--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:29:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ppa/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -666.48 -670.78
2 -666.48 -669.43
--------------------------------------
TOTAL -666.48 -670.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893076 0.090201 0.360688 1.484300 0.857595 1390.00 1445.50 1.000
r(A<->C){all} 0.172310 0.021252 0.000030 0.450354 0.133667 178.07 192.72 1.000
r(A<->G){all} 0.164851 0.020004 0.000001 0.446193 0.128212 222.25 245.99 1.002
r(A<->T){all} 0.164458 0.019678 0.000025 0.454331 0.128378 164.13 229.63 1.002
r(C<->G){all} 0.153685 0.018378 0.000039 0.426975 0.112998 175.14 206.47 1.001
r(C<->T){all} 0.180581 0.022216 0.000277 0.477929 0.142316 148.39 184.00 1.000
r(G<->T){all} 0.164115 0.019287 0.000087 0.447880 0.130005 246.55 275.17 1.001
pi(A){all} 0.237863 0.000375 0.203084 0.277861 0.237006 1127.71 1202.95 1.000
pi(C){all} 0.277893 0.000410 0.239660 0.318723 0.277397 1307.72 1345.15 1.000
pi(G){all} 0.304589 0.000417 0.263593 0.343243 0.304098 1135.53 1204.52 1.000
pi(T){all} 0.179655 0.000290 0.147103 0.213032 0.179272 1290.70 1291.50 1.002
alpha{1,2} 0.421126 0.232270 0.000225 1.365362 0.245181 1002.15 1130.45 1.001
alpha{3} 0.460984 0.252527 0.000136 1.474337 0.291706 990.37 1166.63 1.004
pinvar{all} 0.996763 0.000016 0.989143 0.999998 0.998057 1220.56 1360.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -624.451549
Model 2: PositiveSelection -624.451823
Model 0: one-ratio -624.451924
Model 7: beta -624.451549
Model 8: beta&w>1 -624.451686
Model 0 vs 1 7.499999999254214E-4
Model 2 vs 1 5.479999999806751E-4
Model 8 vs 7 2.7399999999033753E-4
>C1
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C2
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C3
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C4
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C5
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C6
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=162
C1 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C2 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C3 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C4 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C5 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C6 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
**************************************************
C1 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C2 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C3 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C4 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C5 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C6 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
**************************************************
C1 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C2 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C3 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C4 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C5 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C6 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
**************************************************
C1 QRSVERFKAGGH
C2 QRSVERFKAGGH
C3 QRSVERFKAGGH
C4 QRSVERFKAGGH
C5 QRSVERFKAGGH
C6 QRSVERFKAGGH
************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 162 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 162 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4860]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4860]--->[4860]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.470 Mb, Max= 30.698 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C2 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C3 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C4 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C5 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
C6 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
**************************************************
C1 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C2 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C3 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C4 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C5 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
C6 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
**************************************************
C1 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C2 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C3 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C4 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C5 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
C6 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
**************************************************
C1 QRSVERFKAGGH
C2 QRSVERFKAGGH
C3 QRSVERFKAGGH
C4 QRSVERFKAGGH
C5 QRSVERFKAGGH
C6 QRSVERFKAGGH
************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
C2 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
C3 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
C4 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
C5 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
C6 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
**************************************************
C1 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
C2 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
C3 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
C4 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
C5 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
C6 CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
**************************************************
C1 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
C2 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
C3 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
C4 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
C5 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
C6 CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
**************************************************
C1 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
C2 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
C3 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
C4 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
C5 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
C6 GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
**************************************************
C1 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
C2 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
C3 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
C4 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
C5 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
C6 CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
**************************************************
C1 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
C2 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
C3 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
C4 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
C5 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
C6 ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
**************************************************
C1 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
C2 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
C3 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
C4 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
C5 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
C6 CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
**************************************************
C1 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
C2 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
C3 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
C4 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
C5 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
C6 CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
**************************************************
C1 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
C2 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
C3 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
C4 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
C5 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
C6 TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
**************************************************
C1 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
C2 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
C3 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
C4 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
C5 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
C6 CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
************************************
>C1
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C2
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C3
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C4
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C5
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C6
GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA
CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA
CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC
GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT
CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG
ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC
CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA
CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT
TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG
CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>C1
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C2
