (-2180.974) (-2180.527) * [-2177.037] (-2182.772) (-2174.924) (-2185.604) -- 0:01:02
      31500 -- [-2170.856] (-2188.483) (-2186.992) (-2178.055) * (-2177.655) [-2183.124] (-2176.444) (-2175.216) -- 0:01:01
      32000 -- [-2170.790] (-2184.637) (-2187.176) (-2177.006) * [-2180.885] (-2183.850) (-2173.225) (-2182.547) -- 0:01:00
      32500 -- (-2170.949) (-2179.844) [-2177.528] (-2182.631) * (-2185.029) (-2182.426) (-2171.723) [-2178.983] -- 0:00:59
      33000 -- (-2172.116) (-2182.789) [-2186.673] (-2184.825) * (-2185.529) [-2178.109] (-2174.778) (-2183.291) -- 0:01:27
      33500 -- [-2174.173] (-2182.455) (-2181.927) (-2180.499) * (-2182.086) [-2177.869] (-2171.726) (-2179.614) -- 0:01:26
      34000 -- (-2175.035) [-2182.202] (-2178.817) (-2186.104) * (-2181.987) [-2174.376] (-2170.999) (-2181.456) -- 0:01:25
      34500 -- (-2171.414) (-2182.779) [-2180.359] (-2187.416) * (-2185.952) (-2187.318) [-2170.800] (-2179.370) -- 0:01:23
      35000 -- (-2175.246) (-2185.848) (-2175.508) [-2178.671] * [-2177.971] (-2175.432) (-2170.946) (-2188.429) -- 0:01:22

      Average standard deviation of split frequencies: 0.046766

      35500 -- (-2174.738) (-2180.304) [-2183.137] (-2185.059) * [-2180.363] (-2181.721) (-2172.183) (-2187.058) -- 0:01:21
      36000 -- (-2171.654) [-2187.706] (-2189.576) (-2186.934) * (-2183.296) (-2180.950) (-2171.444) [-2177.837] -- 0:01:20
      36500 -- (-2171.716) (-2177.714) [-2178.038] (-2179.125) * (-2180.654) [-2183.500] (-2171.550) (-2175.782) -- 0:01:19
      37000 -- (-2172.461) [-2186.042] (-2179.614) (-2181.966) * (-2192.637) [-2185.878] (-2171.882) (-2180.458) -- 0:01:18
      37500 -- [-2172.073] (-2183.332) (-2182.341) (-2176.652) * (-2189.572) (-2187.353) (-2174.046) [-2180.643] -- 0:01:17
      38000 -- [-2172.057] (-2180.435) (-2183.037) (-2176.243) * (-2178.629) [-2180.503] (-2173.609) (-2184.351) -- 0:01:15
      38500 -- (-2172.494) (-2180.850) [-2181.711] (-2182.307) * [-2178.355] (-2184.398) (-2172.209) (-2177.666) -- 0:01:14
      39000 -- (-2173.698) (-2183.553) (-2183.569) [-2180.010] * (-2190.234) (-2188.947) [-2173.009] (-2180.864) -- 0:01:13
      39500 -- (-2172.743) (-2177.091) (-2182.513) [-2177.337] * (-2181.114) (-2183.958) [-2173.430] (-2184.430) -- 0:01:12
      40000 -- (-2173.675) (-2181.442) [-2182.246] (-2178.916) * (-2172.686) [-2177.426] (-2173.601) (-2181.584) -- 0:01:12

      Average standard deviation of split frequencies: 0.048024

      40500 -- (-2177.028) (-2175.756) (-2181.403) [-2179.060] * (-2171.725) (-2179.303) (-2172.811) [-2177.601] -- 0:01:11
      41000 -- (-2175.255) (-2187.110) (-2184.188) [-2184.195] * (-2171.472) [-2188.027] (-2173.596) (-2181.299) -- 0:01:10
      41500 -- (-2176.670) (-2182.067) [-2186.955] (-2180.791) * (-2173.093) [-2179.575] (-2173.615) (-2184.438) -- 0:01:09
      42000 -- [-2172.028] (-2176.107) (-2201.603) (-2185.870) * (-2178.883) (-2182.863) [-2173.615] (-2185.557) -- 0:01:08
      42500 -- (-2170.980) (-2178.006) [-2182.985] (-2187.902) * (-2180.198) (-2182.095) (-2174.041) [-2179.670] -- 0:01:07
      43000 -- (-2171.073) (-2183.924) (-2180.151) [-2179.840] * (-2176.009) (-2184.112) [-2172.979] (-2180.121) -- 0:01:06
      43500 -- (-2172.489) [-2178.796] (-2190.461) (-2185.766) * (-2172.437) (-2174.787) (-2172.437) [-2181.654] -- 0:01:05
      44000 -- [-2170.604] (-2180.282) (-2184.894) (-2181.403) * (-2175.842) (-2173.572) (-2172.166) [-2182.689] -- 0:01:05
      44500 -- (-2170.608) (-2180.379) (-2180.467) [-2178.865] * (-2176.318) [-2173.430] (-2172.934) (-2183.286) -- 0:01:04
      45000 -- [-2173.827] (-2183.140) (-2185.832) (-2180.420) * (-2172.025) (-2173.917) (-2175.068) [-2182.921] -- 0:01:03

      Average standard deviation of split frequencies: 0.036334

      45500 -- (-2172.572) (-2183.740) [-2185.143] (-2179.074) * (-2174.152) (-2172.944) [-2171.883] (-2194.505) -- 0:01:02
      46000 -- (-2170.739) [-2180.334] (-2183.467) (-2182.037) * (-2174.856) (-2175.396) [-2172.947] (-2195.699) -- 0:01:02
      46500 -- (-2171.411) (-2187.019) (-2188.510) [-2181.560] * [-2173.973] (-2176.543) (-2171.752) (-2183.469) -- 0:01:22
      47000 -- [-2172.035] (-2181.458) (-2186.601) (-2182.004) * (-2174.294) (-2175.501) [-2171.383] (-2178.880) -- 0:01:21
      47500 -- (-2170.938) [-2178.684] (-2185.713) (-2182.660) * (-2173.386) [-2173.202] (-2171.206) (-2176.091) -- 0:01:20
      48000 -- (-2170.786) (-2191.040) [-2174.927] (-2188.929) * (-2175.208) [-2172.765] (-2170.957) (-2175.891) -- 0:01:19
      48500 -- (-2170.898) (-2181.217) [-2174.926] (-2183.367) * (-2173.865) (-2172.758) [-2171.347] (-2175.628) -- 0:01:18
      49000 -- [-2171.525] (-2181.541) (-2175.772) (-2179.354) * (-2170.697) [-2174.718] (-2171.050) (-2177.147) -- 0:01:17
      49500 -- (-2171.525) (-2186.475) (-2174.445) [-2177.123] * (-2175.386) [-2172.379] (-2171.714) (-2175.167) -- 0:01:16
      50000 -- (-2172.707) [-2177.165] (-2172.934) (-2183.007) * (-2173.781) (-2173.548) (-2171.902) [-2174.555] -- 0:01:16

      Average standard deviation of split frequencies: 0.029241

      50500 -- (-2176.592) (-2181.492) (-2173.882) [-2182.453] * (-2173.086) (-2173.111) (-2172.409) [-2176.501] -- 0:01:15
      51000 -- (-2176.592) [-2189.119] (-2173.681) (-2179.286) * [-2172.075] (-2172.476) (-2173.148) (-2176.472) -- 0:01:14
      51500 -- [-2173.096] (-2177.673) (-2172.451) (-2184.909) * [-2172.198] (-2173.972) (-2172.212) (-2176.880) -- 0:01:13
      52000 -- (-2175.250) (-2180.542) (-2172.665) [-2179.556] * [-2172.795] (-2172.859) (-2171.857) (-2173.080) -- 0:01:12
      52500 -- [-2173.665] (-2179.592) (-2172.076) (-2198.907) * (-2173.455) [-2172.387] (-2171.859) (-2171.576) -- 0:01:12
      53000 -- (-2174.576) (-2187.184) (-2172.668) [-2179.511] * (-2177.669) [-2173.759] (-2175.169) (-2172.286) -- 0:01:11
      53500 -- (-2172.985) (-2184.699) [-2172.655] (-2185.031) * (-2173.748) [-2174.014] (-2176.196) (-2174.178) -- 0:01:10
      54000 -- (-2172.229) (-2180.703) (-2173.530) [-2179.276] * (-2173.927) (-2173.886) [-2176.239] (-2173.025) -- 0:01:10
      54500 -- (-2174.227) (-2179.423) [-2173.089] (-2185.712) * (-2173.627) (-2172.469) (-2176.494) [-2173.419] -- 0:01:09
      55000 -- (-2172.422) [-2182.391] (-2173.875) (-2180.227) * (-2177.936) [-2171.760] (-2174.489) (-2174.228) -- 0:01:08

      Average standard deviation of split frequencies: 0.028621

      55500 -- (-2171.817) (-2175.194) (-2174.859) [-2182.177] * (-2172.182) [-2173.764] (-2176.349) (-2173.447) -- 0:01:08
      56000 -- (-2170.920) (-2180.728) [-2176.387] (-2178.399) * (-2177.374) [-2171.158] (-2176.400) (-2171.875) -- 0:01:07
      56500 -- (-2171.404) (-2182.567) [-2174.026] (-2182.929) * (-2173.359) (-2171.158) (-2173.677) [-2172.082] -- 0:01:06
      57000 -- (-2171.949) (-2181.811) (-2175.807) [-2180.991] * [-2171.173] (-2173.631) (-2173.876) (-2173.906) -- 0:01:06
      57500 -- (-2173.089) (-2175.931) [-2176.602] (-2187.995) * (-2172.706) (-2173.709) (-2172.287) [-2172.735] -- 0:01:05
      58000 -- [-2175.351] (-2177.919) (-2176.276) (-2182.710) * (-2174.910) (-2172.957) (-2172.023) [-2172.979] -- 0:01:04
      58500 -- [-2176.853] (-2177.540) (-2175.273) (-2182.768) * (-2173.217) (-2172.371) [-2172.395] (-2172.211) -- 0:01:04
      59000 -- (-2173.971) (-2183.316) (-2174.659) [-2182.121] * (-2172.352) (-2172.227) [-2173.192] (-2173.486) -- 0:01:03
      59500 -- (-2171.309) [-2178.453] (-2173.510) (-2183.127) * (-2173.004) [-2172.285] (-2172.223) (-2173.559) -- 0:01:03
      60000 -- (-2172.912) [-2185.648] (-2175.161) (-2181.203) * (-2172.645) (-2174.038) (-2172.087) [-2172.220] -- 0:01:02

      Average standard deviation of split frequencies: 0.025765

      60500 -- (-2173.592) (-2184.513) (-2174.722) [-2179.136] * (-2171.869) (-2175.634) (-2171.447) [-2172.094] -- 0:01:02
      61000 -- [-2172.195] (-2185.318) (-2173.913) (-2184.328) * [-2171.489] (-2171.456) (-2174.396) (-2171.848) -- 0:01:16
      61500 -- (-2171.596) (-2182.944) (-2174.113) [-2182.754] * [-2171.452] (-2171.804) (-2171.753) (-2171.477) -- 0:01:16
      62000 -- (-2172.782) (-2180.039) [-2176.157] (-2179.386) * (-2177.597) [-2172.602] (-2172.545) (-2171.403) -- 0:01:15
      62500 -- (-2171.046) (-2179.708) (-2172.045) [-2181.268] * (-2172.000) [-2172.017] (-2172.509) (-2173.242) -- 0:01:15
      63000 -- (-2171.433) (-2173.240) (-2172.081) [-2181.240] * [-2172.908] (-2172.133) (-2171.412) (-2174.670) -- 0:01:14
      63500 -- (-2171.434) (-2172.856) [-2175.966] (-2179.007) * [-2171.643] (-2172.645) (-2173.996) (-2173.160) -- 0:01:13
      64000 -- (-2171.417) [-2173.169] (-2173.302) (-2182.553) * (-2176.289) (-2172.492) (-2172.451) [-2171.456] -- 0:01:13
      64500 -- [-2171.366] (-2173.656) (-2173.296) (-2178.300) * (-2173.810) [-2172.271] (-2172.028) (-2171.319) -- 0:01:12
      65000 -- (-2171.548) [-2174.302] (-2172.891) (-2181.948) * [-2173.661] (-2173.551) (-2171.588) (-2170.990) -- 0:01:11

      Average standard deviation of split frequencies: 0.030951

      65500 -- (-2174.223) [-2172.756] (-2171.584) (-2187.195) * (-2174.928) (-2173.184) [-2176.674] (-2174.009) -- 0:01:11
      66000 -- (-2174.656) (-2175.020) [-2171.050] (-2181.457) * [-2175.608] (-2172.289) (-2171.315) (-2173.329) -- 0:01:10
      66500 -- (-2174.726) [-2174.277] (-2172.403) (-2180.878) * (-2175.287) (-2175.307) [-2171.295] (-2172.119) -- 0:01:10
      67000 -- (-2176.080) (-2174.257) (-2172.638) [-2184.621] * (-2175.997) (-2176.679) [-2175.339] (-2172.737) -- 0:01:09
      67500 -- [-2176.082] (-2176.956) (-2171.948) (-2187.226) * (-2173.231) (-2174.332) (-2176.083) [-2173.880] -- 0:01:09
      68000 -- (-2174.559) (-2174.523) [-2171.599] (-2178.177) * (-2173.765) (-2176.339) [-2171.089] (-2175.371) -- 0:01:08
      68500 -- [-2174.105] (-2173.543) (-2174.338) (-2179.921) * (-2174.266) (-2172.943) (-2170.988) [-2181.730] -- 0:01:07
      69000 -- (-2178.376) (-2171.502) [-2175.924] (-2185.794) * (-2173.828) (-2172.574) [-2173.738] (-2174.904) -- 0:01:07
      69500 -- [-2174.712] (-2171.373) (-2175.821) (-2184.653) * (-2175.614) (-2172.967) (-2173.268) [-2173.529] -- 0:01:06
      70000 -- (-2174.732) (-2173.064) (-2175.788) [-2180.587] * [-2173.163] (-2178.052) (-2172.656) (-2174.524) -- 0:01:06