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C3
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C4
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C5
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
>C6
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
QRSVERFKAGGH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 486 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579786104
Setting output file names to "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 54724013
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9810399245
Seed = 1937429800
Swapseed = 1579786104
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1087.691239 -- -24.965149
Chain 2 -- -1087.691301 -- -24.965149
Chain 3 -- -1087.691301 -- -24.965149
Chain 4 -- -1087.691301 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1087.691239 -- -24.965149
Chain 2 -- -1087.691135 -- -24.965149
Chain 3 -- -1087.691239 -- -24.965149
Chain 4 -- -1087.691301 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1087.691] (-1087.691) (-1087.691) (-1087.691) * [-1087.691] (-1087.691) (-1087.691) (-1087.691)
500 -- (-681.324) [-681.292] (-671.503) (-672.077) * (-673.657) (-690.257) [-678.116] (-672.806) -- 0:00:00
1000 -- (-675.503) (-674.507) [-676.375] (-683.501) * (-678.075) (-678.236) [-676.352] (-688.090) -- 0:00:00
1500 -- [-678.382] (-677.222) (-673.452) (-677.425) * (-677.280) [-675.056] (-675.378) (-681.895) -- 0:00:00
2000 -- [-672.228] (-671.429) (-675.100) (-680.774) * (-689.476) (-676.161) [-676.513] (-686.713) -- 0:00:00
2500 -- (-680.433) (-675.950) [-674.151] (-676.010) * [-675.176] (-673.541) (-683.576) (-685.562) -- 0:00:00
3000 -- (-674.297) [-676.581] (-678.272) (-675.855) * (-675.149) [-671.420] (-679.812) (-679.502) -- 0:00:00
3500 -- (-674.732) [-670.796] (-685.680) (-670.966) * (-671.354) (-675.387) (-670.799) [-674.253] -- 0:00:00
4000 -- [-679.957] (-681.096) (-681.143) (-684.752) * (-685.344) (-683.195) (-680.293) [-674.419] -- 0:00:00
4500 -- (-678.031) (-675.222) (-676.976) [-672.308] * (-686.222) (-679.478) [-679.588] (-674.356) -- 0:00:00
5000 -- [-672.582] (-671.453) (-677.203) (-675.258) * (-678.097) [-674.827] (-683.468) (-679.203) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-674.329) (-684.590) (-672.313) [-674.861] * (-680.459) [-674.851] (-675.485) (-679.126) -- 0:00:00
6000 -- (-675.707) (-676.533) [-674.421] (-677.012) * [-674.422] (-669.090) (-677.916) (-670.093) -- 0:00:00
6500 -- (-678.432) (-673.992) [-675.425] (-673.654) * [-681.233] (-676.097) (-675.237) (-685.524) -- 0:00:00
7000 -- [-675.995] (-672.969) (-672.321) (-683.790) * (-671.997) (-673.462) (-677.570) [-675.216] -- 0:00:00
7500 -- [-682.250] (-676.385) (-669.185) (-665.498) * (-681.475) (-674.358) [-675.636] (-680.457) -- 0:00:00
8000 -- [-676.740] (-677.310) (-671.819) (-666.526) * [-672.433] (-683.092) (-676.707) (-671.172) -- 0:00:00
8500 -- (-676.049) [-676.001] (-680.584) (-666.118) * (-681.279) (-676.603) (-675.074) [-673.284] -- 0:00:00
9000 -- [-669.865] (-676.429) (-678.930) (-666.858) * (-675.702) (-674.616) (-685.037) [-681.309] -- 0:00:00
9500 -- (-672.365) (-677.948) (-681.764) [-668.263] * (-672.932) [-679.640] (-676.465) (-684.264) -- 0:00:00
10000 -- [-674.438] (-675.958) (-677.949) (-668.048) * [-679.222] (-679.800) (-675.308) (-686.365) -- 0:00:00
Average standard deviation of split frequencies: 0.079970
10500 -- (-679.257) [-672.693] (-682.012) (-667.627) * (-676.480) (-678.930) (-686.126) [-671.287] -- 0:00:00
11000 -- (-675.151) [-676.968] (-677.058) (-668.757) * (-685.984) (-673.850) [-665.441] (-665.762) -- 0:00:00
11500 -- (-674.040) (-681.343) [-679.447] (-668.129) * [-681.708] (-674.249) (-669.686) (-666.096) -- 0:00:00
12000 -- [-686.768] (-675.921) (-677.384) (-669.394) * (-677.655) (-674.145) (-670.839) [-665.437] -- 0:00:00
12500 -- (-684.789) [-674.048] (-674.623) (-668.119) * [-671.970] (-675.628) (-666.775) (-666.502) -- 0:00:00
13000 -- [-674.262] (-678.258) (-667.958) (-668.196) * (-672.338) [-674.773] (-666.902) (-669.213) -- 0:01:15
13500 -- (-685.233) [-674.761] (-666.790) (-668.753) * [-665.837] (-680.402) (-667.163) (-668.654) -- 0:01:13
14000 -- (-682.128) [-678.979] (-666.345) (-670.744) * (-669.479) (-671.727) (-666.675) [-668.217] -- 0:01:10
14500 -- (-673.021) (-678.478) [-671.423] (-667.582) * (-665.539) [-679.116] (-666.324) (-667.097) -- 0:01:07
15000 -- (-678.049) (-677.829) (-667.406) [-665.445] * (-667.644) (-680.231) [-664.978] (-668.263) -- 0:01:05
Average standard deviation of split frequencies: 0.044970
15500 -- (-674.127) (-684.069) (-667.205) [-666.631] * (-667.487) (-680.765) (-666.656) [-666.156] -- 0:01:03
16000 -- (-680.061) (-671.829) [-665.565] (-668.785) * (-667.848) [-674.472] (-668.624) (-666.171) -- 0:01:01
16500 -- (-673.422) (-679.558) (-667.399) [-665.883] * [-667.100] (-681.453) (-667.343) (-670.284) -- 0:00:59
17000 -- (-676.570) (-679.670) (-668.093) [-666.563] * [-666.046] (-668.990) (-665.457) (-671.406) -- 0:00:57
17500 -- (-679.729) (-672.522) (-672.953) [-666.215] * [-669.902] (-679.147) (-665.928) (-668.982) -- 0:00:56
18000 -- (-676.578) [-671.103] (-671.767) (-666.891) * [-668.201] (-675.987) (-666.200) (-672.932) -- 0:00:54
18500 -- [-675.507] (-678.223) (-671.295) (-667.019) * (-669.542) [-672.809] (-666.111) (-666.651) -- 0:00:53
19000 -- [-675.761] (-679.217) (-668.095) (-667.342) * (-666.844) (-682.887) [-665.901] (-666.604) -- 0:00:51
19500 -- (-671.390) (-673.615) [-670.274] (-666.724) * [-665.269] (-675.704) (-665.378) (-668.125) -- 0:00:50
20000 -- (-678.322) (-670.787) (-675.153) [-666.115] * (-669.220) [-673.208] (-666.163) (-666.154) -- 0:00:49
Average standard deviation of split frequencies: 0.047792
20500 -- (-683.278) (-679.767) [-667.447] (-666.255) * (-666.591) (-680.418) (-665.972) [-666.019] -- 0:00:47
21000 -- [-675.653] (-680.782) (-667.989) (-671.139) * (-665.662) (-670.760) (-666.119) [-665.930] -- 0:00:46
21500 -- (-675.833) [-675.201] (-665.725) (-667.796) * (-670.326) [-680.809] (-666.182) (-667.819) -- 0:00:45
22000 -- (-677.507) (-674.135) [-673.399] (-665.758) * (-665.383) (-681.534) (-666.282) [-667.066] -- 0:00:44
22500 -- (-684.459) (-677.637) (-666.022) [-666.205] * (-668.006) (-676.165) (-666.442) [-667.716] -- 0:00:43
23000 -- (-676.078) (-670.889) (-666.491) [-667.716] * (-669.244) (-677.531) (-666.138) [-667.635] -- 0:00:42
23500 -- (-675.857) (-680.034) [-668.735] (-671.770) * (-667.655) [-672.986] (-664.896) (-666.132) -- 0:00:41
24000 -- (-674.020) (-691.394) (-665.314) [-665.944] * (-671.103) (-681.489) (-669.360) [-669.154] -- 0:00:40
24500 -- (-672.279) (-678.848) (-665.857) [-668.575] * [-667.578] (-670.838) (-665.577) (-670.181) -- 0:00:39
25000 -- (-675.687) (-681.621) [-665.678] (-667.808) * [-667.452] (-687.329) (-666.113) (-672.085) -- 0:00:39
Average standard deviation of split frequencies: 0.037017
25500 -- (-677.691) [-683.285] (-665.692) (-666.032) * [-665.358] (-674.467) (-664.842) (-667.294) -- 0:00:38
26000 -- (-683.737) (-672.839) [-666.686] (-665.829) * [-665.289] (-680.011) (-666.265) (-667.017) -- 0:00:37
26500 -- (-682.937) [-674.237] (-665.202) (-666.937) * (-667.993) (-689.893) (-668.041) [-666.966] -- 0:00:36
27000 -- (-672.590) (-677.759) (-669.596) [-666.885] * (-665.679) (-672.035) (-669.691) [-668.259] -- 0:00:36
27500 -- (-676.131) (-680.426) (-665.707) [-666.078] * (-664.808) [-674.313] (-666.653) (-666.972) -- 0:00:35
28000 -- [-679.019] (-686.711) (-667.219) (-668.299) * (-664.904) [-673.296] (-666.729) (-669.534) -- 0:00:34
28500 -- (-681.575) (-678.694) (-667.504) [-668.034] * (-667.247) [-670.264] (-665.097) (-670.397) -- 0:01:08
29000 -- (-673.852) [-674.431] (-670.631) (-666.024) * [-665.933] (-674.362) (-665.362) (-666.393) -- 0:01:06
29500 -- (-672.520) (-673.313) (-669.807) [-666.466] * (-667.482) (-667.041) [-666.763] (-665.832) -- 0:01:05
30000 -- (-680.211) [-680.865] (-667.317) (-671.105) * (-668.235) (-669.757) (-666.680) [-667.088] -- 0:01:04
Average standard deviation of split frequencies: 0.031598
30500 -- [-676.069] (-679.930) (-667.788) (-666.111) * (-667.136) [-667.873] (-666.003) (-666.695) -- 0:01:03
31000 -- (-666.136) [-673.015] (-667.127) (-669.771) * (-665.902) [-666.069] (-669.041) (-666.453) -- 0:01:02
31500 -- [-665.972] (-677.050) (-669.605) (-670.258) * (-665.258) [-665.816] (-667.039) (-666.610) -- 0:01:01
32000 -- [-668.463] (-680.213) (-665.721) (-665.623) * (-667.089) [-667.280] (-666.242) (-669.819) -- 0:01:00
32500 -- (-667.398) [-678.331] (-668.325) (-666.674) * (-666.787) (-670.901) (-665.991) [-669.017] -- 0:00:59
33000 -- (-666.829) [-673.747] (-668.403) (-666.963) * (-665.875) (-669.880) (-667.677) [-671.144] -- 0:00:58
33500 -- (-668.749) [-675.906] (-666.041) (-669.881) * (-666.416) [-667.218] (-668.282) (-668.711) -- 0:00:57
34000 -- [-666.725] (-677.171) (-667.017) (-672.833) * (-667.811) (-669.081) [-668.916] (-666.857) -- 0:00:56
34500 -- (-666.309) (-673.712) [-668.150] (-667.016) * [-666.824] (-667.238) (-668.022) (-667.266) -- 0:00:55
35000 -- (-670.834) [-674.208] (-667.318) (-667.049) * [-666.654] (-668.953) (-668.949) (-668.631) -- 0:00:55
Average standard deviation of split frequencies: 0.028257
35500 -- [-668.813] (-675.226) (-667.161) (-667.887) * (-666.263) [-667.468] (-672.190) (-665.558) -- 0:00:54
36000 -- [-668.154] (-675.564) (-666.903) (-668.129) * (-669.744) [-666.740] (-669.188) (-670.658) -- 0:00:53
36500 -- (-665.109) (-669.262) (-666.079) [-668.010] * (-670.646) (-668.539) [-667.243] (-666.138) -- 0:00:52
37000 -- (-667.968) (-666.894) [-667.928] (-668.970) * (-666.771) (-665.957) (-671.432) [-667.150] -- 0:00:52
37500 -- (-668.740) (-667.009) [-665.511] (-667.744) * (-666.447) (-668.635) [-668.627] (-666.335) -- 0:00:51