      Average standard deviation of split frequencies: 0.032613

      70500 -- [-2174.023] (-2171.926) (-2174.116) (-2182.410) * (-2174.952) (-2173.637) [-2172.196] (-2171.988) -- 0:01:05
      71000 -- [-2174.246] (-2172.901) (-2174.147) (-2182.076) * [-2174.847] (-2173.637) (-2173.000) (-2173.029) -- 0:01:05
      71500 -- [-2172.461] (-2172.593) (-2176.356) (-2177.783) * (-2173.869) (-2172.960) (-2173.340) [-2172.510] -- 0:01:04
      72000 -- (-2171.460) (-2172.921) (-2177.134) [-2183.580] * (-2171.109) (-2173.687) (-2176.704) [-2172.498] -- 0:01:04
      72500 -- (-2171.921) (-2171.634) (-2178.232) [-2177.618] * [-2172.652] (-2176.492) (-2176.914) (-2176.806) -- 0:01:03
      73000 -- (-2171.388) (-2172.782) (-2177.688) [-2178.332] * (-2172.463) [-2174.505] (-2173.941) (-2179.140) -- 0:01:03
      73500 -- (-2174.803) [-2172.519] (-2172.141) (-2184.039) * (-2174.166) (-2175.266) [-2172.221] (-2178.140) -- 0:01:03
      74000 -- [-2174.450] (-2172.332) (-2174.865) (-2178.417) * (-2171.431) (-2172.651) [-2172.099] (-2176.598) -- 0:01:02
      74500 -- (-2175.463) (-2172.424) (-2175.404) [-2180.437] * (-2177.679) [-2174.485] (-2171.563) (-2173.837) -- 0:01:02
      75000 -- (-2174.340) (-2174.359) (-2175.404) [-2178.538] * (-2173.196) (-2175.633) [-2171.535] (-2172.978) -- 0:01:01

      Average standard deviation of split frequencies: 0.031340

      75500 -- [-2173.055] (-2176.836) (-2176.297) (-2187.534) * [-2173.946] (-2175.782) (-2171.868) (-2175.631) -- 0:01:01
      76000 -- [-2174.206] (-2179.202) (-2172.791) (-2179.336) * (-2174.172) (-2175.506) [-2173.613] (-2179.384) -- 0:01:12
      76500 -- (-2174.863) [-2175.075] (-2174.542) (-2180.206) * (-2174.577) (-2173.591) (-2172.975) [-2178.451] -- 0:01:12
      77000 -- [-2172.481] (-2174.358) (-2176.793) (-2183.134) * (-2174.410) (-2172.043) [-2173.309] (-2171.667) -- 0:01:11
      77500 -- (-2173.652) [-2172.847] (-2175.862) (-2183.711) * (-2176.969) (-2172.557) (-2172.505) [-2171.728] -- 0:01:11
      78000 -- (-2173.633) (-2173.530) [-2171.574] (-2185.383) * (-2176.612) (-2174.869) [-2174.467] (-2173.447) -- 0:01:10
      78500 -- (-2175.265) (-2174.406) [-2172.068] (-2188.942) * (-2178.579) (-2176.548) [-2178.185] (-2172.097) -- 0:01:10
      79000 -- (-2174.288) [-2173.194] (-2172.531) (-2177.254) * (-2189.113) (-2175.378) (-2173.238) [-2172.628] -- 0:01:09
      79500 -- (-2172.941) [-2172.805] (-2174.311) (-2176.428) * (-2176.307) (-2172.523) (-2174.261) [-2171.716] -- 0:01:09
      80000 -- [-2173.610] (-2175.825) (-2175.830) (-2176.500) * [-2175.670] (-2172.105) (-2173.399) (-2172.126) -- 0:01:09

      Average standard deviation of split frequencies: 0.026297

      80500 -- (-2171.718) (-2180.365) (-2172.213) [-2172.868] * (-2176.078) (-2172.255) [-2174.638] (-2172.699) -- 0:01:08
      81000 -- (-2171.986) [-2173.367] (-2171.655) (-2173.413) * (-2170.885) (-2173.963) [-2174.387] (-2172.839) -- 0:01:08
      81500 -- (-2172.669) (-2176.236) [-2174.175] (-2173.947) * (-2172.878) [-2177.304] (-2173.606) (-2173.274) -- 0:01:07
      82000 -- (-2176.598) (-2173.833) (-2172.885) [-2173.710] * [-2171.032] (-2173.212) (-2172.509) (-2174.225) -- 0:01:07
      82500 -- (-2172.837) [-2171.930] (-2173.889) (-2173.880) * (-2174.217) (-2173.148) [-2175.669] (-2173.811) -- 0:01:06
      83000 -- (-2173.073) (-2172.420) (-2171.873) [-2173.459] * (-2173.399) [-2175.475] (-2174.152) (-2171.551) -- 0:01:06
      83500 -- (-2171.967) [-2172.426] (-2172.580) (-2175.125) * (-2175.396) (-2176.577) [-2172.576] (-2171.158) -- 0:01:05
      84000 -- (-2174.160) [-2172.538] (-2172.732) (-2177.227) * (-2173.133) (-2173.051) (-2172.883) [-2172.238] -- 0:01:05
      84500 -- (-2173.728) [-2172.737] (-2173.362) (-2175.474) * (-2174.458) [-2173.796] (-2176.471) (-2171.707) -- 0:01:05
      85000 -- (-2170.917) (-2173.500) (-2173.028) [-2173.378] * (-2176.792) (-2173.826) [-2173.949] (-2173.159) -- 0:01:04

      Average standard deviation of split frequencies: 0.023844

      85500 -- (-2172.385) (-2176.177) (-2173.010) [-2172.859] * (-2171.749) (-2174.151) (-2178.873) [-2174.109] -- 0:01:04
      86000 -- (-2171.454) [-2172.523] (-2173.514) (-2172.469) * (-2174.983) [-2174.102] (-2177.851) (-2176.462) -- 0:01:03
      86500 -- (-2171.321) [-2173.306] (-2178.906) (-2172.242) * (-2173.243) [-2173.968] (-2175.330) (-2172.520) -- 0:01:03
      87000 -- (-2171.821) (-2175.381) [-2175.371] (-2173.277) * [-2171.332] (-2172.970) (-2177.678) (-2172.054) -- 0:01:02
      87500 -- (-2174.808) [-2182.180] (-2172.467) (-2173.194) * (-2174.017) (-2173.079) (-2175.963) [-2173.307] -- 0:01:02
      88000 -- (-2173.785) (-2176.415) (-2172.254) [-2172.410] * [-2174.798] (-2172.456) (-2173.772) (-2173.849) -- 0:01:02
      88500 -- (-2173.020) [-2173.990] (-2172.340) (-2171.723) * [-2173.516] (-2171.375) (-2172.132) (-2175.957) -- 0:01:01
      89000 -- [-2173.122] (-2174.512) (-2172.928) (-2172.055) * (-2172.120) (-2171.746) (-2171.862) [-2176.964] -- 0:01:01
      89500 -- (-2171.369) [-2175.579] (-2173.648) (-2173.476) * (-2171.464) [-2171.746] (-2172.054) (-2172.320) -- 0:01:01
      90000 -- (-2174.928) (-2176.756) (-2174.297) [-2173.650] * [-2171.922] (-2173.237) (-2172.416) (-2175.536) -- 0:01:00

      Average standard deviation of split frequencies: 0.023657

      90500 -- (-2171.553) [-2175.910] (-2177.258) (-2175.437) * [-2172.022] (-2172.853) (-2172.640) (-2175.560) -- 0:01:10
      91000 -- (-2171.255) (-2174.170) [-2172.021] (-2173.270) * (-2172.351) (-2172.730) (-2172.280) [-2172.908] -- 0:01:09
      91500 -- [-2171.473] (-2176.004) (-2172.019) (-2176.054) * (-2172.418) (-2174.028) [-2171.546] (-2172.686) -- 0:01:09
      92000 -- (-2170.599) (-2175.470) (-2175.871) [-2173.967] * (-2174.849) [-2172.639] (-2171.778) (-2172.118) -- 0:01:09
      92500 -- (-2170.864) [-2175.197] (-2172.553) (-2174.854) * [-2174.619] (-2172.277) (-2171.410) (-2172.783) -- 0:01:08
      93000 -- [-2172.060] (-2177.557) (-2171.486) (-2175.026) * (-2172.566) (-2174.300) [-2171.673] (-2171.528) -- 0:01:08
      93500 -- (-2171.151) [-2173.958] (-2171.243) (-2175.285) * (-2172.361) [-2171.705] (-2172.683) (-2171.421) -- 0:01:07
      94000 -- (-2171.864) [-2173.418] (-2172.072) (-2175.361) * [-2171.150] (-2171.340) (-2172.758) (-2172.959) -- 0:01:07
      94500 -- (-2176.915) (-2174.754) [-2174.588] (-2174.786) * (-2171.915) (-2172.727) (-2173.324) [-2172.172] -- 0:01:07
      95000 -- [-2175.922] (-2174.426) (-2171.668) (-2174.870) * [-2170.758] (-2174.543) (-2172.697) (-2174.528) -- 0:01:06

      Average standard deviation of split frequencies: 0.025586

      95500 -- (-2171.940) (-2173.241) (-2174.785) [-2172.276] * (-2172.594) (-2172.048) [-2173.075] (-2174.833) -- 0:01:06
      96000 -- [-2172.361] (-2173.337) (-2174.062) (-2170.790) * (-2172.953) (-2173.732) (-2174.766) [-2173.049] -- 0:01:05
      96500 -- (-2174.338) [-2172.826] (-2172.207) (-2172.026) * [-2172.389] (-2173.191) (-2174.979) (-2172.972) -- 0:01:05
      97000 -- [-2171.220] (-2174.106) (-2173.195) (-2172.354) * [-2173.462] (-2172.362) (-2171.518) (-2174.764) -- 0:01:05
      97500 -- [-2171.699] (-2171.526) (-2172.808) (-2174.009) * (-2173.553) (-2172.851) [-2171.518] (-2175.934) -- 0:01:04
      98000 -- (-2173.401) (-2172.771) (-2171.847) [-2171.129] * [-2173.527] (-2174.207) (-2172.778) (-2172.375) -- 0:01:04
      98500 -- (-2171.823) (-2172.186) [-2172.497] (-2171.125) * (-2172.775) (-2171.209) [-2172.679] (-2172.246) -- 0:01:04
      99000 -- (-2171.408) (-2172.788) (-2174.685) [-2171.620] * (-2172.169) (-2172.436) [-2173.503] (-2175.729) -- 0:01:03
      99500 -- (-2172.118) [-2171.495] (-2173.537) (-2171.330) * (-2173.540) (-2171.920) (-2173.030) [-2175.759] -- 0:01:03
      100000 -- (-2172.116) [-2171.359] (-2173.081) (-2172.229) * (-2172.645) (-2173.676) [-2171.053] (-2175.849) -- 0:01:02

      Average standard deviation of split frequencies: 0.022894

      100500 -- (-2171.492) [-2171.282] (-2172.806) (-2172.880) * (-2178.818) [-2171.566] (-2171.032) (-2174.931) -- 0:01:02
      101000 -- (-2171.492) [-2171.122] (-2173.620) (-2175.021) * (-2173.839) (-2175.557) [-2171.995] (-2176.690) -- 0:01:02
      101500 -- (-2173.474) [-2171.867] (-2174.128) (-2173.197) * (-2173.086) (-2176.421) [-2173.406] (-2175.914) -- 0:01:01
      102000 -- [-2171.577] (-2178.394) (-2172.995) (-2173.387) * (-2171.579) [-2171.568] (-2173.950) (-2175.195) -- 0:01:01
      102500 -- (-2171.837) (-2175.395) (-2172.289) [-2174.540] * (-2174.954) [-2171.528] (-2180.631) (-2171.205) -- 0:01:01
      103000 -- (-2170.935) (-2173.974) (-2174.045) [-2172.738] * (-2172.423) [-2170.988] (-2171.988) (-2171.842) -- 0:01:00
      103500 -- (-2171.508) (-2176.353) [-2174.702] (-2176.107) * (-2172.685) (-2170.778) (-2172.026) [-2173.348] -- 0:01:00
      104000 -- [-2172.319] (-2175.055) (-2174.374) (-2174.446) * (-2174.284) [-2171.247] (-2174.092) (-2174.697) -- 0:01:00
      104500 -- [-2171.598] (-2172.716) (-2172.046) (-2171.283) * [-2172.578] (-2172.112) (-2170.979) (-2176.897) -- 0:00:59
      105000 -- (-2171.406) [-2176.014] (-2175.805) (-2171.549) * (-2173.536) (-2172.040) [-2171.120] (-2173.877) -- 0:00:59

      Average standard deviation of split frequencies: 0.023471

      105500 -- [-2171.775] (-2178.622) (-2172.956) (-2171.519) * (-2172.901) (-2174.668) [-2171.975] (-2172.648) -- 0:01:07
      106000 -- [-2174.700] (-2183.275) (-2172.036) (-2173.824) * (-2179.367) [-2172.387] (-2173.670) (-2173.572) -- 0:01:07
      106500 -- (-2173.343) (-2175.110) (-2172.035) [-2172.751] * (-2175.545) (-2171.736) [-2171.899] (-2172.677) -- 0:01:07
      107000 -- (-2172.068) [-2172.743] (-2172.774) (-2173.038) * (-2176.715) [-2175.075] (-2175.501) (-2174.199) -- 0:01:06
      107500 -- [-2172.244] (-2174.438) (-2173.837) (-2171.251) * (-2174.787) [-2172.602] (-2172.083) (-2172.293) -- 0:01:06
      108000 -- [-2172.929] (-2171.823) (-2175.674) (-2172.094) * (-2174.023) [-2172.219] (-2172.930) (-2172.541) -- 0:01:06
      108500 -- (-2172.400) (-2171.319) (-2172.057) [-2173.503] * (-2175.653) [-2174.825] (-2171.830) (-2171.429) -- 0:01:05
      109000 -- (-2171.805) (-2173.080) [-2175.237] (-2172.067) * (-2172.617) (-2173.936) [-2172.538] (-2171.429) -- 0:01:05
      109500 -- (-2172.971) (-2171.317) (-2172.030) [-2173.322] * (-2172.808) [-2173.364] (-2175.053) (-2171.064) -- 0:01:05
      110000 -- (-2177.370) (-2171.399) [-2173.052] (-2173.946) * (-2173.726) (-2171.509) (-2171.603) [-2170.860] -- 0:01:04

      Average standard deviation of split frequencies: 0.021085

      110500 -- (-2175.889) (-2171.477) [-2171.867] (-2173.473) * (-2174.451) (-2174.034) (-2171.616) [-2170.863] -- 0:01:04
      111000 -- (-2173.751) (-2174.451) [-2172.402] (-2173.473) * (-2170.991) (-2171.865) [-2171.371] (-2172.395) -- 0:01:04
      111500 -- (-2171.766) [-2177.154] (-2174.954) (-2171.814) * (-2172.396) [-2172.693] (-2173.563) (-2171.273) -- 0:01:03
      112000 -- (-2172.047) (-2173.723) [-2171.217] (-2171.081) * (-2172.179) (-2171.855) (-2172.591) [-2171.259] -- 0:01:03
      112500 -- (-2171.410) (-2174.032) [-2173.536] (-2174.900) * (-2172.425) [-2171.266] (-2172.252) (-2175.049) -- 0:01:03
      113000 -- (-2173.010) [-2173.678] (-2173.324) (-2170.681) * [-2171.560] (-2171.218) (-2171.973) (-2173.749) -- 0:01:02
      113500 -- (-2173.010) [-2173.789] (-2174.156) (-2174.115) * (-2171.966) (-2172.206) (-2180.669) [-2172.840] -- 0:01:02
      114000 -- (-2175.059) (-2178.960) [-2172.585] (-2178.477) * (-2172.361) [-2171.583] (-2175.181) (-2174.409) -- 0:01:02
      114500 -- (-2175.843) [-2173.340] (-2175.402) (-2172.823) * [-2170.894] (-2176.106) (-2173.110) (-2172.205) -- 0:01:01
      115000 -- (-2171.165) [-2173.348] (-2175.412) (-2174.846) * (-2171.465) (-2174.536) (-2173.178) [-2170.572] -- 0:01:01

      Average standard deviation of split frequencies: 0.020105

      115500 -- [-2172.181] (-2175.616) (-2171.782) (-2173.734) * [-2171.376] (-2172.420) (-2173.231) (-2171.523) -- 0:01:01
      116000 -- (-2171.903) (-2173.554) [-2170.807] (-2172.345) * (-2172.316) (-2172.034) (-2175.446) [-2172.440] -- 0:01:00
      116500 -- (-2172.117) (-2175.382) [-2175.330] (-2171.293) * [-2172.456] (-2172.012) (-2177.339) (-2172.514) -- 0:01:00
      117000 -- (-2172.726) [-2174.977] (-2176.618) (-2172.835) * (-2176.745) (-2172.019) (-2175.065) [-2172.742] -- 0:01:00
      117500 -- [-2172.137] (-2171.800) (-2172.955) (-2172.798) * (-2178.294) (-2172.216) [-2174.093] (-2172.068) -- 0:01:00
      118000 -- (-2171.965) (-2173.631) [-2173.596] (-2173.178) * (-2172.458) (-2171.985) [-2173.148] (-2172.224) -- 0:00:59
      118500 -- (-2171.710) (-2171.252) [-2173.320] (-2172.977) * (-2174.246) (-2170.644) [-2174.061] (-2172.433) -- 0:00:59
      119000 -- (-2171.596) (-2173.095) (-2171.177) [-2171.928] * (-2173.146) (-2170.641) [-2173.935] (-2176.099) -- 0:00:59
      119500 -- [-2171.595] (-2174.382) (-2172.674) (-2173.504) * (-2172.145) [-2172.988] (-2173.168) (-2175.280) -- 0:00:58
      120000 -- (-2172.671) (-2173.884) [-2172.730] (-2173.771) * (-2173.246) (-2175.036) [-2173.154] (-2173.419) -- 0:00:58

      Average standard deviation of split frequencies: 0.019967

      120500 -- [-2172.259] (-2172.882) (-2170.742) (-2174.417) * (-2173.654) (-2170.803) [-2171.120] (-2175.460) -- 0:01:05
      121000 -- [-2172.314] (-2177.520) (-2170.707) (-2172.485) * (-2171.712) (-2170.767) [-2173.343] (-2177.667) -- 0:01:05
      121500 -- (-2172.058) [-2176.585] (-2173.307) (-2171.369) * (-2171.922) (-2171.397) (-2176.449) [-2175.232] -- 0:01:05
      122000 -- [-2172.807] (-2175.605) (-2171.099) (-2170.909) * (-2172.546) [-2171.568] (-2172.975) (-2175.386) -- 0:01:04
      122500 -- (-2173.861) (-2174.472) (-2171.071) [-2170.998] * (-2172.466) [-2171.568] (-2173.176) (-2175.373) -- 0:01:04
      123000 -- (-2174.056) (-2174.153) [-2172.260] (-2171.079) * (-2173.194) (-2172.401) [-2172.570] (-2172.039) -- 0:01:04
      123500 -- (-2172.661) (-2173.355) (-2174.001) [-2171.122] * (-2172.883) (-2172.658) [-2173.547] (-2171.052) -- 0:01:03
      124000 -- (-2171.787) [-2173.671] (-2173.497) (-2171.892) * (-2175.264) (-2172.279) (-2173.625) [-2173.640] -- 0:01:03
      124500 -- [-2171.931] (-2173.576) (-2175.307) (-2171.866) * (-2172.023) (-2174.297) (-2173.954) [-2174.034] -- 0:01:03
      125000 -- (-2171.643) (-2172.713) (-2173.991) [-2170.996] * [-2170.945] (-2176.536) (-2172.210) (-2176.662) -- 0:01:03

      Average standard deviation of split frequencies: 0.018266

      125500 -- (-2174.724) (-2171.048) (-2172.390) [-2171.806] * [-2171.463] (-2174.570) (-2172.665) (-2173.043) -- 0:01:02
      126000 -- (-2173.897) [-2171.049] (-2173.248) (-2173.187) * (-2172.337) [-2176.179] (-2172.435) (-2173.234) -- 0:01:02
      126500 -- (-2173.871) (-2178.331) [-2172.894] (-2178.612) * (-2172.068) [-2174.371] (-2172.357) (-2176.345) -- 0:01:02
      127000 -- (-2173.309) (-2171.376) (-2172.794) [-2171.688] * (-2172.068) (-2177.484) (-2173.643) [-2176.450] -- 0:01:01
      127500 -- (-2172.601) (-2173.288) [-2172.609] (-2173.296) * (-2171.993) [-2174.490] (-2170.987) (-2177.966) -- 0:01:01
      128000 -- (-2172.574) (-2170.761) (-2172.126) [-2173.200] * [-2173.974] (-2172.017) (-2171.858) (-2171.826) -- 0:01:01
      128500 -- (-2173.156) (-2171.634) (-2172.918) [-2175.154] * (-2173.974) [-2172.685] (-2171.695) (-2171.940) -- 0:01:01
      129000 -- (-2172.677) [-2172.698] (-2173.661) (-2171.745) * (-2171.973) (-2173.211) [-2170.960] (-2171.699) -- 0:01:00
      129500 -- (-2172.507) (-2172.613) (-2172.948) [-2172.156] * [-2171.756] (-2172.809) (-2170.944) (-2171.639) -- 0:01:00
      130000 -- (-2171.421) (-2174.779) [-2174.251] (-2172.076) * (-2170.973) [-2173.150] (-2171.602) (-2172.932) -- 0:01:00

      Average standard deviation of split frequencies: 0.017638

      130500 -- (-2172.888) (-2174.709) [-2176.618] (-2172.534) * (-2172.628) (-2173.652) (-2173.635) [-2172.896] -- 0:00:59
      131000 -- (-2173.018) [-2172.341] (-2174.653) (-2171.335) * (-2171.641) (-2172.025) (-2173.930) [-2173.430] -- 0:00:59
      131500 -- (-2172.449) (-2171.969) (-2171.727) [-2171.505] * (-2174.790) [-2172.020] (-2172.766) (-2174.133) -- 0:00:59
      132000 -- [-2173.902] (-2171.341) (-2173.634) (-2170.943) * (-2172.810) (-2171.667) (-2172.413) [-2174.517] -- 0:00:59
      132500 -- (-2172.046) (-2174.749) [-2171.555] (-2172.925) * (-2170.896) [-2172.382] (-2172.068) (-2172.801) -- 0:00:58
      133000 -- [-2172.066] (-2172.950) (-2171.266) (-2170.952) * [-2171.796] (-2172.678) (-2173.303) (-2172.293) -- 0:00:58
      133500 -- (-2174.297) (-2170.772) (-2171.540) [-2170.983] * [-2173.490] (-2172.716) (-2176.200) (-2173.880) -- 0:00:58
      134000 -- (-2174.661) (-2170.941) [-2172.008] (-2170.816) * (-2171.995) (-2172.418) (-2176.198) [-2178.323] -- 0:00:58
      134500 -- (-2172.131) (-2172.767) [-2172.143] (-2172.178) * (-2173.198) (-2172.844) [-2175.711] (-2180.170) -- 0:00:57
      135000 -- (-2173.594) (-2173.131) [-2170.701] (-2171.854) * (-2172.865) (-2172.953) [-2172.102] (-2176.396) -- 0:00:57

      Average standard deviation of split frequencies: 0.016946

      135500 -- (-2176.494) (-2176.852) [-2172.656] (-2171.602) * (-2172.738) (-2177.004) [-2172.164] (-2176.357) -- 0:00:57
      136000 -- (-2173.197) (-2171.932) [-2175.259] (-2173.774) * (-2171.253) (-2178.688) [-2173.954] (-2174.482) -- 0:01:03
      136500 -- (-2174.018) (-2172.198) [-2170.955] (-2174.034) * (-2175.384) (-2179.034) (-2173.640) [-2173.944] -- 0:01:03
      137000 -- [-2173.979] (-2171.107) (-2171.159) (-2176.066) * [-2171.343] (-2178.272) (-2176.110) (-2172.170) -- 0:01:02
      137500 -- (-2172.864) (-2170.888) [-2174.273] (-2177.032) * (-2176.512) (-2176.892) (-2175.996) [-2171.860] -- 0:01:02
      138000 -- (-2173.361) [-2173.346] (-2174.951) (-2173.245) * [-2174.869] (-2176.375) (-2172.516) (-2173.331) -- 0:01:02
      138500 -- (-2174.041) (-2170.679) [-2173.572] (-2172.112) * [-2173.554] (-2173.015) (-2176.186) (-2173.082) -- 0:01:02
      139000 -- [-2172.435] (-2171.497) (-2171.953) (-2172.406) * (-2174.198) [-2174.244] (-2172.170) (-2172.659) -- 0:01:01
      139500 -- (-2172.742) [-2172.751] (-2171.045) (-2171.504) * (-2173.773) (-2173.060) (-2177.230) [-2172.197] -- 0:01:01
      140000 -- [-2174.513] (-2171.911) (-2171.099) (-2171.771) * (-2173.448) (-2173.418) (-2173.378) [-2173.013] -- 0:01:01

      Average standard deviation of split frequencies: 0.016570

      140500 -- (-2173.067) (-2171.527) (-2171.939) [-2173.435] * (-2172.911) [-2171.920] (-2171.878) (-2178.596) -- 0:01:01
      141000 -- (-2172.090) (-2170.817) (-2171.931) [-2173.601] * (-2173.746) (-2172.024) [-2172.098] (-2177.014) -- 0:01:00
      141500 -- (-2172.014) (-2173.335) (-2171.745) [-2173.142] * (-2172.747) [-2172.554] (-2171.612) (-2173.107) -- 0:01:00
      142000 -- (-2172.534) (-2172.150) [-2174.749] (-2171.938) * (-2172.382) [-2175.239] (-2171.750) (-2172.739) -- 0:01:00
      142500 -- [-2175.627] (-2172.250) (-2173.074) (-2172.835) * (-2174.648) (-2177.110) [-2171.727] (-2172.736) -- 0:01:00
      143000 -- (-2172.724) (-2172.545) [-2170.980] (-2172.040) * (-2176.453) (-2176.634) [-2171.344] (-2172.734) -- 0:00:59
      143500 -- (-2172.425) [-2170.722] (-2172.736) (-2173.843) * (-2177.397) [-2174.840] (-2173.529) (-2176.271) -- 0:00:59
      144000 -- (-2172.746) (-2170.740) (-2174.992) [-2174.344] * [-2173.459] (-2174.124) (-2173.589) (-2176.371) -- 0:00:59
      144500 -- (-2173.227) [-2171.731] (-2176.834) (-2174.870) * (-2174.692) [-2171.460] (-2173.246) (-2171.062) -- 0:00:59
      145000 -- (-2182.798) [-2170.833] (-2175.486) (-2175.073) * (-2174.020) [-2171.645] (-2172.439) (-2171.952) -- 0:00:58