38000 -- [-666.278] (-666.883) (-665.988) (-668.135) * (-668.476) (-667.623) [-667.156] (-666.531) -- 0:00:50
38500 -- (-666.549) [-666.568] (-665.691) (-671.071) * [-666.991] (-665.959) (-666.130) (-665.659) -- 0:00:49
39000 -- (-667.127) [-666.472] (-665.333) (-667.710) * [-666.843] (-666.358) (-668.186) (-666.647) -- 0:00:49
39500 -- [-667.552] (-666.234) (-665.546) (-668.198) * (-665.925) [-666.157] (-665.348) (-665.883) -- 0:00:48
40000 -- (-666.448) (-665.612) [-665.197] (-667.696) * [-668.213] (-665.690) (-668.952) (-666.162) -- 0:00:48
Average standard deviation of split frequencies: 0.031115
40500 -- (-668.664) (-665.165) (-665.454) [-666.318] * [-670.401] (-666.473) (-667.641) (-666.123) -- 0:00:47
41000 -- (-668.573) (-667.693) [-666.124] (-666.791) * (-667.196) [-667.499] (-669.517) (-666.050) -- 0:00:46
41500 -- (-672.058) (-666.442) (-666.318) [-667.310] * (-668.337) (-671.240) (-670.160) [-664.967] -- 0:00:46
42000 -- [-671.561] (-667.162) (-668.477) (-668.288) * (-667.041) (-671.394) (-665.187) [-666.180] -- 0:00:45
42500 -- (-667.006) (-666.994) (-671.156) [-665.843] * (-668.339) (-667.375) [-665.531] (-665.586) -- 0:00:45
43000 -- (-666.779) (-666.092) (-668.168) [-669.261] * (-667.582) [-669.041] (-669.837) (-664.944) -- 0:00:44
43500 -- (-669.850) [-665.650] (-665.911) (-668.751) * (-668.754) [-665.985] (-666.904) (-670.134) -- 0:00:43
44000 -- (-667.637) (-667.307) (-665.740) [-668.490] * (-667.466) (-665.350) (-667.544) [-670.519] -- 0:00:43
44500 -- (-664.928) (-666.029) (-665.326) [-665.282] * (-666.864) (-667.304) [-666.219] (-666.330) -- 0:01:04
45000 -- (-666.240) (-667.078) [-669.624] (-665.634) * (-665.446) (-670.610) (-665.749) [-665.662] -- 0:01:03
Average standard deviation of split frequencies: 0.036893
45500 -- (-665.243) (-668.326) (-671.539) [-667.487] * (-667.724) (-667.548) [-666.900] (-667.897) -- 0:01:02
46000 -- (-666.603) (-667.846) (-668.282) [-666.338] * (-666.335) (-668.721) (-666.271) [-667.253] -- 0:01:02
46500 -- (-666.979) (-667.650) [-666.918] (-665.328) * (-667.039) [-666.907] (-667.556) (-665.983) -- 0:01:01
47000 -- [-666.193] (-667.141) (-666.388) (-666.832) * (-667.421) (-667.739) [-665.125] (-665.834) -- 0:01:00
47500 -- [-666.199] (-670.862) (-666.623) (-666.501) * (-673.798) [-667.048] (-667.862) (-666.904) -- 0:01:00
48000 -- (-665.751) [-671.241] (-666.264) (-666.655) * (-668.751) [-667.223] (-665.315) (-669.501) -- 0:00:59
48500 -- (-665.399) (-666.610) (-668.735) [-667.329] * (-669.519) [-665.458] (-665.135) (-668.319) -- 0:00:58
49000 -- (-666.024) (-668.922) (-666.986) [-670.570] * (-668.114) [-665.742] (-669.091) (-668.452) -- 0:00:58
49500 -- (-668.546) (-668.517) (-667.133) [-670.247] * (-668.047) [-669.806] (-671.424) (-668.217) -- 0:00:57
50000 -- [-666.572] (-667.863) (-669.084) (-666.981) * (-666.294) [-668.323] (-666.102) (-666.872) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
50500 -- (-667.560) (-670.754) [-671.499] (-666.493) * [-667.521] (-667.637) (-666.908) (-666.793) -- 0:00:56
51000 -- (-665.647) (-670.897) [-665.624] (-666.090) * (-668.413) (-667.376) [-666.856] (-666.442) -- 0:00:55
51500 -- [-665.630] (-665.554) (-667.968) (-665.685) * (-666.919) (-669.265) [-667.736] (-667.069) -- 0:00:55
52000 -- (-670.813) [-666.350] (-665.707) (-666.123) * (-666.379) [-668.585] (-667.082) (-666.401) -- 0:00:54
52500 -- (-666.439) (-667.032) (-670.067) [-666.110] * (-670.960) (-670.361) (-670.219) [-665.872] -- 0:00:54
53000 -- (-667.967) (-667.266) [-667.697] (-665.942) * [-668.733] (-669.469) (-672.579) (-666.178) -- 0:00:53
53500 -- (-669.964) (-668.895) [-666.229] (-666.729) * (-667.019) (-672.418) (-666.701) [-665.359] -- 0:00:53
54000 -- (-668.346) [-669.745] (-666.721) (-665.778) * (-666.886) [-670.105] (-666.540) (-666.577) -- 0:00:52
54500 -- [-668.403] (-668.457) (-669.849) (-667.237) * (-669.934) (-667.369) (-670.004) [-666.711] -- 0:00:52
55000 -- (-668.703) (-666.702) [-667.449] (-670.884) * (-666.566) (-667.142) [-668.494] (-666.758) -- 0:00:51
Average standard deviation of split frequencies: 0.043493
55500 -- (-666.368) (-665.864) (-668.490) [-667.076] * (-667.533) [-665.832] (-668.201) (-669.142) -- 0:00:51
56000 -- (-665.990) (-665.422) [-667.266] (-667.906) * (-666.064) [-667.241] (-668.097) (-668.973) -- 0:00:50
56500 -- (-671.141) (-666.869) (-670.939) [-665.892] * (-666.465) (-669.138) [-667.688] (-667.981) -- 0:00:50
57000 -- (-670.484) (-666.931) (-669.461) [-665.882] * (-668.726) [-672.874] (-668.768) (-667.320) -- 0:00:49
57500 -- (-666.292) [-668.439] (-665.510) (-667.361) * (-671.573) (-673.925) [-668.119] (-668.147) -- 0:00:49
58000 -- (-666.232) [-666.893] (-670.499) (-667.063) * (-665.593) (-668.858) [-666.324] (-668.258) -- 0:00:48
58500 -- (-668.313) (-665.887) (-665.755) [-667.488] * (-667.312) (-668.125) (-667.105) [-667.550] -- 0:00:48
59000 -- (-673.427) (-667.992) [-666.304] (-671.866) * [-666.720] (-666.296) (-667.373) (-674.918) -- 0:00:47
59500 -- (-667.382) (-669.100) [-667.173] (-668.837) * (-666.570) (-665.890) (-667.801) [-669.625] -- 0:00:47
60000 -- [-666.048] (-669.439) (-667.013) (-667.327) * (-668.837) (-668.876) [-667.501] (-671.685) -- 0:00:47
Average standard deviation of split frequencies: 0.035989
60500 -- [-665.859] (-666.287) (-667.499) (-665.604) * [-664.959] (-669.423) (-672.588) (-666.025) -- 0:01:02
61000 -- (-666.396) (-667.913) (-667.510) [-665.461] * [-666.583] (-667.934) (-666.085) (-665.620) -- 0:01:01
61500 -- [-665.463] (-668.059) (-671.647) (-667.523) * (-667.201) [-669.595] (-668.268) (-666.365) -- 0:01:01
62000 -- (-667.300) [-667.345] (-674.924) (-665.912) * (-668.253) (-668.887) (-667.099) [-670.427] -- 0:01:00
62500 -- (-668.776) [-666.911] (-666.464) (-665.561) * (-666.536) (-668.793) (-670.524) [-666.884] -- 0:01:00
63000 -- (-665.364) (-669.096) (-665.631) [-666.330] * (-666.278) (-669.773) (-669.629) [-667.415] -- 0:00:59
63500 -- (-665.309) (-668.769) [-668.178] (-666.366) * (-667.196) (-665.964) [-667.478] (-670.893) -- 0:00:58
64000 -- (-673.684) (-667.830) [-668.822] (-666.107) * [-666.273] (-667.038) (-665.773) (-667.581) -- 0:00:58
64500 -- (-674.025) (-667.826) (-667.073) [-667.248] * (-666.892) [-667.092] (-669.988) (-668.183) -- 0:00:58
65000 -- (-671.778) (-667.063) (-669.703) [-665.235] * (-672.835) [-668.107] (-667.407) (-668.057) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
65500 -- (-665.515) (-668.852) [-666.776] (-665.791) * (-667.658) [-665.732] (-667.584) (-666.218) -- 0:00:57
66000 -- (-666.703) (-667.331) (-666.420) [-668.277] * (-672.876) (-669.105) [-671.769] (-666.362) -- 0:00:56
66500 -- (-669.546) (-667.436) (-665.943) [-665.818] * [-672.015] (-666.815) (-669.079) (-666.561) -- 0:00:56
67000 -- (-669.641) (-667.629) [-668.139] (-667.332) * (-672.222) (-665.468) (-666.900) [-666.905] -- 0:00:55
67500 -- (-668.267) (-667.549) (-667.398) [-668.264] * (-669.113) (-665.737) [-667.258] (-669.864) -- 0:00:55
68000 -- (-666.381) (-668.771) (-667.961) [-668.423] * (-670.260) (-665.353) [-665.920] (-667.231) -- 0:00:54
68500 -- (-668.051) [-667.609] (-670.365) (-670.032) * (-671.267) [-665.518] (-667.201) (-666.876) -- 0:00:54
69000 -- (-666.415) (-668.576) (-667.123) [-667.486] * (-667.567) (-665.667) [-665.667] (-667.121) -- 0:00:53
69500 -- (-668.405) (-667.346) [-667.029] (-666.603) * (-674.130) (-664.962) [-665.246] (-667.697) -- 0:00:53
70000 -- (-668.026) (-668.820) [-666.638] (-671.260) * [-668.843] (-666.969) (-665.683) (-668.222) -- 0:00:53
Average standard deviation of split frequencies: 0.029492
70500 -- (-668.614) (-665.750) [-668.333] (-667.463) * [-667.792] (-667.322) (-666.458) (-668.006) -- 0:00:52
71000 -- (-666.193) (-666.983) (-666.904) [-667.453] * (-666.066) (-670.562) [-670.256] (-670.947) -- 0:00:52
71500 -- [-667.325] (-665.468) (-665.916) (-667.018) * (-666.770) (-669.486) [-668.589] (-670.211) -- 0:00:51
72000 -- (-667.852) (-666.413) (-668.847) [-669.030] * [-665.746] (-668.973) (-666.110) (-668.668) -- 0:00:51
72500 -- [-667.200] (-666.103) (-666.413) (-671.324) * (-667.507) [-665.660] (-670.044) (-665.717) -- 0:00:51
73000 -- [-666.605] (-665.746) (-671.961) (-668.314) * (-668.852) (-666.750) (-666.448) [-666.953] -- 0:00:50
73500 -- [-665.462] (-669.158) (-666.687) (-669.480) * (-672.239) (-667.855) (-666.277) [-667.467] -- 0:00:50
74000 -- [-666.193] (-669.694) (-666.158) (-667.024) * (-667.980) (-666.920) (-667.393) [-665.272] -- 0:00:50
74500 -- [-668.972] (-667.299) (-665.431) (-667.083) * (-665.969) (-667.088) (-669.087) [-668.746] -- 0:00:49
75000 -- [-666.510] (-678.706) (-665.233) (-666.169) * [-666.007] (-666.020) (-667.037) (-667.038) -- 0:00:49
Average standard deviation of split frequencies: 0.030034
75500 -- (-665.910) (-669.106) [-667.052] (-666.337) * (-669.385) (-665.516) [-666.277] (-667.126) -- 0:00:48
76000 -- (-667.295) [-667.366] (-667.052) (-666.757) * (-666.435) (-668.009) [-668.481] (-666.387) -- 0:00:48
76500 -- (-670.542) [-671.502] (-667.771) (-667.114) * (-667.444) (-667.766) [-675.142] (-666.082) -- 0:00:48
77000 -- (-668.456) [-667.457] (-666.055) (-668.144) * (-669.239) (-667.483) (-671.083) [-667.237] -- 0:00:59
77500 -- (-665.476) (-667.951) (-666.700) [-670.018] * (-670.306) (-666.815) [-672.169] (-667.711) -- 0:00:59
78000 -- (-665.603) (-667.603) (-667.058) [-669.622] * (-664.959) [-665.588] (-667.098) (-665.364) -- 0:00:59
78500 -- (-666.485) (-668.180) (-667.617) [-670.702] * (-671.543) (-664.975) (-665.675) [-666.927] -- 0:00:58
79000 -- (-666.845) [-665.217] (-669.091) (-665.993) * (-665.152) (-665.311) [-668.100] (-668.923) -- 0:00:58
79500 -- (-671.230) (-667.491) [-668.325] (-668.351) * [-665.533] (-665.352) (-671.131) (-666.994) -- 0:00:57
80000 -- (-669.849) [-667.198] (-669.163) (-665.311) * (-665.874) [-666.162] (-667.781) (-669.112) -- 0:00:57
Average standard deviation of split frequencies: 0.029544
80500 -- [-667.741] (-665.919) (-669.902) (-666.099) * (-665.446) (-669.370) (-667.907) [-668.986] -- 0:00:57
81000 -- [-667.162] (-669.199) (-669.582) (-671.993) * (-666.791) (-666.555) [-670.921] (-668.938) -- 0:00:56
81500 -- [-666.248] (-669.056) (-668.196) (-672.264) * [-667.199] (-668.410) (-669.360) (-666.459) -- 0:00:56
82000 -- [-665.941] (-666.990) (-668.940) (-666.524) * (-668.941) [-669.769] (-668.309) (-665.751) -- 0:00:55
82500 -- (-667.202) (-666.233) (-665.533) [-666.851] * (-666.990) [-666.766] (-667.997) (-670.154) -- 0:00:55
83000 -- (-667.931) [-665.317] (-666.111) (-668.505) * (-672.140) (-668.649) (-665.044) [-666.739] -- 0:00:55
83500 -- (-667.786) [-669.909] (-666.262) (-666.410) * [-665.947] (-668.873) (-665.154) (-667.033) -- 0:00:54
84000 -- [-665.420] (-666.295) (-667.080) (-667.101) * (-668.277) (-670.787) (-666.615) [-668.309] -- 0:00:54
84500 -- (-666.030) [-670.512] (-666.603) (-669.961) * (-667.239) [-667.225] (-666.979) (-668.524) -- 0:00:54
85000 -- (-666.031) (-667.218) (-668.558) [-667.747] * [-667.685] (-669.215) (-671.012) (-667.460) -- 0:00:53
Average standard deviation of split frequencies: 0.031062
85500 -- [-666.615] (-670.836) (-667.021) (-668.755) * (-670.210) [-670.715] (-669.970) (-665.587) -- 0:00:53
86000 -- (-668.839) [-668.852] (-667.946) (-666.651) * (-668.096) (-668.239) (-668.376) [-665.506] -- 0:00:53
86500 -- [-667.165] (-671.804) (-665.417) (-667.024) * [-670.906] (-668.872) (-667.455) (-666.996) -- 0:00:52
87000 -- (-665.770) [-665.599] (-665.839) (-667.040) * (-667.451) (-668.397) (-665.756) [-667.141] -- 0:00:52
87500 -- (-669.034) (-668.854) (-667.078) [-666.467] * (-668.115) (-666.792) [-666.305] (-670.098) -- 0:00:52
88000 -- [-666.956] (-669.806) (-666.035) (-666.038) * (-671.766) [-667.640] (-673.842) (-670.643) -- 0:00:51
88500 -- (-668.138) (-666.721) (-665.448) [-666.598] * (-668.023) [-667.826] (-673.425) (-669.363) -- 0:00:51
89000 -- [-666.241] (-666.151) (-667.148) (-671.347) * (-667.343) [-666.787] (-667.599) (-667.285) -- 0:00:51
89500 -- (-668.441) (-666.526) [-668.411] (-669.359) * [-667.350] (-668.307) (-666.491) (-669.433) -- 0:00:50
90000 -- [-665.633] (-666.161) (-666.286) (-667.783) * (-666.967) [-669.312] (-666.723) (-671.436) -- 0:00:50
Average standard deviation of split frequencies: 0.030040
90500 -- (-667.678) (-666.167) (-665.617) [-667.103] * (-665.952) (-667.812) [-665.645] (-671.662) -- 0:00:50
91000 -- [-667.873] (-665.604) (-667.814) (-666.507) * (-666.706) (-667.593) [-666.377] (-665.667) -- 0:00:49
91500 -- (-669.911) [-667.232] (-668.971) (-673.376) * [-670.191] (-666.231) (-665.935) (-665.421) -- 0:00:49
92000 -- (-669.087) (-671.913) [-670.569] (-666.574) * (-674.274) [-666.823] (-666.590) (-669.162) -- 0:00:49
92500 -- (-667.764) [-667.319] (-670.185) (-667.423) * [-667.714] (-670.519) (-672.257) (-671.359) -- 0:00:49
93000 -- [-666.625] (-672.790) (-666.155) (-666.205) * (-665.047) (-673.127) [-667.032] (-665.526) -- 0:00:48
93500 -- (-666.065) (-669.326) (-666.170) [-666.054] * (-668.324) (-667.990) (-666.387) [-668.472] -- 0:00:48
94000 -- [-665.086] (-667.385) (-665.772) (-666.906) * (-671.227) [-667.334] (-665.880) (-666.630) -- 0:00:57
94500 -- (-666.729) [-667.495] (-665.884) (-667.066) * (-667.733) (-666.769) (-666.656) [-667.561] -- 0:00:57
95000 -- [-670.023] (-667.735) (-665.333) (-671.303) * (-670.731) [-666.137] (-666.826) (-666.789) -- 0:00:57
Average standard deviation of split frequencies: 0.034100
95500 -- [-671.817] (-669.863) (-666.729) (-666.354) * (-667.924) (-667.839) (-665.767) [-666.015] -- 0:00:56
96000 -- [-666.989] (-666.843) (-672.404) (-667.721) * (-671.922) (-665.984) (-668.165) [-665.785] -- 0:00:56
96500 -- (-666.769) (-665.571) [-668.608] (-669.774) * [-665.259] (-669.780) (-667.498) (-666.594) -- 0:00:56
97000 -- [-668.839] (-665.820) (-669.801) (-665.795) * (-667.066) [-668.034] (-668.288) (-669.785) -- 0:00:55
97500 -- (-668.459) [-666.455] (-669.545) (-666.601) * (-671.422) [-667.802] (-665.779) (-668.254) -- 0:00:55
98000 -- (-667.523) (-665.881) [-666.931] (-667.348) * (-671.272) [-667.036] (-667.792) (-665.626) -- 0:00:55
98500 -- (-674.790) (-665.214) (-666.441) [-669.299] * (-668.346) [-666.462] (-666.706) (-668.844) -- 0:00:54
99000 -- (-669.008) (-666.846) (-666.750) [-669.243] * (-665.880) [-667.451] (-666.741) (-666.688) -- 0:00:54
99500 -- (-667.216) [-669.435] (-666.861) (-670.479) * (-666.353) [-667.765] (-665.759) (-666.218) -- 0:00:54
100000 -- (-669.357) (-670.076) (-671.797) [-667.032] * (-665.574) (-668.927) (-665.735) [-668.044] -- 0:00:54
Average standard deviation of split frequencies: 0.033820
100500 -- (-667.578) (-665.278) (-666.320) [-665.739] * [-668.256] (-666.641) (-667.617) (-668.047) -- 0:00:53
101000 -- (-671.152) (-665.451) [-666.234] (-666.363) * (-666.833) (-666.610) (-670.465) [-667.378] -- 0:00:53
101500 -- (-666.155) (-666.208) (-668.548) [-665.793] * (-665.544) (-667.511) (-671.876) [-665.798] -- 0:00:53
102000 -- (-666.441) (-666.286) [-666.854] (-666.166) * (-665.235) (-666.963) (-675.109) [-666.456] -- 0:00:52
102500 -- (-666.102) (-665.610) (-670.174) [-665.387] * [-669.105] (-671.917) (-668.609) (-668.964) -- 0:00:52
103000 -- (-666.754) [-667.956] (-667.234) (-665.606) * (-669.141) (-669.861) (-666.256) [-666.616] -- 0:00:52
103500 -- (-670.549) (-668.999) [-666.031] (-665.658) * (-674.451) (-669.867) (-670.443) [-665.685] -- 0:00:51
104000 -- (-668.463) (-670.106) (-667.720) [-665.657] * (-668.183) (-666.448) [-668.715] (-665.243) -- 0:00:51
104500 -- [-665.998] (-673.422) (-666.635) (-666.405) * (-667.376) [-667.755] (-667.066) (-666.290) -- 0:00:51
105000 -- [-666.434] (-668.104) (-666.307) (-666.587) * (-665.939) (-667.181) (-666.248) [-665.138] -- 0:00:51
Average standard deviation of split frequencies: 0.031872
105500 -- (-667.613) [-669.246] (-664.874) (-670.521) * [-666.293] (-667.651) (-665.329) (-667.971) -- 0:00:50
106000 -- (-667.336) [-665.513] (-667.626) (-666.408) * [-667.020] (-666.642) (-666.887) (-669.870) -- 0:00:50
106500 -- [-667.063] (-667.262) (-667.141) (-667.585) * (-665.635) (-666.494) (-665.880) [-666.065] -- 0:00:50
107000 -- (-668.499) [-665.895] (-667.353) (-665.674) * (-668.887) [-668.128] (-666.621) (-671.433) -- 0:00:50
107500 -- (-664.847) [-667.023] (-667.249) (-666.633) * (-666.523) (-671.137) (-667.560) [-666.864] -- 0:00:49
108000 -- [-664.847] (-666.378) (-669.568) (-666.527) * (-665.437) [-668.096] (-666.433) (-668.573) -- 0:00:49
108500 -- (-664.843) [-665.598] (-668.721) (-666.867) * (-665.704) (-666.834) [-666.012] (-672.808) -- 0:00:49
109000 -- [-667.257] (-665.475) (-667.828) (-666.369) * [-665.765] (-667.735) (-668.233) (-672.565) -- 0:00:49
109500 -- (-667.529) (-668.773) [-666.338] (-666.444) * (-670.706) [-665.252] (-665.945) (-666.262) -- 0:00:48
110000 -- (-675.376) (-667.786) (-666.759) [-669.421] * (-665.600) (-665.796) [-665.396] (-666.467) -- 0:00:48
Average standard deviation of split frequencies: 0.030764
110500 -- (-667.506) (-668.559) (-669.775) [-671.814] * (-669.739) (-666.799) (-664.957) [-668.469] -- 0:00:56
111000 -- (-667.029) [-668.381] (-672.632) (-666.090) * (-667.668) (-665.272) [-666.000] (-666.844) -- 0:00:56
111500 -- (-666.871) [-667.094] (-667.821) (-670.981) * [-668.270] (-665.453) (-666.399) (-670.796) -- 0:00:55
112000 -- [-668.071] (-665.346) (-666.106) (-668.281) * (-670.543) [-666.845] (-668.225) (-670.330) -- 0:00:55
112500 -- (-667.101) (-668.923) [-669.013] (-669.751) * [-666.534] (-669.038) (-669.288) (-667.224) -- 0:00:55
113000 -- [-666.624] (-665.754) (-670.456) (-667.612) * [-666.211] (-668.483) (-666.417) (-669.006) -- 0:00:54
113500 -- (-670.524) (-665.405) [-666.364] (-666.821) * (-667.594) [-666.546] (-667.314) (-669.682) -- 0:00:54
114000 -- (-665.652) (-666.851) [-672.690] (-666.026) * (-667.799) (-669.267) [-666.416] (-668.265) -- 0:00:54
114500 -- [-667.083] (-665.369) (-668.667) (-668.424) * (-665.791) (-666.397) [-667.446] (-667.880) -- 0:00:54
115000 -- (-669.385) [-666.425] (-667.374) (-665.968) * (-666.855) [-665.517] (-666.259) (-666.261) -- 0:00:53
Average standard deviation of split frequencies: 0.029350
115500 -- [-671.091] (-667.188) (-666.618) (-667.009) * (-665.708) [-665.567] (-665.427) (-667.862) -- 0:00:53
116000 -- (-668.461) (-671.806) [-665.627] (-667.272) * (-666.161) (-665.931) [-667.592] (-666.554) -- 0:00:53
116500 -- (-667.984) (-667.637) (-666.427) [-666.422] * (-667.137) (-666.083) [-667.528] (-669.162) -- 0:00:53
117000 -- (-666.361) (-672.136) (-668.228) [-667.215] * (-667.743) [-666.848] (-666.481) (-672.069) -- 0:00:52
117500 -- (-666.810) (-676.970) (-665.313) [-666.643] * (-668.656) (-668.954) [-665.495] (-674.943) -- 0:00:52
118000 -- (-666.956) (-671.833) [-665.230] (-668.334) * (-667.132) [-666.408] (-667.657) (-672.267) -- 0:00:52
118500 -- (-670.313) (-669.736) [-665.368] (-675.710) * (-666.508) (-665.918) (-666.611) [-668.556] -- 0:00:52
119000 -- (-668.033) [-666.141] (-668.943) (-675.366) * [-665.327] (-672.359) (-667.049) (-668.069) -- 0:00:51
119500 -- [-665.587] (-666.583) (-666.185) (-669.807) * (-669.416) [-666.110] (-671.695) (-669.634) -- 0:00:51
120000 -- (-667.102) (-669.212) [-666.186] (-669.186) * (-665.569) (-666.165) (-668.965) [-668.017] -- 0:00:51
Average standard deviation of split frequencies: 0.027758
120500 -- (-665.783) (-669.223) [-665.325] (-668.819) * (-667.734) (-665.632) [-666.605] (-668.327) -- 0:00:51
121000 -- (-668.882) (-669.789) (-667.719) [-668.166] * (-666.822) (-670.857) [-667.721] (-667.254) -- 0:00:50
121500 -- (-668.934) (-668.122) [-665.919] (-666.553) * (-667.016) [-666.857] (-666.102) (-666.737) -- 0:00:50