      Average standard deviation of split frequencies: 0.015464

      145500 -- (-2174.759) [-2171.364] (-2174.953) (-2173.312) * (-2176.141) [-2177.901] (-2172.104) (-2173.220) -- 0:00:58
      146000 -- (-2172.412) [-2172.642] (-2177.668) (-2175.865) * (-2170.902) (-2181.667) [-2174.312] (-2171.811) -- 0:00:58
      146500 -- [-2172.418] (-2171.934) (-2175.977) (-2176.114) * [-2170.872] (-2174.821) (-2172.309) (-2176.105) -- 0:00:58
      147000 -- (-2174.997) [-2171.951] (-2173.818) (-2171.634) * [-2171.015] (-2175.423) (-2172.793) (-2172.229) -- 0:00:58
      147500 -- [-2170.888] (-2172.551) (-2171.594) (-2171.823) * (-2173.922) [-2173.703] (-2172.882) (-2171.877) -- 0:00:57
      148000 -- [-2172.004] (-2171.521) (-2173.711) (-2174.406) * (-2172.997) (-2171.866) [-2172.320] (-2172.424) -- 0:00:57
      148500 -- (-2172.664) (-2170.901) [-2174.139] (-2175.988) * [-2171.991] (-2171.490) (-2173.571) (-2171.154) -- 0:00:57
      149000 -- (-2174.332) (-2170.901) (-2174.876) [-2171.586] * [-2172.190] (-2172.357) (-2173.053) (-2171.242) -- 0:00:57
      149500 -- (-2174.535) [-2171.936] (-2174.831) (-2173.407) * [-2171.588] (-2175.780) (-2174.424) (-2171.228) -- 0:00:56
      150000 -- (-2173.256) (-2171.936) (-2171.691) [-2172.423] * (-2172.184) [-2174.106] (-2173.721) (-2172.521) -- 0:00:56

      Average standard deviation of split frequencies: 0.016467

      150500 -- [-2175.154] (-2173.063) (-2171.690) (-2171.744) * (-2171.037) (-2172.380) (-2174.555) [-2173.534] -- 0:00:56
      151000 -- (-2177.239) [-2171.762] (-2171.925) (-2174.052) * (-2174.635) [-2172.183] (-2173.640) (-2171.900) -- 0:01:01
      151500 -- (-2179.428) (-2171.755) (-2172.285) [-2172.391] * (-2173.893) (-2176.054) (-2177.629) [-2171.817] -- 0:01:01
      152000 -- (-2173.849) (-2172.143) (-2171.428) [-2172.009] * [-2171.343] (-2175.861) (-2173.072) (-2171.467) -- 0:01:01
      152500 -- (-2174.959) (-2173.876) [-2172.210] (-2172.624) * [-2174.017] (-2174.629) (-2173.165) (-2171.622) -- 0:01:01
      153000 -- (-2173.179) (-2173.766) [-2172.164] (-2172.104) * (-2181.320) [-2173.917] (-2172.499) (-2173.836) -- 0:01:00
      153500 -- [-2173.689] (-2175.747) (-2171.904) (-2171.663) * (-2173.592) (-2173.853) [-2172.515] (-2172.052) -- 0:01:00
      154000 -- [-2172.936] (-2173.929) (-2173.844) (-2171.697) * [-2176.208] (-2171.323) (-2172.805) (-2172.044) -- 0:01:00
      154500 -- (-2173.179) (-2173.694) (-2172.845) [-2172.596] * (-2172.492) [-2172.101] (-2172.585) (-2173.644) -- 0:01:00
      155000 -- (-2172.418) (-2176.058) [-2171.413] (-2170.861) * (-2172.660) [-2171.948] (-2174.145) (-2173.381) -- 0:00:59

      Average standard deviation of split frequencies: 0.015904

      155500 -- (-2171.958) (-2181.571) (-2175.212) [-2171.245] * [-2171.239] (-2172.633) (-2174.285) (-2170.893) -- 0:00:59
      156000 -- (-2172.043) [-2174.927] (-2175.674) (-2172.086) * [-2180.258] (-2172.279) (-2173.304) (-2172.196) -- 0:00:59
      156500 -- (-2173.854) (-2173.297) (-2177.085) [-2173.585] * (-2174.201) (-2173.616) (-2174.147) [-2170.673] -- 0:00:59
      157000 -- [-2174.139] (-2173.034) (-2178.209) (-2172.272) * (-2171.402) (-2176.002) (-2173.852) [-2170.686] -- 0:00:59
      157500 -- (-2172.997) [-2173.308] (-2173.066) (-2173.046) * (-2171.640) (-2171.815) [-2171.772] (-2170.809) -- 0:00:58
      158000 -- (-2173.496) [-2172.853] (-2171.843) (-2175.060) * (-2173.227) (-2171.490) (-2173.543) [-2170.734] -- 0:00:58
      158500 -- (-2173.442) (-2172.391) (-2171.368) [-2173.945] * (-2173.424) [-2171.419] (-2173.505) (-2172.409) -- 0:00:58
      159000 -- (-2172.729) (-2173.613) (-2175.310) [-2174.648] * (-2174.211) (-2172.218) [-2172.961] (-2173.583) -- 0:00:58
      159500 -- (-2173.136) (-2172.773) [-2172.119] (-2177.002) * (-2173.242) [-2172.248] (-2171.390) (-2175.393) -- 0:00:57
      160000 -- [-2173.530] (-2172.511) (-2171.830) (-2174.151) * (-2176.464) (-2173.058) [-2171.175] (-2177.064) -- 0:00:57

      Average standard deviation of split frequencies: 0.016832

      160500 -- (-2173.823) [-2174.714] (-2173.869) (-2173.331) * (-2174.055) (-2173.502) [-2171.122] (-2172.833) -- 0:00:57
      161000 -- (-2172.514) (-2173.010) (-2175.513) [-2172.919] * (-2174.990) [-2172.478] (-2173.495) (-2172.782) -- 0:00:57
      161500 -- (-2172.669) (-2172.568) (-2175.617) [-2171.542] * (-2176.907) (-2173.134) (-2173.078) [-2173.663] -- 0:00:57
      162000 -- [-2171.537] (-2172.915) (-2175.097) (-2171.542) * [-2171.202] (-2173.377) (-2176.075) (-2173.010) -- 0:00:56
      162500 -- [-2171.563] (-2172.905) (-2172.826) (-2173.477) * (-2172.886) (-2175.628) [-2171.772] (-2173.623) -- 0:00:56
      163000 -- [-2172.186] (-2171.610) (-2174.103) (-2172.998) * (-2173.286) (-2172.651) [-2172.720] (-2173.251) -- 0:00:56
      163500 -- (-2171.977) (-2172.490) [-2173.626] (-2173.107) * [-2172.784] (-2172.256) (-2173.905) (-2172.598) -- 0:00:56
      164000 -- [-2171.751] (-2172.832) (-2171.670) (-2172.851) * (-2172.283) (-2171.876) (-2175.032) [-2173.285] -- 0:00:56
      164500 -- (-2172.231) (-2171.771) [-2176.887] (-2174.626) * (-2176.777) (-2171.174) [-2174.065] (-2172.872) -- 0:00:55
      165000 -- [-2172.148] (-2171.336) (-2172.043) (-2174.625) * (-2178.463) (-2171.153) [-2171.091] (-2177.955) -- 0:00:55

      Average standard deviation of split frequencies: 0.016441

      165500 -- [-2172.295] (-2171.327) (-2171.531) (-2182.287) * (-2174.705) (-2171.397) [-2171.957] (-2174.977) -- 0:00:55
      166000 -- (-2174.107) (-2171.328) [-2171.597] (-2177.858) * (-2172.853) [-2173.213] (-2174.563) (-2173.478) -- 0:01:00
      166500 -- (-2172.142) (-2170.915) (-2173.980) [-2173.122] * (-2173.818) [-2173.168] (-2172.381) (-2172.607) -- 0:01:00
      167000 -- (-2173.893) (-2171.028) (-2172.342) [-2174.656] * (-2172.796) (-2173.825) [-2173.016] (-2172.610) -- 0:00:59
      167500 -- [-2172.352] (-2170.962) (-2171.173) (-2175.801) * [-2172.496] (-2177.360) (-2172.623) (-2171.868) -- 0:00:59
      168000 -- (-2171.790) [-2171.955] (-2171.807) (-2173.258) * [-2174.579] (-2174.743) (-2174.216) (-2171.755) -- 0:00:59
      168500 -- [-2171.697] (-2172.716) (-2172.208) (-2175.501) * (-2173.168) (-2174.306) [-2175.894] (-2171.826) -- 0:00:59
      169000 -- (-2174.312) (-2171.859) [-2175.743] (-2174.370) * (-2173.875) [-2172.723] (-2174.572) (-2172.253) -- 0:00:59
      169500 -- (-2171.965) [-2172.249] (-2175.836) (-2174.662) * (-2180.795) (-2170.928) [-2171.681] (-2172.253) -- 0:00:58
      170000 -- (-2173.678) [-2172.804] (-2176.652) (-2173.746) * (-2173.508) (-2170.935) [-2175.113] (-2173.732) -- 0:00:58

      Average standard deviation of split frequencies: 0.015264

      170500 -- [-2172.150] (-2178.717) (-2177.944) (-2173.332) * (-2172.559) [-2171.467] (-2171.845) (-2171.635) -- 0:00:58
      171000 -- [-2172.532] (-2174.261) (-2178.381) (-2171.433) * (-2173.172) (-2171.448) [-2171.746] (-2172.309) -- 0:00:58
      171500 -- [-2172.116] (-2174.611) (-2178.518) (-2172.028) * [-2171.490] (-2174.863) (-2171.599) (-2173.481) -- 0:00:57
      172000 -- (-2174.744) (-2175.678) (-2176.360) [-2172.509] * (-2171.609) [-2172.542] (-2172.786) (-2176.077) -- 0:00:57
      172500 -- (-2172.043) [-2174.622] (-2175.494) (-2175.903) * (-2170.970) (-2178.769) (-2175.025) [-2172.401] -- 0:00:57
      173000 -- [-2172.063] (-2176.421) (-2185.469) (-2175.094) * [-2171.479] (-2177.131) (-2172.829) (-2176.170) -- 0:00:57
      173500 -- (-2171.844) (-2175.890) (-2172.950) [-2170.843] * (-2171.582) (-2173.862) [-2174.975] (-2172.172) -- 0:00:57
      174000 -- (-2172.359) [-2174.220] (-2176.336) (-2170.870) * (-2171.293) [-2173.572] (-2178.961) (-2174.309) -- 0:00:56
      174500 -- (-2171.888) (-2172.815) [-2178.848] (-2174.434) * (-2171.715) (-2173.918) (-2172.237) [-2171.658] -- 0:00:56
      175000 -- [-2172.151] (-2172.620) (-2177.247) (-2171.530) * [-2172.620] (-2173.518) (-2173.470) (-2172.121) -- 0:00:56

      Average standard deviation of split frequencies: 0.016916

      175500 -- [-2172.410] (-2173.177) (-2177.742) (-2172.480) * [-2172.273] (-2173.395) (-2171.211) (-2171.363) -- 0:00:56
      176000 -- (-2175.319) [-2173.316] (-2172.071) (-2171.133) * (-2173.261) (-2171.880) [-2171.201] (-2172.170) -- 0:00:56
      176500 -- (-2172.925) (-2174.873) (-2171.217) [-2173.921] * [-2173.336] (-2172.142) (-2171.877) (-2173.285) -- 0:00:55
      177000 -- [-2173.017] (-2172.119) (-2171.192) (-2172.104) * (-2172.208) [-2171.966] (-2174.180) (-2172.152) -- 0:00:55
      177500 -- (-2174.868) (-2172.401) (-2172.538) [-2171.056] * (-2173.666) (-2172.132) (-2171.694) [-2173.315] -- 0:00:55
      178000 -- (-2172.927) [-2176.570] (-2173.637) (-2175.027) * [-2172.130] (-2171.250) (-2174.241) (-2175.113) -- 0:00:55
      178500 -- [-2173.850] (-2172.843) (-2175.073) (-2173.547) * (-2172.127) (-2172.513) [-2172.040] (-2174.246) -- 0:00:55
      179000 -- (-2172.629) (-2175.885) [-2174.345] (-2172.120) * (-2171.565) (-2181.503) [-2173.438] (-2174.602) -- 0:00:55
      179500 -- (-2171.516) (-2174.101) (-2172.558) [-2172.815] * (-2174.407) (-2175.000) (-2173.109) [-2175.567] -- 0:00:54
      180000 -- (-2175.291) (-2174.532) (-2175.625) [-2172.134] * (-2181.431) (-2175.259) (-2172.996) [-2170.935] -- 0:00:54

      Average standard deviation of split frequencies: 0.018265

      180500 -- [-2176.179] (-2173.919) (-2173.976) (-2172.364) * (-2175.576) [-2173.384] (-2172.989) (-2170.935) -- 0:00:54
      181000 -- [-2173.631] (-2175.811) (-2175.019) (-2171.115) * (-2177.403) (-2173.742) (-2171.936) [-2171.970] -- 0:00:58
      181500 -- (-2173.035) [-2172.850] (-2174.135) (-2171.150) * (-2176.321) (-2173.436) [-2172.158] (-2175.829) -- 0:00:58
      182000 -- (-2174.295) [-2172.323] (-2174.400) (-2171.879) * (-2176.893) (-2175.777) [-2172.882] (-2173.722) -- 0:00:58
      182500 -- (-2171.858) [-2171.918] (-2171.617) (-2172.988) * (-2178.500) [-2174.375] (-2172.577) (-2174.308) -- 0:00:58
      183000 -- (-2171.793) (-2172.783) (-2171.749) [-2173.764] * [-2175.022] (-2175.586) (-2173.771) (-2174.216) -- 0:00:58
      183500 -- (-2172.814) [-2173.370] (-2172.945) (-2182.266) * (-2174.854) (-2173.091) (-2173.175) [-2176.160] -- 0:00:57
      184000 -- (-2172.861) (-2173.437) [-2173.763] (-2173.886) * (-2173.834) (-2170.889) [-2173.175] (-2175.350) -- 0:00:57
      184500 -- [-2173.131] (-2173.447) (-2171.422) (-2172.399) * [-2173.109] (-2172.467) (-2173.945) (-2174.921) -- 0:00:57
      185000 -- (-2174.666) (-2172.008) [-2171.087] (-2172.447) * (-2176.154) (-2171.360) [-2175.388] (-2177.495) -- 0:00:57