122000 -- (-667.699) (-669.093) [-665.108] (-667.727) * (-666.702) (-667.045) [-665.991] (-667.665) -- 0:00:50
122500 -- (-667.013) (-668.278) (-669.001) [-666.491] * (-667.473) (-667.090) [-666.503] (-667.703) -- 0:00:50
123000 -- [-666.767] (-666.512) (-668.299) (-667.199) * [-667.843] (-669.607) (-667.349) (-668.189) -- 0:00:49
123500 -- (-667.555) [-665.481] (-665.560) (-669.001) * (-666.279) [-666.431] (-667.255) (-668.759) -- 0:00:49
124000 -- [-667.214] (-667.458) (-668.737) (-667.809) * (-667.654) [-667.253] (-665.317) (-668.909) -- 0:00:49
124500 -- [-667.088] (-665.672) (-669.409) (-667.044) * (-665.419) (-669.901) (-665.425) [-669.056] -- 0:00:49
125000 -- (-665.614) (-669.959) (-670.463) [-667.897] * (-673.377) [-665.374] (-665.716) (-668.888) -- 0:00:49
Average standard deviation of split frequencies: 0.026780
125500 -- (-666.111) (-665.384) (-668.451) [-666.129] * [-667.434] (-666.441) (-665.540) (-667.824) -- 0:00:48
126000 -- [-668.433] (-665.766) (-671.453) (-670.172) * (-667.635) [-667.297] (-667.832) (-667.455) -- 0:00:48
126500 -- (-667.336) (-667.411) (-669.743) [-668.411] * (-665.960) [-667.210] (-669.444) (-669.267) -- 0:00:48
127000 -- (-668.339) (-672.229) (-668.113) [-665.948] * [-667.198] (-668.375) (-674.715) (-669.060) -- 0:00:54
127500 -- (-669.146) (-668.494) (-671.769) [-669.884] * (-668.022) (-669.189) [-669.011] (-669.806) -- 0:00:54
128000 -- (-666.448) (-669.537) [-668.046] (-670.587) * (-669.404) (-668.209) (-670.987) [-670.037] -- 0:00:54
128500 -- [-670.510] (-671.887) (-669.516) (-666.470) * (-668.538) [-665.238] (-665.618) (-666.047) -- 0:00:54
129000 -- (-667.226) (-667.379) [-669.230] (-665.338) * (-669.226) (-672.447) (-666.791) [-666.545] -- 0:00:54
129500 -- (-665.942) (-667.712) (-665.879) [-665.527] * (-668.463) [-668.079] (-665.232) (-667.611) -- 0:00:53
130000 -- (-666.501) [-667.195] (-666.733) (-668.370) * (-667.872) [-667.670] (-669.440) (-669.653) -- 0:00:53
Average standard deviation of split frequencies: 0.027722
130500 -- [-667.323] (-667.643) (-667.806) (-672.390) * [-665.916] (-668.054) (-667.888) (-671.069) -- 0:00:53
131000 -- [-665.472] (-667.002) (-669.142) (-669.532) * (-666.671) [-666.500] (-668.354) (-671.566) -- 0:00:53
131500 -- [-665.089] (-669.967) (-668.519) (-666.742) * (-667.134) (-666.533) (-671.796) [-666.700] -- 0:00:52
132000 -- (-669.034) (-666.999) (-668.241) [-667.000] * [-666.178] (-666.184) (-666.048) (-674.490) -- 0:00:52
132500 -- (-670.085) [-667.342] (-668.847) (-667.159) * (-670.206) (-666.528) [-669.342] (-667.528) -- 0:00:52
133000 -- (-670.843) [-666.510] (-669.109) (-670.301) * (-670.042) (-668.624) (-669.851) [-666.277] -- 0:00:52
133500 -- (-668.905) (-667.565) [-666.211] (-668.310) * (-667.653) [-666.881] (-666.120) (-666.020) -- 0:00:51
134000 -- [-667.414] (-670.355) (-667.585) (-666.375) * [-667.103] (-665.951) (-669.473) (-666.078) -- 0:00:51
134500 -- (-666.374) (-669.294) (-668.586) [-670.263] * (-666.768) (-667.334) (-667.011) [-666.992] -- 0:00:51
135000 -- (-666.288) (-669.170) (-671.724) [-665.552] * (-669.688) (-672.232) [-667.494] (-666.248) -- 0:00:51
Average standard deviation of split frequencies: 0.026517
135500 -- (-667.296) [-667.672] (-672.239) (-665.323) * (-666.930) [-668.196] (-667.525) (-667.016) -- 0:00:51
136000 -- (-666.632) (-667.045) (-668.005) [-667.527] * [-668.805] (-667.475) (-666.072) (-667.323) -- 0:00:50
136500 -- (-670.136) (-666.039) [-666.496] (-666.828) * (-665.741) [-666.110] (-666.835) (-665.351) -- 0:00:50
137000 -- (-671.230) [-666.489] (-666.700) (-666.108) * (-666.943) (-666.156) [-669.261] (-666.439) -- 0:00:50
137500 -- (-668.604) [-665.838] (-667.775) (-667.642) * (-668.169) (-672.448) [-668.534] (-668.503) -- 0:00:50
138000 -- (-666.558) (-668.067) [-665.827] (-669.122) * (-670.617) [-665.526] (-667.025) (-667.254) -- 0:00:49
138500 -- [-666.351] (-667.097) (-667.486) (-669.313) * (-667.783) [-665.899] (-667.919) (-667.457) -- 0:00:49
139000 -- (-667.177) (-665.779) (-669.367) [-670.709] * (-666.689) (-665.341) [-666.959] (-667.818) -- 0:00:49
139500 -- (-666.157) (-665.930) [-665.256] (-669.652) * (-667.493) (-665.766) (-670.061) [-670.101] -- 0:00:49
140000 -- [-666.367] (-670.881) (-665.849) (-665.955) * (-668.467) (-666.063) [-667.006] (-666.802) -- 0:00:49
Average standard deviation of split frequencies: 0.026475
140500 -- (-666.135) (-667.311) [-668.769] (-669.964) * (-665.461) (-665.678) [-667.909] (-666.087) -- 0:00:48
141000 -- [-666.138] (-668.663) (-665.409) (-668.492) * (-666.433) (-666.615) [-666.650] (-666.757) -- 0:00:48
141500 -- (-666.139) (-668.963) [-666.124] (-665.546) * [-668.423] (-666.737) (-669.524) (-665.711) -- 0:00:48
142000 -- [-666.897] (-669.596) (-666.949) (-666.441) * [-668.045] (-667.977) (-672.743) (-672.691) -- 0:00:48
142500 -- [-666.754] (-667.672) (-665.945) (-670.805) * (-667.718) (-668.553) [-666.376] (-666.890) -- 0:00:48
143000 -- [-669.105] (-666.626) (-671.215) (-665.130) * (-665.015) (-667.916) [-666.335] (-666.648) -- 0:00:47
143500 -- (-667.128) (-666.623) (-669.701) [-665.365] * (-668.511) (-668.840) (-666.859) [-667.338] -- 0:00:53
144000 -- [-671.011] (-666.398) (-666.614) (-665.690) * (-668.695) [-666.061] (-666.371) (-669.729) -- 0:00:53
144500 -- [-666.487] (-667.594) (-666.706) (-666.209) * (-666.400) (-665.356) (-667.948) [-665.998] -- 0:00:53
145000 -- (-668.473) (-667.139) [-666.925] (-667.819) * (-667.905) (-665.957) [-671.873] (-669.456) -- 0:00:53
Average standard deviation of split frequencies: 0.026153
145500 -- (-668.765) [-665.242] (-670.451) (-667.605) * (-667.098) (-670.608) (-669.316) [-668.294] -- 0:00:52
146000 -- (-666.425) (-666.594) (-667.305) [-665.746] * (-666.952) (-674.919) (-665.573) [-666.016] -- 0:00:52
146500 -- (-668.272) [-666.652] (-667.739) (-665.704) * (-665.436) (-668.240) [-667.551] (-667.321) -- 0:00:52
147000 -- (-666.748) (-672.819) (-668.401) [-668.664] * (-667.262) [-667.691] (-667.791) (-665.556) -- 0:00:52
147500 -- (-669.667) [-665.950] (-667.544) (-667.226) * [-668.177] (-668.443) (-666.641) (-667.575) -- 0:00:52
148000 -- (-666.668) (-667.623) [-671.628] (-668.739) * (-669.842) [-669.074] (-666.377) (-666.269) -- 0:00:51
148500 -- (-668.113) (-666.428) [-669.514] (-665.561) * (-666.767) (-670.280) [-666.831] (-668.351) -- 0:00:51
149000 -- (-668.946) [-667.177] (-666.695) (-666.554) * (-665.862) (-666.079) (-665.940) [-667.413] -- 0:00:51
149500 -- (-665.936) [-665.616] (-666.544) (-666.660) * (-670.170) (-666.292) [-666.818] (-666.709) -- 0:00:51
150000 -- (-665.594) (-667.352) [-664.926] (-665.645) * [-671.965] (-667.923) (-666.922) (-666.440) -- 0:00:51
Average standard deviation of split frequencies: 0.025187
150500 -- (-666.206) (-669.247) [-667.693] (-670.033) * (-674.212) [-668.980] (-672.350) (-666.288) -- 0:00:50
151000 -- [-665.952] (-665.776) (-667.927) (-667.005) * (-672.866) (-665.650) (-669.080) [-666.496] -- 0:00:50
151500 -- (-668.890) (-668.190) [-668.162] (-667.787) * (-665.307) (-667.508) (-668.881) [-665.654] -- 0:00:50
152000 -- (-668.144) (-666.951) (-668.572) [-670.112] * (-667.005) [-665.832] (-665.877) (-665.519) -- 0:00:50
152500 -- (-667.979) (-670.532) [-666.517] (-669.471) * [-671.741] (-669.987) (-666.809) (-667.613) -- 0:00:50
153000 -- (-666.177) [-667.661] (-666.362) (-671.357) * [-668.888] (-667.656) (-669.976) (-666.285) -- 0:00:49
153500 -- (-665.358) [-668.445] (-665.697) (-672.817) * (-666.092) [-668.110] (-668.573) (-672.181) -- 0:00:49
154000 -- (-665.347) [-665.686] (-668.668) (-666.345) * [-667.292] (-671.996) (-666.175) (-666.121) -- 0:00:49
154500 -- (-667.526) (-666.538) [-665.838] (-668.972) * (-670.761) (-667.550) (-668.318) [-672.072] -- 0:00:49
155000 -- (-665.058) (-666.035) (-667.005) [-669.617] * (-669.911) (-666.647) (-667.322) [-669.749] -- 0:00:49
Average standard deviation of split frequencies: 0.025606
155500 -- [-669.740] (-666.922) (-668.939) (-666.917) * (-667.125) (-665.730) [-666.145] (-667.076) -- 0:00:48
156000 -- [-669.949] (-666.851) (-670.005) (-665.591) * (-665.406) (-666.593) (-666.573) [-667.181] -- 0:00:48
156500 -- (-671.465) (-666.910) (-668.401) [-666.328] * (-667.200) [-665.555] (-666.663) (-666.002) -- 0:00:48
157000 -- (-671.603) [-667.464] (-667.944) (-667.103) * [-667.813] (-668.302) (-668.204) (-667.183) -- 0:00:48
157500 -- (-665.596) (-666.950) (-666.983) [-666.591] * (-666.706) [-667.741] (-671.265) (-672.188) -- 0:00:48
158000 -- (-667.000) [-665.595] (-667.761) (-665.736) * [-668.515] (-669.271) (-665.078) (-668.566) -- 0:00:47
158500 -- (-668.286) (-672.207) (-669.887) [-669.249] * (-668.355) [-668.785] (-668.274) (-671.714) -- 0:00:47
159000 -- (-665.903) (-669.227) [-666.376] (-669.269) * [-666.998] (-668.435) (-669.744) (-668.177) -- 0:00:47
159500 -- (-666.543) (-668.004) (-666.576) [-668.311] * (-666.284) (-669.265) [-666.869] (-666.143) -- 0:00:47
160000 -- [-666.273] (-671.143) (-665.745) (-667.014) * (-667.322) (-669.432) (-669.048) [-665.951] -- 0:00:47
Average standard deviation of split frequencies: 0.025789
160500 -- (-665.257) (-671.679) (-668.293) [-665.999] * (-670.247) (-669.965) [-668.938] (-667.739) -- 0:00:52
161000 -- [-668.836] (-668.509) (-666.751) (-666.527) * (-670.655) [-666.164] (-668.268) (-671.479) -- 0:00:52
161500 -- (-669.522) (-666.949) [-666.631] (-666.713) * (-665.499) (-668.450) (-670.306) [-666.062] -- 0:00:51
162000 -- (-668.975) (-672.365) [-667.837] (-667.283) * (-666.829) [-667.672] (-668.866) (-665.805) -- 0:00:51
162500 -- (-665.095) (-668.921) (-670.226) [-665.222] * (-667.842) [-670.454] (-667.851) (-670.779) -- 0:00:51
163000 -- (-666.635) (-666.858) (-668.898) [-667.390] * (-669.509) [-669.197] (-668.060) (-673.969) -- 0:00:51
163500 -- (-666.635) [-667.325] (-667.974) (-667.227) * (-669.652) [-666.471] (-667.946) (-665.577) -- 0:00:51
164000 -- [-667.973] (-667.050) (-667.780) (-670.633) * (-670.890) [-669.570] (-668.539) (-665.770) -- 0:00:50
164500 -- (-667.925) (-666.064) (-665.722) [-666.065] * (-666.205) (-670.374) (-665.328) [-667.988] -- 0:00:50
165000 -- (-667.752) (-666.650) [-666.329] (-667.111) * [-668.762] (-666.931) (-667.869) (-666.946) -- 0:00:50
Average standard deviation of split frequencies: 0.023167
165500 -- (-669.287) (-666.375) [-666.832] (-669.298) * [-665.996] (-670.474) (-669.131) (-666.763) -- 0:00:50
166000 -- (-666.266) [-665.881] (-666.070) (-669.510) * (-669.084) (-669.557) [-670.406] (-665.909) -- 0:00:50
166500 -- (-672.461) (-667.254) (-665.679) [-671.036] * (-666.208) [-669.686] (-667.119) (-668.204) -- 0:00:50
167000 -- (-672.392) (-665.100) (-667.348) [-665.675] * (-667.532) [-668.462] (-667.830) (-665.418) -- 0:00:49
167500 -- (-668.063) [-666.556] (-667.506) (-667.225) * [-669.605] (-670.548) (-669.356) (-669.844) -- 0:00:49
168000 -- [-667.146] (-665.294) (-668.890) (-667.512) * (-667.018) (-670.180) (-667.061) [-666.056] -- 0:00:49
168500 -- (-668.434) [-670.112] (-668.154) (-665.926) * (-668.071) [-667.214] (-667.983) (-666.580) -- 0:00:49
169000 -- (-665.237) (-667.657) (-665.089) [-666.774] * (-665.472) [-666.250] (-668.674) (-669.435) -- 0:00:49
169500 -- [-665.556] (-669.036) (-666.522) (-666.896) * (-666.227) (-668.730) [-668.020] (-669.531) -- 0:00:48
170000 -- (-666.527) (-665.967) (-669.350) [-665.531] * [-665.264] (-668.488) (-667.447) (-667.543) -- 0:00:48
Average standard deviation of split frequencies: 0.022864
170500 -- (-666.522) [-665.849] (-669.822) (-665.666) * (-665.904) (-667.069) [-665.560] (-665.480) -- 0:00:48
171000 -- (-666.140) (-668.021) [-666.747] (-666.675) * (-665.811) (-665.981) (-667.211) [-668.556] -- 0:00:48
171500 -- (-668.123) [-668.168] (-665.524) (-666.001) * (-666.479) (-674.412) [-667.012] (-666.234) -- 0:00:48
172000 -- (-668.226) (-666.448) [-667.693] (-666.393) * (-669.847) (-669.999) (-667.670) [-670.039] -- 0:00:48
172500 -- (-665.952) (-666.209) [-667.264] (-665.881) * (-665.529) (-670.703) (-666.660) [-668.680] -- 0:00:47
173000 -- (-666.414) (-665.500) (-669.722) [-665.688] * [-665.403] (-668.558) (-671.223) (-666.100) -- 0:00:47
173500 -- (-669.304) [-665.398] (-668.903) (-669.162) * (-666.842) (-666.486) [-666.014] (-666.387) -- 0:00:47
174000 -- (-670.269) (-667.774) (-669.465) [-667.128] * (-668.946) (-668.019) (-666.759) [-666.194] -- 0:00:47
174500 -- [-671.312] (-666.303) (-668.526) (-667.262) * (-668.368) (-672.034) (-666.965) [-666.004] -- 0:00:47
175000 -- [-667.434] (-665.866) (-669.097) (-672.675) * (-667.792) (-667.524) [-667.994] (-666.381) -- 0:00:47
Average standard deviation of split frequencies: 0.022978
175500 -- (-667.615) [-666.730] (-670.188) (-667.090) * (-665.922) (-669.021) [-669.344] (-667.193) -- 0:00:46
176000 -- (-667.275) (-666.352) [-667.775] (-666.887) * (-672.163) [-666.984] (-668.695) (-667.617) -- 0:00:46
176500 -- [-666.087] (-666.177) (-670.571) (-668.659) * (-671.117) (-667.235) [-666.246] (-665.467) -- 0:00:46
177000 -- (-667.749) (-667.424) (-670.728) [-667.618] * (-668.390) (-667.209) (-666.703) [-666.079] -- 0:00:46
177500 -- (-668.103) [-666.324] (-666.625) (-667.667) * (-667.667) (-667.016) (-665.838) [-666.946] -- 0:00:50
178000 -- (-668.421) (-669.119) (-665.767) [-666.500] * (-667.133) [-666.115] (-667.688) (-666.297) -- 0:00:50
178500 -- [-667.638] (-666.861) (-668.025) (-666.255) * (-667.127) [-668.753] (-666.763) (-668.454) -- 0:00:50
179000 -- (-670.009) (-666.566) [-668.373] (-666.316) * (-670.719) (-669.319) (-667.072) [-667.235] -- 0:00:50
179500 -- [-666.070] (-666.683) (-666.443) (-666.500) * (-667.807) (-673.907) [-667.055] (-670.072) -- 0:00:50
180000 -- [-666.676] (-666.116) (-666.433) (-667.929) * (-674.829) (-665.943) [-667.256] (-669.310) -- 0:00:50
Average standard deviation of split frequencies: 0.022522
180500 -- [-667.926] (-666.434) (-666.352) (-665.644) * (-668.612) (-667.055) (-665.387) [-668.228] -- 0:00:49
181000 -- (-667.504) [-666.882] (-669.547) (-665.464) * (-668.149) [-666.795] (-666.261) (-666.452) -- 0:00:49
181500 -- (-670.125) [-669.246] (-667.485) (-665.509) * [-666.935] (-665.613) (-666.761) (-667.668) -- 0:00:49
182000 -- [-667.208] (-669.218) (-665.843) (-665.484) * (-666.645) (-669.321) [-667.149] (-672.451) -- 0:00:49
182500 -- [-666.225] (-667.270) (-666.325) (-666.761) * (-668.017) [-666.822] (-665.557) (-668.548) -- 0:00:49
183000 -- (-667.465) [-666.875] (-672.547) (-666.391) * (-667.547) [-665.797] (-664.957) (-665.804) -- 0:00:49
183500 -- (-666.752) [-666.452] (-668.109) (-666.660) * [-666.241] (-666.412) (-666.047) (-666.188) -- 0:00:48
184000 -- (-666.871) (-669.031) (-667.656) [-668.165] * (-667.804) (-668.043) [-667.146] (-666.187) -- 0:00:48
184500 -- (-665.553) (-673.203) [-667.280] (-667.064) * [-669.474] (-667.945) (-669.764) (-665.993) -- 0:00:48
185000 -- (-666.148) (-667.198) [-667.399] (-667.477) * (-671.696) (-668.566) [-665.522] (-668.027) -- 0:00:48
Average standard deviation of split frequencies: 0.021343
185500 -- (-665.239) [-666.252] (-665.740) (-665.544) * (-666.336) (-667.700) (-665.069) [-667.223] -- 0:00:48
186000 -- (-667.424) (-668.502) (-666.650) [-666.604] * (-664.880) [-665.160] (-666.179) (-666.588) -- 0:00:48
186500 -- (-665.484) [-667.619] (-668.561) (-665.938) * (-665.227) [-666.484] (-667.542) (-666.964) -- 0:00:47
187000 -- [-665.844] (-666.362) (-666.561) (-665.901) * (-666.965) (-668.631) (-667.565) [-665.215] -- 0:00:47
187500 -- (-668.118) (-668.940) (-667.713) [-667.250] * [-667.008] (-669.151) (-666.362) (-670.398) -- 0:00:47
188000 -- (-670.354) [-667.378] (-667.424) (-669.909) * (-665.908) [-667.500] (-667.570) (-669.323) -- 0:00:47
188500 -- (-667.163) (-667.305) (-666.576) [-665.282] * (-672.036) [-667.237] (-669.113) (-669.385) -- 0:00:47
189000 -- [-666.832] (-666.836) (-667.688) (-665.141) * [-666.226] (-674.916) (-665.166) (-666.579) -- 0:00:47
189500 -- [-665.240] (-667.862) (-665.681) (-666.110) * [-666.312] (-674.523) (-666.473) (-667.149) -- 0:00:47
190000 -- (-666.735) (-668.003) [-665.850] (-665.536) * [-666.186] (-668.445) (-666.587) (-667.355) -- 0:00:46
Average standard deviation of split frequencies: 0.021471
190500 -- (-665.364) (-665.886) [-666.269] (-668.965) * (-670.655) (-666.011) [-667.379] (-669.372) -- 0:00:46
191000 -- [-666.686] (-666.733) (-666.219) (-670.254) * [-667.741] (-666.940) (-668.280) (-667.361) -- 0:00:46
191500 -- (-667.908) (-666.784) [-666.276] (-668.939) * (-667.992) (-665.810) [-666.258] (-666.953) -- 0:00:46
192000 -- (-669.806) [-665.552] (-666.828) (-667.675) * [-669.188] (-665.175) (-665.992) (-666.642) -- 0:00:46
192500 -- [-667.677] (-666.379) (-666.852) (-669.151) * (-667.848) (-667.656) (-666.710) [-666.741] -- 0:00:46
193000 -- (-665.835) (-666.244) (-668.111) [-666.741] * (-667.990) (-665.625) (-669.792) [-668.481] -- 0:00:45
193500 -- (-665.398) (-665.459) [-666.064] (-668.582) * (-667.638) (-665.560) (-667.845) [-668.688] -- 0:00:45
194000 -- (-666.590) (-667.578) [-666.803] (-670.068) * (-665.926) (-668.804) [-669.029] (-668.251) -- 0:00:45
194500 -- [-665.672] (-666.531) (-668.158) (-668.239) * (-669.552) (-667.391) (-668.528) [-666.337] -- 0:00:49
195000 -- (-665.184) (-666.475) (-670.986) [-670.131] * (-667.631) (-666.486) (-667.930) [-665.858] -- 0:00:49
Average standard deviation of split frequencies: 0.019494
195500 -- [-666.065] (-666.522) (-668.274) (-666.430) * (-669.029) (-669.583) (-668.002) [-665.779] -- 0:00:49
196000 -- (-668.190) (-666.402) (-670.384) [-667.499] * (-666.198) (-670.653) (-666.874) [-667.585] -- 0:00:49
196500 -- (-666.411) (-667.132) [-665.893] (-665.522) * [-666.053] (-668.809) (-668.597) (-667.733) -- 0:00:49
197000 -- (-665.236) [-666.612] (-665.872) (-668.655) * (-667.397) (-666.838) [-665.566] (-667.038) -- 0:00:48
197500 -- [-666.715] (-666.080) (-665.665) (-666.716) * (-667.233) (-666.886) (-670.099) [-666.068] -- 0:00:48
198000 -- [-667.630] (-665.182) (-667.388) (-667.968) * [-666.626] (-666.315) (-668.584) (-668.266) -- 0:00:48
198500 -- (-666.718) [-665.431] (-666.885) (-664.894) * (-669.813) (-668.584) [-666.011] (-666.783) -- 0:00:48
199000 -- (-665.775) (-667.300) (-669.146) [-665.174] * (-666.187) (-667.129) [-665.864] (-668.758) -- 0:00:48
199500 -- [-666.170] (-669.848) (-668.228) (-664.947) * (-668.422) [-667.970] (-666.991) (-666.201) -- 0:00:48
200000 -- (-667.609) [-665.268] (-667.910) (-665.216) * (-666.394) [-667.762] (-668.253) (-666.475) -- 0:00:48
Average standard deviation of split frequencies: 0.019783
200500 -- (-669.828) (-665.532) (-666.235) [-665.024] * [-666.540] (-667.292) (-667.068) (-665.417) -- 0:00:47
201000 -- (-668.618) (-671.645) [-666.001] (-674.982) * (-666.782) [-669.307] (-667.209) (-667.886) -- 0:00:47
201500 -- (-665.777) [-668.489] (-666.151) (-666.638) * (-665.685) [-668.231] (-666.627) (-667.081) -- 0:00:47
202000 -- (-665.239) (-667.144) [-666.388] (-665.783) * (-666.670) [-667.893] (-668.795) (-666.882) -- 0:00:47
202500 -- (-665.479) (-665.561) (-666.543) [-668.976] * [-667.661] (-667.206) (-670.371) (-671.837) -- 0:00:47
203000 -- (-665.768) [-667.703] (-666.721) (-666.951) * (-667.660) (-669.693) (-665.761) [-669.204] -- 0:00:47
203500 -- (-665.602) [-666.751] (-665.107) (-665.739) * (-666.156) (-668.449) (-665.638) [-670.593] -- 0:00:46
204000 -- (-667.553) (-667.522) [-666.886] (-667.186) * (-669.621) (-670.563) (-666.450) [-669.483] -- 0:00:46
204500 -- (-668.101) [-667.468] (-665.923) (-668.617) * (-668.969) (-666.118) (-666.521) [-666.207] -- 0:00:46