      Average standard deviation of split frequencies: 0.017361

      185500 -- (-2174.694) [-2172.080] (-2172.549) (-2174.119) * (-2173.660) (-2173.385) [-2174.680] (-2176.907) -- 0:00:57
      186000 -- (-2177.122) [-2171.992] (-2172.181) (-2174.337) * (-2173.510) (-2175.257) [-2173.686] (-2176.615) -- 0:00:56
      186500 -- (-2174.324) (-2174.134) (-2173.802) [-2172.612] * [-2171.441] (-2174.202) (-2173.868) (-2172.128) -- 0:00:56
      187000 -- (-2174.274) (-2173.398) [-2175.034] (-2174.265) * (-2171.425) (-2171.569) (-2172.645) [-2172.991] -- 0:00:56
      187500 -- (-2175.933) (-2176.797) (-2174.500) [-2174.972] * [-2172.147] (-2171.532) (-2173.301) (-2171.945) -- 0:00:56
      188000 -- (-2176.163) (-2172.650) (-2174.129) [-2173.492] * (-2172.749) (-2171.691) [-2174.155] (-2172.340) -- 0:00:56
      188500 -- (-2174.369) (-2174.988) [-2174.055] (-2173.178) * [-2171.498] (-2171.117) (-2174.160) (-2173.283) -- 0:00:55
      189000 -- (-2172.468) [-2175.938] (-2175.113) (-2174.040) * (-2177.644) (-2170.646) [-2170.973] (-2174.694) -- 0:00:55
      189500 -- (-2173.422) (-2178.883) [-2173.695] (-2174.018) * (-2175.561) [-2171.314] (-2172.198) (-2175.706) -- 0:00:55
      190000 -- (-2172.532) (-2174.390) [-2173.476] (-2171.833) * [-2172.350] (-2172.043) (-2171.293) (-2171.727) -- 0:00:55

      Average standard deviation of split frequencies: 0.017542

      190500 -- (-2173.582) (-2174.902) (-2172.926) [-2172.491] * (-2172.726) [-2172.281] (-2173.246) (-2171.727) -- 0:00:55
      191000 -- (-2171.926) [-2175.693] (-2172.722) (-2174.806) * (-2177.820) (-2175.205) [-2174.009] (-2173.069) -- 0:00:55
      191500 -- [-2172.335] (-2178.428) (-2171.193) (-2172.341) * [-2172.057] (-2172.146) (-2172.958) (-2174.434) -- 0:00:54
      192000 -- [-2171.868] (-2172.181) (-2174.145) (-2171.653) * [-2175.004] (-2172.073) (-2172.313) (-2175.539) -- 0:00:54
      192500 -- (-2172.749) (-2174.195) [-2172.041] (-2172.649) * (-2173.613) (-2172.416) [-2171.940] (-2175.651) -- 0:00:54
      193000 -- (-2172.211) [-2172.151] (-2173.379) (-2172.640) * (-2173.214) (-2170.886) (-2171.369) [-2174.461] -- 0:00:54
      193500 -- (-2172.822) (-2171.958) (-2172.178) [-2173.719] * [-2171.725] (-2171.135) (-2172.420) (-2173.119) -- 0:00:54
      194000 -- (-2172.052) [-2171.958] (-2173.729) (-2173.663) * [-2171.194] (-2171.135) (-2171.433) (-2173.615) -- 0:00:54
      194500 -- (-2173.625) (-2171.958) (-2172.441) [-2172.140] * [-2172.678] (-2171.427) (-2173.618) (-2174.151) -- 0:00:53
      195000 -- (-2176.915) (-2172.697) [-2172.978] (-2174.181) * (-2173.473) (-2171.807) (-2173.250) [-2173.866] -- 0:00:53

      Average standard deviation of split frequencies: 0.019126

      195500 -- (-2175.144) [-2172.809] (-2172.543) (-2174.402) * [-2172.614] (-2174.211) (-2171.613) (-2171.641) -- 0:00:53
      196000 -- (-2174.210) (-2172.733) (-2172.791) [-2174.713] * [-2172.288] (-2175.878) (-2171.494) (-2171.751) -- 0:00:57
      196500 -- (-2175.509) (-2173.534) (-2172.828) [-2177.283] * (-2173.079) (-2174.761) (-2172.977) [-2171.087] -- 0:00:57
      197000 -- (-2175.303) (-2173.308) (-2175.946) [-2179.656] * [-2171.986] (-2175.093) (-2172.609) (-2171.735) -- 0:00:57
      197500 -- (-2177.069) (-2171.969) [-2172.595] (-2173.489) * (-2172.518) [-2172.614] (-2172.642) (-2171.370) -- 0:00:56
      198000 -- (-2175.615) (-2172.889) (-2177.969) [-2173.421] * (-2172.591) [-2173.498] (-2175.340) (-2171.251) -- 0:00:56
      198500 -- (-2174.393) [-2171.811] (-2173.175) (-2173.158) * [-2173.671] (-2173.439) (-2172.336) (-2171.251) -- 0:00:56
      199000 -- (-2175.450) [-2171.851] (-2171.537) (-2175.754) * [-2173.919] (-2174.364) (-2172.355) (-2170.698) -- 0:00:56
      199500 -- (-2173.114) [-2172.433] (-2172.628) (-2174.722) * [-2173.707] (-2172.828) (-2172.923) (-2171.750) -- 0:00:56
      200000 -- (-2173.858) [-2171.997] (-2172.595) (-2173.760) * (-2176.950) (-2174.536) (-2171.620) [-2172.077] -- 0:00:55

      Average standard deviation of split frequencies: 0.018089

      200500 -- [-2174.753] (-2173.978) (-2173.054) (-2173.244) * (-2177.507) (-2176.155) (-2171.431) [-2171.277] -- 0:00:55
      201000 -- (-2174.183) (-2172.518) [-2174.378] (-2171.811) * (-2175.921) (-2176.858) (-2175.759) [-2171.990] -- 0:00:55
      201500 -- (-2172.765) [-2171.976] (-2174.897) (-2171.804) * (-2175.457) [-2170.721] (-2177.185) (-2173.386) -- 0:00:55
      202000 -- [-2172.350] (-2171.987) (-2178.876) (-2172.215) * [-2174.432] (-2170.734) (-2174.957) (-2171.990) -- 0:00:55
      202500 -- (-2173.352) (-2173.570) [-2172.751] (-2173.917) * (-2172.105) [-2173.289] (-2172.071) (-2171.735) -- 0:00:55
      203000 -- [-2172.982] (-2176.270) (-2175.143) (-2174.145) * (-2174.995) [-2172.978] (-2177.033) (-2174.566) -- 0:00:54
      203500 -- (-2172.155) (-2177.662) (-2174.752) [-2172.342] * (-2172.176) (-2173.949) [-2172.898] (-2171.125) -- 0:00:54
      204000 -- (-2174.845) [-2173.211] (-2172.217) (-2171.081) * (-2172.205) [-2173.162] (-2171.393) (-2174.630) -- 0:00:54
      204500 -- [-2174.076] (-2172.616) (-2173.606) (-2174.307) * [-2172.935] (-2177.253) (-2171.644) (-2177.850) -- 0:00:54
      205000 -- [-2173.434] (-2172.516) (-2174.946) (-2174.502) * [-2171.904] (-2173.504) (-2172.244) (-2173.498) -- 0:00:54

      Average standard deviation of split frequencies: 0.017544

      205500 -- (-2174.834) (-2173.268) (-2173.500) [-2173.826] * (-2171.987) (-2173.416) (-2172.638) [-2170.995] -- 0:00:54
      206000 -- (-2172.925) [-2171.582] (-2171.645) (-2179.964) * (-2178.374) (-2174.200) [-2171.584] (-2170.927) -- 0:00:53
      206500 -- (-2171.573) [-2171.322] (-2172.434) (-2173.900) * [-2173.098] (-2178.273) (-2173.338) (-2173.022) -- 0:00:53
      207000 -- (-2171.753) (-2171.937) [-2173.400] (-2174.082) * (-2174.339) (-2175.330) (-2172.868) [-2172.189] -- 0:00:53
      207500 -- [-2172.647] (-2171.318) (-2173.033) (-2173.717) * (-2174.973) (-2174.344) [-2173.326] (-2173.500) -- 0:00:53
      208000 -- (-2172.834) [-2175.421] (-2172.775) (-2173.509) * (-2173.671) (-2173.812) (-2171.899) [-2173.352] -- 0:00:53
      208500 -- [-2174.065] (-2171.502) (-2172.883) (-2173.165) * (-2174.151) (-2172.656) (-2173.817) [-2171.847] -- 0:00:53
      209000 -- [-2171.341] (-2170.755) (-2173.534) (-2175.897) * (-2172.778) [-2172.665] (-2171.127) (-2173.123) -- 0:00:52
      209500 -- (-2172.309) [-2170.767] (-2172.574) (-2175.397) * (-2175.589) (-2174.008) [-2172.751] (-2173.071) -- 0:00:52
      210000 -- (-2172.568) (-2170.767) (-2172.574) [-2170.971] * (-2172.804) (-2171.713) (-2173.654) [-2173.459] -- 0:00:52

      Average standard deviation of split frequencies: 0.018013

      210500 -- (-2181.238) (-2171.501) (-2172.962) [-2170.971] * (-2172.760) [-2172.378] (-2173.035) (-2172.600) -- 0:00:56
      211000 -- (-2173.066) [-2171.899] (-2175.136) (-2171.249) * (-2173.467) [-2172.293] (-2173.034) (-2175.674) -- 0:00:56
      211500 -- (-2172.661) (-2173.885) [-2175.489] (-2170.910) * [-2173.396] (-2172.117) (-2174.348) (-2174.816) -- 0:00:55
      212000 -- (-2172.661) (-2174.052) [-2173.452] (-2176.205) * (-2173.162) (-2170.951) [-2172.276] (-2171.604) -- 0:00:55
      212500 -- [-2172.311] (-2173.472) (-2173.515) (-2173.402) * (-2175.541) (-2171.451) (-2171.427) [-2172.050] -- 0:00:55
      213000 -- (-2171.664) (-2178.666) [-2171.163] (-2173.245) * (-2178.186) (-2170.817) [-2172.866] (-2172.498) -- 0:00:55
      213500 -- (-2171.846) (-2175.336) [-2171.751] (-2176.368) * (-2174.436) (-2171.396) (-2174.420) [-2176.483] -- 0:00:55
      214000 -- (-2171.780) [-2173.938] (-2173.083) (-2172.784) * (-2171.177) [-2170.655] (-2172.916) (-2172.617) -- 0:00:55
      214500 -- [-2171.945] (-2174.170) (-2172.930) (-2173.350) * (-2172.780) (-2171.331) (-2176.509) [-2172.690] -- 0:00:54
      215000 -- (-2171.559) (-2170.956) (-2172.120) [-2171.929] * (-2173.924) (-2172.373) [-2173.972] (-2172.690) -- 0:00:54

      Average standard deviation of split frequencies: 0.017944

      215500 -- (-2173.250) (-2171.352) (-2176.403) [-2171.444] * (-2175.095) (-2172.382) [-2172.122] (-2172.262) -- 0:00:54
      216000 -- (-2172.912) [-2171.051] (-2175.851) (-2174.246) * (-2174.805) (-2171.412) (-2172.791) [-2171.289] -- 0:00:54
      216500 -- (-2175.014) (-2174.862) (-2174.405) [-2173.378] * (-2173.345) [-2170.895] (-2171.954) (-2172.107) -- 0:00:54
      217000 -- (-2173.193) [-2173.329] (-2174.352) (-2173.743) * (-2174.087) (-2170.964) (-2174.003) [-2171.309] -- 0:00:54
      217500 -- (-2173.469) (-2172.308) (-2172.558) [-2173.483] * (-2172.566) (-2171.885) [-2174.250] (-2171.997) -- 0:00:53
      218000 -- [-2172.418] (-2171.689) (-2171.620) (-2175.502) * (-2172.974) [-2171.526] (-2175.208) (-2173.857) -- 0:00:53
      218500 -- (-2172.939) [-2171.770] (-2171.532) (-2174.211) * (-2172.322) [-2173.020] (-2174.531) (-2175.846) -- 0:00:53
      219000 -- (-2174.452) (-2172.673) [-2171.408] (-2174.595) * (-2172.588) (-2170.982) [-2172.215] (-2174.167) -- 0:00:53
      219500 -- (-2173.895) (-2172.855) [-2171.401] (-2172.430) * [-2172.551] (-2170.982) (-2172.181) (-2175.490) -- 0:00:53
      220000 -- (-2175.417) [-2170.650] (-2172.909) (-2174.486) * [-2173.343] (-2170.982) (-2170.797) (-2177.299) -- 0:00:53

      Average standard deviation of split frequencies: 0.018889

      220500 -- (-2172.494) (-2171.480) (-2172.673) [-2172.905] * (-2173.578) (-2170.966) [-2170.855] (-2175.847) -- 0:00:53
      221000 -- (-2171.460) (-2171.777) (-2172.975) [-2171.169] * (-2172.253) [-2170.684] (-2171.669) (-2179.614) -- 0:00:52
      221500 -- (-2173.908) (-2173.835) [-2172.574] (-2171.530) * [-2172.032] (-2171.537) (-2172.168) (-2172.871) -- 0:00:52
      222000 -- (-2172.130) (-2173.660) [-2173.159] (-2172.498) * [-2171.896] (-2173.774) (-2172.109) (-2171.552) -- 0:00:52
      222500 -- [-2172.107] (-2175.138) (-2176.252) (-2175.459) * (-2172.593) (-2174.390) (-2171.442) [-2171.351] -- 0:00:52
      223000 -- [-2172.736] (-2176.382) (-2175.352) (-2175.578) * (-2174.687) (-2175.780) [-2172.061] (-2180.156) -- 0:00:52
      223500 -- (-2172.089) (-2172.472) [-2171.936] (-2174.639) * (-2174.668) (-2173.430) (-2172.515) [-2180.477] -- 0:00:52
      224000 -- (-2175.157) (-2171.897) (-2172.272) [-2172.980] * (-2175.858) (-2172.892) [-2172.105] (-2186.752) -- 0:00:51
      224500 -- (-2179.366) (-2173.082) [-2172.268] (-2171.411) * (-2172.957) [-2173.023] (-2172.585) (-2182.097) -- 0:00:51
      225000 -- (-2183.282) (-2172.134) (-2172.880) [-2174.003] * (-2172.224) (-2172.687) [-2177.019] (-2181.183) -- 0:00:51

      Average standard deviation of split frequencies: 0.018443

      225500 -- (-2179.192) (-2172.349) [-2173.405] (-2175.134) * [-2172.134] (-2172.700) (-2175.419) (-2178.513) -- 0:00:54
      226000 -- (-2177.550) [-2171.125] (-2174.184) (-2176.247) * [-2172.831] (-2172.684) (-2178.578) (-2172.638) -- 0:00:54
      226500 -- (-2175.495) (-2172.138) (-2176.531) [-2171.630] * (-2173.540) [-2172.600] (-2177.971) (-2172.127) -- 0:00:54
      227000 -- (-2176.102) (-2173.629) [-2175.559] (-2174.718) * (-2174.029) [-2172.439] (-2177.552) (-2172.278) -- 0:00:54
      227500 -- (-2175.935) [-2173.619] (-2171.514) (-2172.051) * (-2171.343) [-2172.117] (-2176.807) (-2173.186) -- 0:00:54
      228000 -- [-2174.244] (-2172.806) (-2173.276) (-2171.852) * [-2171.127] (-2173.114) (-2175.243) (-2172.928) -- 0:00:54
      228500 -- (-2173.763) [-2173.031] (-2174.259) (-2170.837) * [-2171.110] (-2173.114) (-2174.707) (-2172.021) -- 0:00:54
      229000 -- (-2173.828) [-2173.077] (-2174.409) (-2170.956) * (-2171.938) [-2172.907] (-2178.784) (-2171.872) -- 0:00:53
      229500 -- [-2171.518] (-2172.202) (-2177.205) (-2175.378) * (-2174.228) (-2171.309) (-2171.342) [-2171.479] -- 0:00:53
      230000 -- (-2171.337) (-2172.202) [-2174.846] (-2171.392) * (-2174.317) [-2171.028] (-2173.299) (-2173.767) -- 0:00:53

      Average standard deviation of split frequencies: 0.016995

      230500 -- (-2171.979) [-2172.089] (-2171.199) (-2171.548) * (-2173.828) (-2171.028) (-2171.101) [-2172.538] -- 0:00:53
      231000 -- (-2174.569) (-2174.164) [-2171.505] (-2177.514) * (-2177.025) (-2174.238) [-2182.294] (-2173.596) -- 0:00:53
      231500 -- [-2176.709] (-2173.498) (-2171.713) (-2177.722) * (-2172.361) [-2172.186] (-2173.734) (-2171.612) -- 0:00:53
      232000 -- (-2173.388) (-2176.499) [-2171.392] (-2173.389) * (-2172.811) (-2172.186) [-2175.445] (-2172.357) -- 0:00:52
      232500 -- [-2173.078] (-2172.746) (-2174.843) (-2175.517) * (-2172.863) (-2172.871) [-2170.894] (-2173.563) -- 0:00:52
      233000 -- (-2178.044) [-2174.626] (-2175.332) (-2175.464) * [-2172.663] (-2172.917) (-2170.660) (-2175.037) -- 0:00:52
      233500 -- [-2173.799] (-2170.995) (-2173.504) (-2177.995) * (-2175.942) (-2173.164) (-2170.655) [-2171.263] -- 0:00:52
      234000 -- (-2177.646) (-2172.375) [-2175.237] (-2174.151) * (-2175.170) (-2172.702) [-2171.440] (-2173.151) -- 0:00:52
      234500 -- (-2172.949) (-2175.060) [-2173.550] (-2173.078) * [-2173.504] (-2171.510) (-2170.784) (-2173.161) -- 0:00:52
      235000 -- (-2173.353) (-2173.518) [-2177.349] (-2173.670) * (-2171.455) [-2173.958] (-2170.700) (-2171.723) -- 0:00:52

      Average standard deviation of split frequencies: 0.015203

      235500 -- (-2175.391) (-2172.358) (-2173.030) [-2174.792] * (-2171.652) (-2176.232) [-2171.311] (-2170.879) -- 0:00:51
      236000 -- [-2175.391] (-2172.620) (-2174.912) (-2172.387) * (-2171.473) (-2177.905) (-2173.940) [-2171.975] -- 0:00:51
      236500 -- (-2175.430) (-2173.142) [-2173.153] (-2170.995) * (-2171.759) (-2172.909) [-2172.561] (-2173.767) -- 0:00:51
      237000 -- (-2176.387) (-2171.089) [-2173.441] (-2171.081) * (-2173.018) (-2171.781) [-2173.773] (-2172.863) -- 0:00:51
      237500 -- (-2177.283) (-2171.264) [-2174.111] (-2171.093) * (-2173.159) [-2171.543] (-2182.065) (-2173.189) -- 0:00:51
      238000 -- (-2175.591) (-2173.620) [-2171.747] (-2173.458) * [-2174.226] (-2174.268) (-2178.141) (-2174.294) -- 0:00:51
      238500 -- (-2174.853) (-2172.872) [-2173.617] (-2173.919) * (-2172.755) (-2173.240) (-2180.247) [-2173.339] -- 0:00:51
      239000 -- (-2174.049) [-2172.708] (-2172.079) (-2173.841) * (-2173.214) (-2172.544) [-2175.147] (-2175.269) -- 0:00:50
      239500 -- (-2176.029) (-2171.352) (-2172.870) [-2174.250] * (-2176.707) (-2182.072) (-2175.823) [-2172.979] -- 0:00:50
      240000 -- (-2173.221) [-2171.680] (-2173.405) (-2171.489) * (-2177.275) (-2179.990) (-2173.781) [-2173.337] -- 0:00:50

      Average standard deviation of split frequencies: 0.014124

      240500 -- (-2173.329) (-2172.429) [-2172.747] (-2172.582) * (-2175.431) (-2174.212) [-2171.993] (-2172.749) -- 0:00:53
      241000 -- (-2177.864) (-2173.457) [-2172.235] (-2171.840) * (-2173.351) (-2174.246) [-2172.969] (-2173.007) -- 0:00:53
      241500 -- (-2175.823) (-2172.595) [-2173.233] (-2175.680) * (-2177.348) (-2174.904) (-2173.588) [-2172.156] -- 0:00:53
      242000 -- [-2175.915] (-2174.803) (-2173.673) (-2173.957) * (-2176.383) (-2178.306) [-2172.144] (-2173.098) -- 0:00:53
      242500 -- [-2175.468] (-2174.623) (-2174.041) (-2175.515) * (-2176.350) [-2173.016] (-2172.144) (-2173.686) -- 0:00:53
      243000 -- [-2175.265] (-2172.896) (-2174.428) (-2179.221) * (-2176.719) (-2174.055) [-2174.436] (-2173.431) -- 0:00:52
      243500 -- (-2174.175) (-2173.062) [-2174.445] (-2175.031) * [-2174.516] (-2172.664) (-2172.065) (-2173.426) -- 0:00:52
      244000 -- [-2175.911] (-2173.945) (-2174.838) (-2173.108) * [-2172.719] (-2172.261) (-2172.741) (-2172.987) -- 0:00:52
      244500 -- (-2173.845) (-2178.345) [-2172.640] (-2173.047) * (-2172.937) [-2171.728] (-2171.375) (-2172.865) -- 0:00:52
      245000 -- (-2173.449) [-2173.230] (-2172.472) (-2173.573) * (-2171.650) (-2171.837) (-2173.479) [-2173.057] -- 0:00:52

      Average standard deviation of split frequencies: 0.014053

      245500 -- (-2173.449) (-2172.744) (-2172.347) [-2173.545] * (-2174.266) [-2172.789] (-2175.582) (-2173.096) -- 0:00:52
      246000 -- (-2172.933) (-2174.446) (-2173.127) [-2171.083] * (-2171.785) [-2171.849] (-2172.684) (-2171.908) -- 0:00:52
      246500 -- [-2172.849] (-2174.041) (-2173.331) (-2176.593) * [-2171.304] (-2175.632) (-2175.844) (-2171.907) -- 0:00:51
      247000 -- (-2174.817) (-2173.930) [-2171.484] (-2171.588) * (-2172.460) (-2176.488) (-2174.292) [-2172.082] -- 0:00:51
      247500 -- (-2174.352) (-2172.072) [-2171.476] (-2172.535) * (-2171.629) (-2173.744) (-2175.632) [-2175.645] -- 0:00:51
      248000 -- (-2176.170) (-2172.279) (-2171.635) [-2172.710] * [-2177.171] (-2173.972) (-2174.293) (-2173.822) -- 0:00:51
      248500 -- (-2173.953) (-2172.306) (-2176.689) [-2171.244] * (-2173.794) [-2173.154] (-2178.061) (-2172.141) -- 0:00:51
      249000 -- [-2171.975] (-2172.960) (-2174.764) (-2172.090) * [-2171.402] (-2172.536) (-2176.425) (-2172.744) -- 0:00:51
      249500 -- (-2171.738) [-2172.036] (-2175.739) (-2173.070) * [-2171.141] (-2172.406) (-2175.693) (-2173.326) -- 0:00:51
      250000 -- (-2172.413) [-2171.279] (-2176.452) (-2174.324) * [-2172.157] (-2172.100) (-2172.777) (-2173.224) -- 0:00:51

      Average standard deviation of split frequencies: 0.013687

      250500 -- (-2172.253) (-2171.177) [-2171.875] (-2172.607) * (-2173.661) (-2171.107) (-2173.901) [-2174.799] -- 0:00:50
      251000 -- (-2175.269) [-2170.780] (-2176.255) (-2173.094) * (-2173.621) (-2171.838) [-2173.755] (-2172.104) -- 0:00:50
      251500 -- (-2174.761) [-2170.810] (-2175.861) (-2173.894) * (-2175.241) (-2171.838) [-2172.802] (-2175.622) -- 0:00:50
      252000 -- [-2171.927] (-2170.809) (-2172.373) (-2173.062) * (-2178.439) (-2172.731) [-2178.828] (-2173.556) -- 0:00:50
      252500 -- (-2173.136) (-2171.553) [-2173.756] (-2172.867) * [-2174.467] (-2172.959) (-2174.224) (-2175.971) -- 0:00:50
      253000 -- (-2175.527) (-2172.185) (-2172.701) [-2172.438] * (-2175.415) (-2172.836) (-2171.607) [-2174.640] -- 0:00:50
      253500 -- (-2174.700) (-2173.079) [-2175.197] (-2173.407) * (-2174.638) (-2171.356) [-2175.294] (-2170.786) -- 0:00:50
      254000 -- (-2173.141) (-2171.495) (-2173.172) [-2175.614] * (-2171.641) (-2171.536) (-2177.263) [-2170.781] -- 0:00:49
      254500 -- [-2172.339] (-2171.322) (-2177.204) (-2174.607) * (-2170.770) [-2175.388] (-2173.849) (-2171.306) -- 0:00:49
      255000 -- (-2173.720) (-2173.317) (-2176.740) [-2174.109] * (-2172.813) [-2172.363] (-2173.692) (-2171.304) -- 0:00:49

      Average standard deviation of split frequencies: 0.014538

      255500 -- [-2172.186] (-2174.253) (-2175.511) (-2174.414) * (-2171.681) [-2175.001] (-2172.961) (-2171.435) -- 0:00:52
      256000 -- [-2172.160] (-2174.738) (-2172.682) (-2174.458) * [-2171.136] (-2172.306) (-2172.024) (-2171.069) -- 0:00:52
      256500 -- (-2172.160) (-2173.912) [-2174.850] (-2172.449) * (-2172.813) (-2172.118) [-2172.720] (-2174.401) -- 0:00:52
      257000 -- [-2172.068] (-2172.312) (-2175.443) (-2172.605) * (-2171.702) (-2172.100) [-2173.529] (-2172.326) -- 0:00:52
      257500 -- (-2172.774) (-2173.975) [-2171.505] (-2171.832) * (-2171.702) (-2171.604) (-2172.662) [-2172.369] -- 0:00:51
      258000 -- (-2173.166) (-2172.561) [-2172.437] (-2175.381) * [-2171.843] (-2174.943) (-2172.906) (-2173.747) -- 0:00:51
      258500 -- (-2171.396) [-2171.074] (-2173.944) (-2173.612) * (-2171.765) (-2180.708) (-2172.906) [-2175.372] -- 0:00:51
      259000 -- [-2171.112] (-2175.594) (-2175.953) (-2173.716) * [-2171.765] (-2175.857) (-2172.683) (-2177.673) -- 0:00:51
      259500 -- [-2171.178] (-2171.088) (-2173.009) (-2173.428) * (-2172.839) (-2176.322) (-2174.323) [-2172.609] -- 0:00:51
      260000 -- (-2173.812) [-2171.812] (-2175.194) (-2172.945) * (-2175.022) [-2183.168] (-2171.699) (-2172.125) -- 0:00:51