205000 -- (-666.275) [-666.620] (-668.831) (-667.115) * (-668.429) [-668.765] (-666.551) (-666.035) -- 0:00:46
Average standard deviation of split frequencies: 0.018879
205500 -- (-667.452) [-666.098] (-669.244) (-665.864) * (-665.745) [-665.747] (-667.590) (-669.831) -- 0:00:46
206000 -- (-668.979) (-667.797) (-667.027) [-665.468] * (-666.457) [-666.735] (-666.749) (-669.663) -- 0:00:46
206500 -- (-667.216) (-666.709) [-672.037] (-666.986) * (-670.410) (-669.581) (-665.937) [-666.333] -- 0:00:46
207000 -- [-664.941] (-667.446) (-669.375) (-666.599) * (-667.313) (-669.752) (-665.339) [-667.062] -- 0:00:45
207500 -- (-666.383) (-666.157) (-668.303) [-668.908] * (-668.776) (-668.702) [-666.862] (-669.199) -- 0:00:45
208000 -- (-670.634) [-666.064] (-670.565) (-672.830) * (-667.055) [-667.416] (-666.605) (-666.593) -- 0:00:45
208500 -- [-666.038] (-665.665) (-667.987) (-665.596) * (-669.457) (-669.531) (-669.094) [-667.839] -- 0:00:45
209000 -- (-670.635) [-665.564] (-666.116) (-667.578) * (-667.877) (-668.183) (-668.632) [-666.471] -- 0:00:45
209500 -- (-666.323) [-670.652] (-665.505) (-668.079) * [-667.776] (-666.173) (-667.126) (-667.570) -- 0:00:45
210000 -- [-668.426] (-666.691) (-665.854) (-667.966) * (-668.821) (-666.299) [-667.540] (-666.693) -- 0:00:45
Average standard deviation of split frequencies: 0.016724
210500 -- (-669.304) (-668.774) (-669.203) [-665.046] * (-665.644) [-665.793] (-667.055) (-665.536) -- 0:00:45
211000 -- (-673.585) (-670.237) [-666.896] (-666.600) * (-666.200) (-672.451) (-667.570) [-665.264] -- 0:00:48
211500 -- (-667.451) [-666.106] (-668.285) (-672.236) * [-665.489] (-668.492) (-666.996) (-668.227) -- 0:00:48
212000 -- (-667.838) (-666.278) [-665.909] (-670.398) * (-665.046) (-665.363) (-666.613) [-665.603] -- 0:00:48
212500 -- (-666.348) [-665.473] (-667.917) (-668.672) * (-665.004) [-666.721] (-667.027) (-668.165) -- 0:00:48
213000 -- (-666.180) (-666.618) (-666.247) [-666.391] * (-666.804) (-666.490) (-670.452) [-665.695] -- 0:00:48
213500 -- (-667.215) (-667.276) (-667.889) [-665.984] * (-667.768) (-669.170) (-668.764) [-665.108] -- 0:00:47
214000 -- (-666.757) (-665.790) [-672.875] (-669.517) * [-665.942] (-668.464) (-669.951) (-667.100) -- 0:00:47
214500 -- (-672.692) (-668.519) (-665.628) [-667.080] * (-664.809) [-668.587] (-666.954) (-669.212) -- 0:00:47
215000 -- (-669.929) (-667.167) [-670.442] (-666.172) * (-671.331) (-666.563) (-667.294) [-666.722] -- 0:00:47
Average standard deviation of split frequencies: 0.015851
215500 -- (-669.409) [-666.307] (-667.443) (-671.039) * [-665.653] (-667.809) (-667.653) (-668.051) -- 0:00:47
216000 -- [-666.611] (-666.293) (-665.497) (-666.987) * (-666.401) [-666.993] (-668.350) (-667.606) -- 0:00:47
216500 -- [-667.809] (-667.764) (-667.421) (-666.046) * [-667.470] (-669.803) (-666.856) (-666.859) -- 0:00:47
217000 -- (-668.633) [-666.123] (-668.073) (-669.336) * (-666.139) (-667.478) [-666.158] (-667.242) -- 0:00:46
217500 -- [-667.762] (-665.564) (-668.355) (-667.740) * (-666.225) (-667.952) (-666.836) [-665.823] -- 0:00:46
218000 -- [-669.276] (-667.723) (-666.725) (-667.982) * (-665.670) (-667.229) [-665.199] (-668.668) -- 0:00:46
218500 -- [-667.224] (-665.477) (-665.213) (-667.227) * (-667.050) [-667.768] (-665.646) (-675.124) -- 0:00:46
219000 -- (-667.319) [-667.511] (-667.065) (-668.294) * (-665.339) [-667.220] (-668.541) (-670.930) -- 0:00:46
219500 -- (-666.944) (-666.689) [-666.637] (-667.599) * [-668.017] (-666.308) (-668.266) (-667.804) -- 0:00:46
220000 -- [-665.867] (-668.012) (-672.512) (-666.237) * (-673.062) [-666.101] (-669.344) (-667.398) -- 0:00:46
Average standard deviation of split frequencies: 0.015331
220500 -- (-666.813) (-671.156) (-672.877) [-665.686] * (-667.376) (-667.725) [-666.256] (-667.964) -- 0:00:45
221000 -- (-667.064) (-669.068) [-667.815] (-666.434) * (-665.961) (-665.565) [-666.249] (-669.363) -- 0:00:45
221500 -- (-665.738) (-666.093) (-666.885) [-669.245] * (-667.536) (-667.812) (-666.011) [-665.454] -- 0:00:45
222000 -- [-666.883] (-666.677) (-666.357) (-667.333) * (-666.764) (-668.060) (-666.564) [-669.526] -- 0:00:45
222500 -- (-668.165) (-666.691) (-670.166) [-671.784] * (-670.131) [-665.606] (-667.243) (-665.566) -- 0:00:45
223000 -- (-667.646) (-666.074) [-665.026] (-666.740) * (-670.100) (-666.894) (-666.951) [-666.096] -- 0:00:45
223500 -- (-667.472) (-667.568) [-665.792] (-666.257) * (-668.831) (-665.522) (-670.135) [-667.279] -- 0:00:45
224000 -- (-667.056) (-665.544) [-666.406] (-668.682) * (-666.611) (-666.224) (-666.540) [-665.599] -- 0:00:45
224500 -- (-666.556) (-665.818) [-666.962] (-670.095) * (-668.583) (-665.879) [-668.196] (-666.814) -- 0:00:44
225000 -- (-666.562) (-665.995) (-668.372) [-665.657] * (-667.446) [-665.917] (-665.950) (-666.379) -- 0:00:44
Average standard deviation of split frequencies: 0.016061
225500 -- [-664.792] (-668.187) (-668.246) (-666.762) * (-667.176) (-666.645) (-668.811) [-665.833] -- 0:00:44
226000 -- [-665.271] (-665.671) (-669.348) (-669.286) * [-666.370] (-667.230) (-670.838) (-666.550) -- 0:00:44
226500 -- (-669.172) (-666.081) [-668.106] (-669.939) * (-668.970) (-665.288) (-666.512) [-666.310] -- 0:00:44
227000 -- (-668.316) (-669.169) [-668.998] (-666.203) * (-669.338) [-666.619] (-667.840) (-666.516) -- 0:00:44
227500 -- (-666.211) [-669.720] (-668.252) (-667.372) * (-668.497) [-665.127] (-667.733) (-669.211) -- 0:00:44
228000 -- [-666.820] (-665.689) (-668.460) (-665.706) * [-667.033] (-665.883) (-666.110) (-672.560) -- 0:00:47
228500 -- [-672.348] (-667.439) (-666.605) (-665.289) * (-666.732) (-667.006) [-665.688] (-667.477) -- 0:00:47
229000 -- (-668.724) (-668.797) [-669.311] (-668.726) * (-667.817) [-666.981] (-667.087) (-670.440) -- 0:00:47
229500 -- (-665.473) (-667.560) [-666.228] (-668.937) * [-666.924] (-667.399) (-671.136) (-666.531) -- 0:00:47
230000 -- [-667.098] (-665.250) (-668.557) (-666.049) * [-666.464] (-666.203) (-666.542) (-670.040) -- 0:00:46
Average standard deviation of split frequencies: 0.015919
230500 -- (-668.498) [-668.315] (-671.810) (-668.566) * (-667.247) [-667.042] (-666.023) (-670.603) -- 0:00:46
231000 -- [-666.110] (-665.885) (-673.586) (-667.420) * (-665.610) [-666.800] (-668.997) (-669.806) -- 0:00:46
231500 -- [-667.993] (-667.018) (-670.071) (-667.811) * (-665.164) (-668.475) [-665.782] (-668.371) -- 0:00:46
232000 -- (-668.611) (-670.494) [-666.511] (-666.481) * (-666.729) (-665.452) (-673.248) [-666.816] -- 0:00:46
232500 -- [-667.306] (-666.058) (-667.953) (-666.968) * (-666.164) (-665.702) (-674.076) [-667.175] -- 0:00:46
233000 -- [-666.232] (-670.091) (-666.386) (-665.807) * (-665.054) (-667.340) [-668.243] (-669.292) -- 0:00:46
233500 -- (-666.529) (-667.377) (-673.036) [-667.253] * [-666.089] (-669.099) (-668.497) (-667.174) -- 0:00:45
234000 -- [-665.329] (-670.153) (-669.738) (-665.851) * [-665.490] (-668.908) (-668.935) (-667.533) -- 0:00:45
234500 -- [-668.090] (-666.983) (-675.126) (-667.142) * (-665.248) [-666.208] (-670.018) (-666.883) -- 0:00:45
235000 -- (-670.401) (-667.753) [-666.417] (-669.117) * (-664.918) [-668.929] (-671.182) (-670.008) -- 0:00:45
Average standard deviation of split frequencies: 0.014929
235500 -- (-670.354) (-666.074) [-665.855] (-671.869) * [-664.896] (-667.078) (-668.525) (-666.823) -- 0:00:45
236000 -- (-669.475) (-668.158) [-666.603] (-668.969) * [-669.332] (-664.970) (-667.005) (-665.596) -- 0:00:45
236500 -- [-666.647] (-666.487) (-666.043) (-672.946) * [-665.908] (-666.724) (-667.827) (-668.256) -- 0:00:45
237000 -- (-666.056) (-669.582) [-667.150] (-666.244) * (-667.800) (-665.487) [-668.265] (-668.425) -- 0:00:45
237500 -- (-668.751) (-669.980) (-669.883) [-666.644] * (-667.111) [-666.799] (-670.539) (-665.803) -- 0:00:44
238000 -- [-667.850] (-669.388) (-666.736) (-668.919) * (-666.122) [-670.515] (-668.255) (-668.382) -- 0:00:44
238500 -- (-665.391) (-666.194) [-667.166] (-670.214) * (-666.854) [-668.228] (-669.084) (-668.549) -- 0:00:44
239000 -- (-665.008) (-666.574) [-665.558] (-671.252) * (-668.003) [-667.390] (-666.635) (-667.072) -- 0:00:44
239500 -- (-667.905) (-665.381) [-665.426] (-666.364) * (-668.692) [-668.773] (-667.806) (-666.153) -- 0:00:44
240000 -- [-669.384] (-666.948) (-667.192) (-670.421) * (-668.017) [-667.157] (-667.483) (-668.900) -- 0:00:44
Average standard deviation of split frequencies: 0.014639
240500 -- (-669.179) [-665.341] (-666.509) (-671.610) * (-669.933) [-665.670] (-666.294) (-667.947) -- 0:00:44
241000 -- (-665.886) [-668.542] (-666.074) (-671.686) * (-670.740) [-665.670] (-665.581) (-668.530) -- 0:00:44
241500 -- (-665.631) [-665.210] (-671.115) (-666.694) * (-672.366) (-665.980) (-665.598) [-668.051] -- 0:00:43
242000 -- (-668.813) (-666.235) [-665.345] (-669.312) * (-668.288) (-665.333) (-668.162) [-665.775] -- 0:00:43
242500 -- [-669.325] (-669.735) (-669.737) (-670.948) * (-668.881) (-667.697) [-667.866] (-668.220) -- 0:00:43
243000 -- [-671.014] (-668.407) (-664.959) (-666.270) * (-666.772) (-667.336) (-668.131) [-666.102] -- 0:00:43
243500 -- (-669.968) (-668.624) (-668.883) [-666.661] * (-666.376) [-667.885] (-665.713) (-666.621) -- 0:00:43
244000 -- (-667.220) (-667.005) [-671.055] (-666.141) * [-665.983] (-667.990) (-668.908) (-666.167) -- 0:00:43
244500 -- (-669.670) (-669.861) [-666.859] (-666.075) * (-672.738) (-666.759) (-667.090) [-666.286] -- 0:00:43
245000 -- (-667.386) [-666.505] (-668.605) (-667.921) * (-674.314) (-668.376) [-667.071] (-670.297) -- 0:00:46
Average standard deviation of split frequencies: 0.013111
245500 -- (-668.440) (-665.582) (-670.459) [-668.588] * (-665.798) (-668.405) (-668.810) [-666.389] -- 0:00:46
246000 -- (-668.106) [-665.164] (-666.917) (-668.033) * [-665.368] (-668.445) (-667.100) (-669.636) -- 0:00:45