      Average standard deviation of split frequencies: 0.014355

      260500 -- (-2172.266) [-2170.704] (-2172.214) (-2173.177) * (-2173.356) [-2173.759] (-2173.452) (-2175.050) -- 0:00:51
      261000 -- (-2171.448) (-2174.239) (-2171.247) [-2172.093] * (-2172.668) (-2174.917) [-2173.452] (-2175.615) -- 0:00:50
      261500 -- (-2174.137) (-2171.487) (-2172.962) [-2172.698] * (-2173.077) [-2172.494] (-2173.962) (-2172.618) -- 0:00:50
      262000 -- (-2173.749) (-2175.805) (-2173.580) [-2172.406] * (-2172.778) (-2173.838) [-2175.006] (-2173.514) -- 0:00:50
      262500 -- (-2174.200) [-2172.431] (-2171.397) (-2175.296) * (-2173.142) (-2174.791) [-2173.377] (-2171.869) -- 0:00:50
      263000 -- (-2177.463) (-2177.099) [-2172.366] (-2174.509) * (-2173.335) [-2173.556] (-2173.259) (-2172.694) -- 0:00:50
      263500 -- [-2172.932] (-2177.427) (-2174.238) (-2176.085) * (-2170.953) (-2173.725) [-2173.391] (-2173.802) -- 0:00:50
      264000 -- (-2172.553) [-2176.318] (-2172.659) (-2173.122) * (-2170.953) [-2173.398] (-2172.482) (-2172.042) -- 0:00:50
      264500 -- [-2173.314] (-2174.775) (-2171.918) (-2172.845) * (-2170.963) (-2173.108) (-2171.769) [-2172.957] -- 0:00:50
      265000 -- (-2174.299) (-2174.858) (-2176.182) [-2174.120] * (-2170.978) (-2172.500) (-2174.236) [-2172.849] -- 0:00:49

      Average standard deviation of split frequencies: 0.014510

      265500 -- (-2171.839) (-2177.671) [-2174.180] (-2176.335) * (-2173.356) (-2172.504) (-2175.647) [-2172.309] -- 0:00:49
      266000 -- [-2174.751] (-2176.763) (-2175.716) (-2175.405) * (-2172.789) [-2174.560] (-2177.061) (-2172.539) -- 0:00:49
      266500 -- (-2174.919) (-2174.977) (-2171.941) [-2173.449] * (-2173.006) (-2172.771) (-2174.600) [-2172.539] -- 0:00:49
      267000 -- (-2174.467) (-2174.133) [-2173.889] (-2175.894) * [-2176.800] (-2172.850) (-2176.419) (-2176.858) -- 0:00:49
      267500 -- (-2173.554) (-2174.786) (-2170.972) [-2175.508] * [-2172.553] (-2172.848) (-2170.967) (-2173.135) -- 0:00:49
      268000 -- [-2173.714] (-2175.433) (-2172.240) (-2173.723) * (-2172.712) (-2174.151) (-2171.298) [-2173.462] -- 0:00:49
      268500 -- (-2173.530) [-2173.321] (-2171.250) (-2172.698) * (-2173.876) (-2174.526) (-2172.405) [-2171.563] -- 0:00:49
      269000 -- (-2174.289) (-2173.317) [-2173.486] (-2173.713) * (-2175.137) [-2173.198] (-2173.573) (-2171.589) -- 0:00:48
      269500 -- (-2173.015) (-2175.539) (-2172.207) [-2172.568] * [-2173.005] (-2170.995) (-2172.812) (-2172.886) -- 0:00:48
      270000 -- (-2174.066) (-2175.510) [-2172.705] (-2172.338) * [-2173.816] (-2172.321) (-2174.593) (-2175.854) -- 0:00:48

      Average standard deviation of split frequencies: 0.012909

      270500 -- (-2178.542) (-2174.468) (-2173.359) [-2172.248] * [-2174.648] (-2172.695) (-2177.130) (-2175.367) -- 0:00:51
      271000 -- (-2172.918) (-2177.252) [-2172.728] (-2174.663) * [-2173.469] (-2171.914) (-2174.783) (-2178.881) -- 0:00:51
      271500 -- (-2173.465) [-2172.434] (-2172.728) (-2174.212) * (-2173.410) (-2171.862) [-2173.315] (-2176.556) -- 0:00:50
      272000 -- (-2172.814) [-2172.057] (-2171.868) (-2173.200) * (-2172.233) [-2172.937] (-2174.813) (-2172.849) -- 0:00:50
      272500 -- (-2171.943) [-2170.920] (-2171.525) (-2173.579) * [-2171.436] (-2172.476) (-2178.298) (-2172.714) -- 0:00:50
      273000 -- [-2178.068] (-2172.191) (-2176.126) (-2173.604) * (-2175.755) (-2174.481) [-2175.715] (-2172.386) -- 0:00:50
      273500 -- (-2171.587) [-2171.804] (-2173.375) (-2177.841) * (-2176.924) (-2177.990) (-2178.333) [-2171.712] -- 0:00:50
      274000 -- [-2172.090] (-2177.143) (-2172.821) (-2177.927) * (-2173.802) (-2173.131) (-2170.636) [-2172.024] -- 0:00:50
      274500 -- (-2172.361) (-2172.105) (-2172.880) [-2172.374] * (-2172.387) (-2172.285) [-2171.566] (-2172.529) -- 0:00:50
      275000 -- (-2171.699) (-2171.921) (-2176.786) [-2174.370] * [-2170.824] (-2173.005) (-2173.207) (-2173.229) -- 0:00:50

      Average standard deviation of split frequencies: 0.012405

      275500 -- [-2171.566] (-2170.913) (-2172.060) (-2172.638) * (-2171.316) (-2170.687) [-2173.719] (-2173.047) -- 0:00:49
      276000 -- (-2173.851) (-2172.049) [-2174.430] (-2174.671) * (-2171.810) (-2170.834) [-2172.567] (-2172.637) -- 0:00:49
      276500 -- [-2172.865] (-2174.819) (-2177.220) (-2174.294) * (-2172.244) [-2170.758] (-2171.024) (-2172.471) -- 0:00:49
      277000 -- (-2171.124) (-2184.985) (-2177.209) [-2174.538] * (-2172.114) (-2171.860) (-2171.326) [-2172.180] -- 0:00:49
      277500 -- [-2171.084] (-2174.681) (-2173.258) (-2177.705) * (-2171.878) (-2171.549) (-2173.888) [-2172.647] -- 0:00:49
      278000 -- (-2171.019) (-2173.754) [-2172.395] (-2177.371) * [-2171.801] (-2171.378) (-2172.601) (-2174.708) -- 0:00:49
      278500 -- [-2171.061] (-2172.710) (-2172.967) (-2171.503) * (-2172.247) [-2172.649] (-2172.638) (-2179.759) -- 0:00:49
      279000 -- (-2171.061) (-2173.395) [-2171.571] (-2172.488) * (-2174.621) [-2172.538] (-2172.392) (-2176.789) -- 0:00:49
      279500 -- (-2171.516) (-2171.409) (-2172.097) [-2172.661] * (-2172.901) (-2172.728) [-2175.199] (-2176.865) -- 0:00:48
      280000 -- (-2171.988) [-2172.843] (-2171.311) (-2174.750) * [-2172.183] (-2171.892) (-2173.954) (-2174.468) -- 0:00:48

      Average standard deviation of split frequencies: 0.012288

      280500 -- (-2176.638) (-2171.980) [-2173.265] (-2172.065) * [-2178.238] (-2174.543) (-2175.803) (-2171.850) -- 0:00:48
      281000 -- (-2176.640) (-2173.257) (-2171.781) [-2171.352] * (-2174.909) [-2172.792] (-2176.690) (-2171.896) -- 0:00:48
      281500 -- (-2172.386) [-2171.221] (-2176.734) (-2171.412) * (-2176.875) [-2172.035] (-2175.824) (-2171.953) -- 0:00:48
      282000 -- (-2174.795) (-2171.096) [-2171.732] (-2175.238) * [-2172.792] (-2171.734) (-2177.844) (-2173.179) -- 0:00:48
      282500 -- [-2174.222] (-2171.791) (-2172.984) (-2172.859) * (-2174.907) (-2172.537) (-2176.156) [-2174.771] -- 0:00:48
      283000 -- [-2173.086] (-2172.988) (-2172.200) (-2173.270) * (-2172.571) (-2173.042) [-2172.130] (-2174.308) -- 0:00:48
      283500 -- (-2172.935) [-2171.982] (-2171.421) (-2174.512) * (-2174.022) [-2172.751] (-2175.970) (-2174.074) -- 0:00:48
      284000 -- (-2171.872) (-2171.238) [-2171.421] (-2174.512) * (-2174.641) [-2176.746] (-2171.575) (-2172.073) -- 0:00:47
      284500 -- (-2171.607) [-2170.980] (-2171.348) (-2172.687) * (-2174.450) [-2176.189] (-2172.139) (-2170.972) -- 0:00:47
      285000 -- (-2170.992) [-2170.986] (-2174.562) (-2173.329) * [-2173.348] (-2175.565) (-2173.414) (-2172.068) -- 0:00:47

      Average standard deviation of split frequencies: 0.012752

      285500 -- (-2173.364) [-2171.593] (-2172.963) (-2173.409) * [-2173.670] (-2176.213) (-2174.012) (-2171.407) -- 0:00:50
      286000 -- (-2173.825) (-2174.560) [-2171.687] (-2173.654) * (-2172.902) [-2174.620] (-2172.539) (-2174.592) -- 0:00:49
      286500 -- (-2173.241) (-2171.297) [-2172.625] (-2173.371) * [-2172.169] (-2174.434) (-2172.865) (-2171.491) -- 0:00:49
      287000 -- [-2173.114] (-2173.116) (-2174.886) (-2174.106) * (-2177.169) (-2178.540) (-2173.745) [-2171.757] -- 0:00:49
      287500 -- (-2173.751) (-2173.683) (-2176.501) [-2171.730] * (-2175.711) (-2176.121) [-2174.188] (-2176.103) -- 0:00:49
      288000 -- (-2171.939) (-2172.785) (-2175.802) [-2172.659] * (-2175.680) (-2172.628) (-2175.031) [-2172.593] -- 0:00:49
      288500 -- (-2171.817) (-2171.309) (-2174.114) [-2173.085] * (-2172.474) (-2172.237) [-2177.540] (-2173.843) -- 0:00:49
      289000 -- (-2170.803) [-2172.011] (-2174.757) (-2175.096) * (-2172.722) (-2172.215) [-2172.350] (-2173.878) -- 0:00:49
      289500 -- [-2172.351] (-2172.142) (-2177.167) (-2175.926) * (-2173.307) (-2171.185) [-2173.867] (-2174.068) -- 0:00:49
      290000 -- (-2171.803) (-2172.180) (-2173.134) [-2176.559] * (-2172.365) [-2172.740] (-2171.599) (-2173.717) -- 0:00:48

      Average standard deviation of split frequencies: 0.013401

      290500 -- (-2172.577) [-2171.116] (-2174.946) (-2176.235) * [-2171.021] (-2172.740) (-2171.856) (-2174.120) -- 0:00:48
      291000 -- [-2172.178] (-2173.371) (-2175.622) (-2172.087) * [-2174.227] (-2173.759) (-2175.133) (-2173.624) -- 0:00:48
      291500 -- (-2170.668) (-2171.320) [-2172.547] (-2171.993) * [-2172.314] (-2175.551) (-2174.626) (-2171.935) -- 0:00:48
      292000 -- (-2171.557) [-2171.215] (-2172.149) (-2172.768) * (-2171.495) (-2175.492) [-2172.335] (-2171.795) -- 0:00:48
      292500 -- (-2170.920) (-2176.964) [-2175.261] (-2172.950) * (-2171.678) [-2172.876] (-2172.500) (-2171.795) -- 0:00:48
      293000 -- [-2171.893] (-2173.475) (-2175.074) (-2176.411) * (-2171.101) (-2173.747) [-2171.869] (-2171.135) -- 0:00:48
      293500 -- (-2173.855) (-2171.667) (-2175.352) [-2174.058] * (-2171.998) (-2175.347) [-2171.127] (-2173.772) -- 0:00:48
      294000 -- (-2176.143) (-2173.171) (-2174.511) [-2172.431] * (-2174.678) (-2174.486) (-2174.939) [-2171.174] -- 0:00:48
      294500 -- (-2174.161) (-2171.411) (-2174.517) [-2172.899] * (-2171.738) (-2174.121) (-2175.246) [-2171.204] -- 0:00:47
      295000 -- (-2172.108) (-2171.248) (-2172.459) [-2170.993] * (-2176.109) (-2171.899) [-2177.324] (-2171.254) -- 0:00:47

      Average standard deviation of split frequencies: 0.011986

      295500 -- (-2174.173) (-2174.139) (-2172.371) [-2174.974] * [-2173.115] (-2171.707) (-2177.487) (-2173.937) -- 0:00:47
      296000 -- (-2175.590) (-2174.183) [-2172.012] (-2175.359) * (-2174.592) (-2173.136) (-2173.525) [-2173.069] -- 0:00:47
      296500 -- (-2172.384) [-2172.980] (-2171.733) (-2172.436) * (-2172.126) (-2172.943) [-2179.793] (-2174.607) -- 0:00:47
      297000 -- (-2172.122) (-2174.588) (-2171.163) [-2171.669] * (-2171.972) (-2172.652) (-2177.840) [-2178.298] -- 0:00:47
      297500 -- (-2171.780) (-2172.766) [-2171.501] (-2172.862) * (-2172.089) (-2172.489) (-2174.649) [-2170.849] -- 0:00:47
      298000 -- (-2173.258) [-2175.963] (-2172.472) (-2172.829) * (-2174.499) (-2172.549) (-2173.053) [-2171.015] -- 0:00:47
      298500 -- (-2173.577) (-2175.497) [-2173.353] (-2174.209) * (-2175.970) (-2172.504) (-2171.998) [-2173.224] -- 0:00:47
      299000 -- [-2171.379] (-2174.051) (-2172.570) (-2173.771) * [-2172.763] (-2177.052) (-2171.386) (-2173.168) -- 0:00:46
      299500 -- (-2172.242) [-2175.999] (-2173.673) (-2173.653) * [-2175.659] (-2173.456) (-2171.386) (-2171.653) -- 0:00:46
      300000 -- (-2171.311) [-2173.286] (-2172.758) (-2173.936) * [-2171.182] (-2171.966) (-2171.298) (-2172.689) -- 0:00:46

      Average standard deviation of split frequencies: 0.011759

      300500 -- (-2173.129) [-2173.462] (-2171.673) (-2174.303) * [-2171.120] (-2171.686) (-2171.113) (-2172.945) -- 0:00:46
      301000 -- (-2173.210) [-2173.219] (-2172.653) (-2176.129) * (-2171.170) [-2173.329] (-2172.710) (-2172.992) -- 0:00:48
      301500 -- [-2172.908] (-2180.788) (-2172.645) (-2174.697) * (-2171.339) (-2172.824) [-2172.466] (-2171.914) -- 0:00:48
      302000 -- (-2172.659) [-2177.283] (-2171.035) (-2174.952) * [-2173.016] (-2180.327) (-2172.939) (-2171.914) -- 0:00:48
      302500 -- (-2174.715) [-2171.919] (-2173.480) (-2174.455) * (-2172.352) (-2173.502) (-2173.782) [-2171.254] -- 0:00:48
      303000 -- (-2172.305) [-2172.546] (-2172.055) (-2173.258) * (-2172.439) [-2172.151] (-2173.066) (-2175.008) -- 0:00:48
      303500 -- (-2172.338) (-2172.554) (-2171.421) [-2171.639] * (-2172.678) (-2170.902) [-2171.280] (-2171.393) -- 0:00:48
      304000 -- (-2171.678) [-2172.429] (-2172.596) (-2173.744) * (-2175.545) (-2171.603) [-2172.604] (-2173.458) -- 0:00:48
      304500 -- (-2174.036) (-2172.330) (-2174.869) [-2173.026] * [-2177.730] (-2171.643) (-2173.468) (-2174.650) -- 0:00:47
      305000 -- (-2172.847) (-2175.090) [-2176.787] (-2172.845) * [-2174.986] (-2176.520) (-2174.329) (-2173.726) -- 0:00:47

      Average standard deviation of split frequencies: 0.010869

      305500 -- (-2172.757) [-2175.652] (-2174.997) (-2174.041) * [-2173.854] (-2173.419) (-2174.248) (-2174.655) -- 0:00:47
      306000 -- (-2173.622) (-2173.252) (-2174.741) [-2174.585] * [-2173.354] (-2174.724) (-2173.626) (-2172.411) -- 0:00:47
      306500 -- (-2175.909) [-2173.878] (-2172.385) (-2174.679) * (-2175.951) (-2176.335) [-2178.409] (-2170.603) -- 0:00:47
      307000 -- (-2174.589) (-2173.586) (-2172.534) [-2177.163] * (-2174.559) [-2175.036] (-2172.336) (-2174.814) -- 0:00:47
      307500 -- (-2172.554) [-2172.617] (-2177.653) (-2179.021) * (-2174.816) (-2175.294) [-2172.239] (-2170.849) -- 0:00:47
      308000 -- (-2172.282) [-2172.548] (-2176.858) (-2179.382) * (-2174.224) (-2179.482) [-2172.148] (-2171.892) -- 0:00:47
      308500 -- (-2173.548) (-2172.251) (-2177.132) [-2177.807] * (-2174.153) [-2171.481] (-2173.315) (-2172.180) -- 0:00:47
      309000 -- (-2171.435) (-2177.823) (-2172.155) [-2174.114] * [-2176.585] (-2171.507) (-2170.650) (-2174.146) -- 0:00:46
      309500 -- (-2174.083) [-2175.610] (-2171.947) (-2175.294) * (-2171.806) [-2171.583] (-2171.619) (-2173.019) -- 0:00:46
      310000 -- (-2174.688) [-2174.088] (-2171.182) (-2176.984) * [-2171.633] (-2171.133) (-2172.823) (-2174.134) -- 0:00:46

      Average standard deviation of split frequencies: 0.009863

      310500 -- (-2177.243) (-2174.698) (-2171.808) [-2173.563] * (-2173.793) (-2171.982) [-2172.825] (-2176.440) -- 0:00:46
      311000 -- (-2177.243) (-2171.235) [-2171.077] (-2173.985) * (-2172.534) [-2172.372] (-2173.396) (-2171.430) -- 0:00:46
      311500 -- (-2173.166) [-2171.403] (-2171.131) (-2173.156) * (-2172.494) (-2172.378) (-2174.454) [-2170.761] -- 0:00:46
      312000 -- (-2171.079) [-2171.436] (-2171.084) (-2173.332) * (-2173.366) (-2173.768) (-2174.533) [-2172.311] -- 0:00:46
      312500 -- (-2171.017) (-2172.565) [-2171.287] (-2174.024) * (-2173.167) (-2175.525) [-2173.034] (-2172.435) -- 0:00:46
      313000 -- (-2171.709) [-2171.704] (-2172.273) (-2176.916) * (-2172.895) (-2171.209) [-2171.490] (-2171.852) -- 0:00:46
      313500 -- (-2171.440) [-2171.378] (-2171.300) (-2170.734) * (-2172.778) [-2171.280] (-2171.064) (-2173.044) -- 0:00:45
      314000 -- (-2173.237) (-2171.377) [-2171.243] (-2172.859) * (-2177.418) (-2171.878) [-2172.403] (-2173.578) -- 0:00:45
      314500 -- (-2175.748) (-2171.285) (-2173.055) [-2171.437] * [-2173.665] (-2170.678) (-2171.120) (-2174.208) -- 0:00:45
      315000 -- (-2173.082) (-2170.698) (-2171.464) [-2171.135] * [-2172.758] (-2172.803) (-2171.024) (-2174.093) -- 0:00:45

      Average standard deviation of split frequencies: 0.009614

      315500 -- (-2175.929) (-2170.754) (-2171.422) [-2171.460] * (-2176.644) [-2173.423] (-2171.495) (-2172.559) -- 0:00:45
      316000 -- (-2174.049) [-2172.546] (-2174.144) (-2171.472) * (-2173.852) (-2174.917) (-2171.976) [-2171.964] -- 0:00:47
      316500 -- (-2173.348) (-2174.120) [-2172.136] (-2173.684) * (-2172.635) (-2175.260) (-2174.678) [-2171.827] -- 0:00:47
      317000 -- [-2172.494] (-2171.250) (-2173.267) (-2173.618) * (-2171.824) (-2175.273) [-2171.113] (-2174.024) -- 0:00:47
      317500 -- (-2172.851) (-2170.837) (-2171.315) [-2172.710] * (-2171.817) (-2174.724) [-2171.106] (-2172.803) -- 0:00:47
      318000 -- (-2180.081) (-2171.033) [-2171.238] (-2171.259) * [-2171.046] (-2174.367) (-2172.176) (-2170.825) -- 0:00:47
      318500 -- (-2172.733) (-2171.432) [-2172.867] (-2178.770) * [-2170.885] (-2171.391) (-2171.840) (-2173.120) -- 0:00:47
      319000 -- (-2171.981) (-2171.384) (-2172.734) [-2172.235] * [-2173.778] (-2173.973) (-2171.167) (-2171.572) -- 0:00:46
      319500 -- [-2171.753] (-2173.153) (-2172.663) (-2171.526) * (-2173.066) (-2174.295) [-2172.299] (-2172.045) -- 0:00:46
      320000 -- (-2173.681) [-2171.374] (-2171.160) (-2174.870) * (-2171.573) (-2172.683) [-2171.326] (-2173.097) -- 0:00:46

      Average standard deviation of split frequencies: 0.011679

      320500 -- [-2178.921] (-2171.038) (-2173.150) (-2172.904) * (-2175.037) [-2172.803] (-2171.339) (-2175.916) -- 0:00:46
      321000 -- (-2174.617) (-2171.864) (-2172.955) [-2172.948] * (-2170.894) [-2172.804] (-2171.134) (-2173.388) -- 0:00:46
      321500 -- (-2179.212) (-2171.064) [-2172.955] (-2172.905) * (-2173.559) (-2173.647) [-2173.541] (-2175.980) -- 0:00:46
      322000 -- (-2177.695) (-2171.702) [-2171.652] (-2171.879) * (-2173.387) (-2171.861) (-2171.338) [-2171.982] -- 0:00:46
      322500 -- (-2176.571) [-2171.709] (-2174.611) (-2171.975) * (-2172.900) (-2171.169) [-2171.424] (-2171.855) -- 0:00:46
      323000 -- (-2175.023) (-2171.459) (-2174.855) [-2171.605] * (-2172.668) [-2171.173] (-2172.642) (-2175.202) -- 0:00:46
      323500 -- (-2173.276) [-2171.642] (-2172.516) (-2173.376) * (-2175.682) (-2176.673) [-2172.289] (-2174.551) -- 0:00:46
      324000 -- (-2175.025) [-2171.960] (-2174.136) (-2173.090) * [-2176.498] (-2173.375) (-2171.435) (-2176.766) -- 0:00:45
      324500 -- (-2173.306) [-2172.178] (-2171.753) (-2171.272) * (-2172.950) [-2170.551] (-2171.435) (-2176.400) -- 0:00:45
      325000 -- (-2177.022) (-2176.344) (-2172.174) [-2172.767] * (-2173.837) (-2171.348) (-2170.905) [-2172.468] -- 0:00:45

      Average standard deviation of split frequencies: 0.011890

      325500 -- (-2174.227) [-2173.337] (-2174.830) (-2174.556) * (-2176.905) (-2171.515) (-2170.988) [-2173.305] -- 0:00:45
      326000 -- (-2173.581) [-2172.085] (-2173.375) (-2172.967) * [-2175.588] (-2172.793) (-2170.774) (-2171.648) -- 0:00:45
      326500 -- (-2178.160) (-2172.597) [-2172.331] (-2172.943) * (-2171.765) (-2172.769) [-2173.115] (-2171.851) -- 0:00:45
      327000 -- [-2173.630] (-2172.570) (-2171.107) (-2172.017) * (-2173.296) (-2173.783) [-2172.977] (-2171.478) -- 0:00:45
      327500 -- (-2170.773) [-2174.384] (-2170.812) (-2173.750) * (-2173.669) [-2175.571] (-2174.368) (-2171.978) -- 0:00:45
      328000 -- (-2172.018) [-2171.164] (-2170.800) (-2174.633) * (-2173.360) (-2173.087) [-2171.983] (-2172.834) -- 0:00:45
      328500 -- (-2172.238) [-2171.379] (-2174.077) (-2172.583) * (-2174.518) (-2173.453) (-2175.651) [-2172.798] -- 0:00:44
      329000 -- (-2172.209) (-2170.946) (-2172.707) [-2172.685] * (-2173.162) [-2174.343] (-2179.758) (-2172.209) -- 0:00:44
      329500 -- [-2173.622] (-2171.105) (-2175.437) (-2176.308) * (-2171.743) (-2174.692) (-2174.016) [-2171.489] -- 0:00:44
      330000 -- (-2172.737) (-2172.294) (-2175.400) [-2171.481] * (-2171.790) (-2172.556) (-2174.709) [-2171.691] -- 0:00:44

      Average standard deviation of split frequencies: 0.012831

      330500 -- [-2173.183] (-2173.812) (-2173.772) (-2173.998) * (-2173.332) [-2171.760] (-2173.448) (-2172.001) -- 0:00:44
      331000 -- (-2174.687) (-2175.825) (-2173.218) [-2173.067] * [-2173.004] (-2172.454) (-2174.789) (-2170.968) -- 0:00:46
      331500 -- [-2173.918] (-2171.864) (-2172.048) (-2171.859) * (-2172.493) (-2170.825) [-2173.102] (-2178.059) -- 0:00:46
      332000 -- (-2174.865) (-2172.166) (-2174.655) [-2173.343] * (-2176.221) (-2172.704) [-2173.906] (-2174.026) -- 0:00:46
      332500 -- (-2172.739) [-2171.979] (-2172.382) (-2172.039) * (-2175.241) (-2171.999) [-2173.795] (-2172.962) -- 0:00:46
      333000 -- (-2172.480) (-2171.875) (-2171.339) [-2171.951] * (-2171.745) [-2171.681] (-2177.968) (-2173.255) -- 0:00:46
      333500 -- (-2172.828) (-2171.454) (-2172.700) [-2173.733] * (-2171.644) (-2174.057) (-2173.545) [-2173.006] -- 0:00:45
      334000 -- (-2173.198) (-2172.391) [-2174.042] (-2170.776) * (-2174.528) (-2175.414) (-2174.736) [-2177.660] -- 0:00:45
      334500 -- [-2172.934] (-2172.778) (-2171.850) (-2170.726) * (-2175.409) (-2172.528) [-2171.978] (-2171.763) -- 0:00:45
      335000 -- (-2173.521) [-2172.297] (-2176.933) (-2172.706) * (-2173.511) [-2171.666] (-2171.695) (-2172.352) -- 0:00:45

      Average standard deviation of split frequencies: 0.012861

      335500 -- (-2174.981) (-2174.243) (-2175.828) [-2178.299] * (-2171.669) (-2171.705) [-2172.714] (-2174.614) -- 0:00:45
      336000 -- (-2173.211) (-2171.482) [-2173.405] (-2172.868) * (-2172.640) (-2170.784) [-2171.316] (-2173.173) -- 0:00:45
      336500 -- (-2173.851) [-2172.506] (-2172.261) (-2171.243) * [-2173.638] (-2171.294) (-2174.192) (-2172.050) -- 0:00:45
      337000 -- (-2174.157) [-2171.944] (-2172.002) (-2171.973) * (-2172.065) (-2172.095) [-2171.268] (-2171.464) -- 0:00:45
      337500 -- (-2175.052) [-2172.958] (-2172.002) (-2172.297) * (-2172.371) (-2175.432) (-2173.238) [-2172.313] -- 0:00:45
      338000 -- [-2174.121] (-2172.622) (-2172.589) (-2173.217) * (-2171.148) (-2176.160) [-2174.198] (-2173.310) -- 0:00:45
      338500 -- (-2171.996) (-2172.152) (-2172.739) [-2173.085] * (-2174.038) (-2177.382) [-2172.960] (-2172.951) -- 0:00:44
      339000 -- (-2171.600) (-2