246500 -- [-665.912] (-669.371) (-667.355) (-665.462) * [-666.600] (-666.297) (-671.529) (-666.654) -- 0:00:45
247000 -- [-665.946] (-665.430) (-673.236) (-665.530) * (-667.186) (-666.246) [-667.771] (-669.683) -- 0:00:45
247500 -- (-665.440) (-669.928) [-667.539] (-667.942) * [-666.809] (-667.779) (-668.768) (-668.507) -- 0:00:45
248000 -- (-668.113) [-669.703] (-667.200) (-667.651) * [-667.176] (-667.542) (-668.643) (-668.780) -- 0:00:45
248500 -- (-667.526) (-667.521) [-668.919] (-666.810) * (-669.836) (-667.416) [-665.671] (-668.643) -- 0:00:45
249000 -- (-667.212) (-668.643) [-666.865] (-665.786) * (-669.336) [-671.142] (-667.100) (-668.364) -- 0:00:45
249500 -- (-667.850) (-667.308) [-672.034] (-667.272) * (-666.604) [-668.093] (-665.301) (-668.340) -- 0:00:45
250000 -- (-666.372) (-667.609) (-667.247) [-665.804] * (-665.699) (-667.370) (-666.288) [-665.990] -- 0:00:45
Average standard deviation of split frequencies: 0.011806
250500 -- (-670.746) [-667.346] (-671.792) (-665.540) * [-668.148] (-673.471) (-666.651) (-666.304) -- 0:00:44
251000 -- (-666.748) [-667.747] (-665.851) (-669.238) * (-670.049) (-668.318) [-669.926] (-666.730) -- 0:00:44
251500 -- (-666.380) [-668.200] (-674.020) (-667.845) * [-666.937] (-666.486) (-673.033) (-665.872) -- 0:00:44
252000 -- (-669.400) (-666.627) (-666.411) [-665.431] * (-666.130) (-666.969) (-667.904) [-668.693] -- 0:00:44
252500 -- (-666.537) (-668.720) [-665.785] (-667.859) * (-665.392) (-667.319) (-667.961) [-668.056] -- 0:00:44
253000 -- [-667.047] (-665.611) (-665.179) (-668.271) * (-668.627) (-667.511) (-667.207) [-666.294] -- 0:00:44
253500 -- [-671.001] (-669.260) (-666.381) (-667.923) * (-665.670) (-672.775) [-667.376] (-667.735) -- 0:00:44
254000 -- (-670.336) (-665.878) (-665.473) [-667.759] * [-670.230] (-667.972) (-673.301) (-667.657) -- 0:00:44
254500 -- (-667.777) (-665.984) (-667.359) [-665.946] * (-669.410) (-668.054) (-667.867) [-665.929] -- 0:00:43
255000 -- (-672.928) [-665.957] (-667.084) (-665.676) * (-669.160) (-666.470) [-670.467] (-665.883) -- 0:00:43
Average standard deviation of split frequencies: 0.011482
255500 -- (-672.662) [-667.246] (-666.196) (-667.740) * [-667.639] (-666.758) (-669.765) (-667.414) -- 0:00:43
256000 -- (-669.492) [-667.859] (-665.260) (-667.381) * (-668.206) [-667.045] (-666.689) (-667.492) -- 0:00:43
256500 -- (-669.463) (-667.508) (-670.756) [-665.885] * (-668.544) [-666.333] (-668.760) (-665.206) -- 0:00:43
257000 -- (-665.478) (-667.279) (-668.383) [-670.023] * (-669.324) (-668.194) [-668.898] (-666.558) -- 0:00:43
257500 -- (-670.772) [-666.780] (-668.369) (-668.652) * (-666.060) (-667.646) [-666.656] (-665.248) -- 0:00:43
258000 -- (-666.121) [-666.379] (-669.941) (-666.488) * (-669.222) (-669.040) [-666.448] (-670.610) -- 0:00:43
258500 -- (-667.798) [-665.426] (-667.690) (-668.579) * (-666.707) (-666.635) (-665.848) [-665.413] -- 0:00:43
259000 -- (-666.034) [-666.291] (-666.379) (-667.099) * (-667.834) [-667.170] (-665.296) (-665.850) -- 0:00:42
259500 -- (-665.491) (-665.551) (-668.328) [-670.417] * (-666.459) [-666.515] (-666.460) (-665.503) -- 0:00:42
260000 -- (-667.964) [-667.010] (-667.917) (-667.286) * [-667.349] (-667.940) (-669.932) (-665.704) -- 0:00:42
Average standard deviation of split frequencies: 0.010348
260500 -- [-668.139] (-667.536) (-671.134) (-668.083) * (-666.158) (-665.931) (-668.516) [-666.001] -- 0:00:42
261000 -- [-667.474] (-665.262) (-665.622) (-667.005) * (-666.258) [-665.179] (-667.037) (-666.108) -- 0:00:42
261500 -- (-665.557) [-665.283] (-666.915) (-666.524) * (-666.428) [-668.097] (-668.985) (-666.535) -- 0:00:42
262000 -- (-666.118) [-665.846] (-673.073) (-668.404) * (-673.178) [-666.754] (-671.635) (-666.745) -- 0:00:45
262500 -- [-666.162] (-667.406) (-674.836) (-668.002) * (-665.715) [-665.897] (-667.719) (-665.796) -- 0:00:44
263000 -- (-667.279) (-668.533) [-668.327] (-666.203) * (-669.833) [-666.792] (-669.990) (-668.010) -- 0:00:44
263500 -- [-667.281] (-668.060) (-672.940) (-665.186) * (-666.845) (-665.512) (-669.185) [-666.234] -- 0:00:44
264000 -- [-666.581] (-667.002) (-665.836) (-666.678) * (-668.441) [-666.329] (-667.648) (-669.086) -- 0:00:44
264500 -- (-667.265) (-668.357) [-670.293] (-666.983) * (-666.656) [-667.203] (-665.070) (-669.946) -- 0:00:44
265000 -- (-667.015) [-667.129] (-665.285) (-667.815) * (-665.730) (-675.422) (-667.155) [-667.826] -- 0:00:44
Average standard deviation of split frequencies: 0.010338
265500 -- (-667.005) (-670.258) (-665.484) [-666.513] * (-666.173) (-669.618) (-666.459) [-668.702] -- 0:00:44
266000 -- (-668.670) [-673.929] (-665.063) (-667.100) * [-665.870] (-665.514) (-665.445) (-669.079) -- 0:00:44
266500 -- [-667.883] (-666.146) (-670.235) (-667.111) * (-671.501) [-667.248] (-665.016) (-665.207) -- 0:00:44
267000 -- (-666.606) (-668.829) (-668.920) [-666.921] * (-666.084) [-668.138] (-668.232) (-666.528) -- 0:00:43
267500 -- (-666.262) [-665.200] (-666.241) (-668.580) * (-667.579) (-665.531) (-668.083) [-667.275] -- 0:00:43
268000 -- (-670.318) [-666.123] (-665.642) (-667.938) * (-669.195) (-667.684) (-665.932) [-665.513] -- 0:00:43
268500 -- (-669.818) [-665.590] (-667.441) (-666.636) * [-667.416] (-676.890) (-668.907) (-666.339) -- 0:00:43
269000 -- (-668.180) (-667.916) (-665.961) [-670.932] * (-666.147) [-666.757] (-669.555) (-667.177) -- 0:00:43
269500 -- (-671.514) [-665.228] (-666.495) (-668.753) * (-669.011) (-665.948) (-673.991) [-666.225] -- 0:00:43
270000 -- [-666.352] (-665.966) (-668.547) (-667.434) * (-667.700) (-667.934) (-666.610) [-665.806] -- 0:00:43
Average standard deviation of split frequencies: 0.009425
270500 -- (-665.420) (-668.971) [-667.640] (-666.615) * (-666.098) [-666.018] (-667.213) (-669.233) -- 0:00:43
271000 -- [-665.277] (-665.461) (-667.162) (-667.183) * (-666.406) (-666.777) (-670.616) [-669.627] -- 0:00:43
271500 -- (-672.031) (-666.935) (-668.692) [-666.533] * [-669.191] (-667.454) (-668.448) (-670.457) -- 0:00:42
272000 -- [-669.726] (-668.706) (-669.088) (-666.669) * [-670.464] (-676.865) (-667.062) (-665.978) -- 0:00:42
272500 -- [-666.597] (-667.756) (-666.071) (-669.559) * (-668.076) (-672.165) (-668.382) [-665.444] -- 0:00:42
273000 -- (-666.649) [-667.738] (-667.067) (-670.740) * (-668.388) [-669.690] (-667.186) (-667.687) -- 0:00:42
273500 -- (-668.484) [-666.251] (-666.664) (-668.748) * (-665.906) (-667.446) (-668.989) [-667.866] -- 0:00:42
274000 -- (-666.679) [-665.703] (-667.488) (-669.846) * (-666.479) [-667.074] (-666.843) (-665.807) -- 0:00:42
274500 -- (-669.819) [-666.732] (-672.739) (-666.535) * (-667.647) [-666.685] (-670.113) (-667.524) -- 0:00:42
275000 -- (-669.172) [-668.422] (-666.919) (-667.618) * (-670.715) (-666.027) (-666.889) [-666.827] -- 0:00:42
Average standard deviation of split frequencies: 0.010750
275500 -- [-665.710] (-666.682) (-667.190) (-667.120) * [-667.317] (-665.485) (-669.024) (-666.813) -- 0:00:42
276000 -- (-666.569) [-665.387] (-666.063) (-666.967) * (-665.917) [-665.459] (-669.423) (-667.106) -- 0:00:41
276500 -- (-668.403) [-665.554] (-666.879) (-666.045) * (-674.174) (-668.957) [-665.380] (-669.018) -- 0:00:41
277000 -- (-666.854) (-668.459) [-665.532] (-665.336) * (-669.407) (-668.366) (-666.716) [-666.088] -- 0:00:41
277500 -- (-666.432) (-669.441) [-665.191] (-665.057) * (-666.359) (-666.552) [-665.271] (-668.075) -- 0:00:41
278000 -- (-667.415) [-666.673] (-667.333) (-665.934) * (-665.341) [-670.809] (-666.358) (-671.298) -- 0:00:41
278500 -- (-667.266) (-666.585) [-665.606] (-668.623) * (-667.318) [-667.123] (-666.957) (-674.957) -- 0:00:41
279000 -- [-666.437] (-666.077) (-666.423) (-666.830) * (-668.642) (-666.765) [-669.657] (-668.762) -- 0:00:43
279500 -- (-666.171) (-668.791) (-666.941) [-666.633] * (-666.452) (-667.388) (-666.808) [-668.816] -- 0:00:43
280000 -- (-672.415) (-666.473) (-668.543) [-665.252] * [-668.225] (-665.705) (-667.263) (-669.038) -- 0:00:43
Average standard deviation of split frequencies: 0.011232
280500 -- (-668.979) [-667.178] (-670.744) (-667.681) * (-667.285) [-673.517] (-669.213) (-667.974) -- 0:00:43
281000 -- (-669.655) [-668.029] (-666.953) (-665.533) * (-668.159) [-665.613] (-667.682) (-667.101) -- 0:00:43
281500 -- (-669.406) (-667.702) (-665.344) [-666.016] * [-670.806] (-666.382) (-667.575) (-668.128) -- 0:00:43
282000 -- [-666.996] (-666.017) (-668.184) (-668.123) * (-667.084) (-666.972) (-666.761) [-667.205] -- 0:00:43
282500 -- (-667.692) (-665.775) (-665.821) [-667.221] * (-668.385) [-667.570] (-667.291) (-669.539) -- 0:00:43
283000 -- (-667.779) (-671.029) (-668.439) [-667.980] * (-667.029) (-667.956) [-666.797] (-668.314) -- 0:00:43
283500 -- (-668.804) [-667.537] (-667.783) (-670.082) * (-667.299) [-666.364] (-669.771) (-666.416) -- 0:00:42
284000 -- (-668.116) (-670.062) [-665.311] (-667.399) * (-667.624) (-667.175) (-668.641) [-665.479] -- 0:00:42
284500 -- (-666.376) (-666.141) [-669.987] (-667.287) * (-667.682) (-669.769) (-666.784) [-665.804] -- 0:00:42
285000 -- (-670.502) [-666.868] (-668.323) (-666.368) * (-668.556) (-669.171) (-671.139) [-665.260] -- 0:00:42
Average standard deviation of split frequencies: 0.011625
285500 -- (-665.944) [-667.236] (-666.046) (-665.534) * (-668.926) (-666.036) [-665.645] (-665.793) -- 0:00:42
286000 -- [-667.235] (-667.192) (-669.091) (-672.154) * (-667.374) [-665.143] (-666.491) (-668.034) -- 0:00:42
286500 -- (-670.545) (-668.941) (-668.283) [-666.544] * (-668.630) (-667.011) (-666.608) [-665.157] -- 0:00:42
287000 -- [-671.936] (-665.413) (-667.521) (-665.217) * (-668.503) (-671.850) (-665.456) [-666.687] -- 0:00:42
287500 -- [-667.032] (-667.868) (-670.289) (-667.871) * (-666.761) [-669.236] (-666.372) (-666.815) -- 0:00:42
288000 -- (-667.201) (-667.825) (-666.694) [-668.408] * (-667.374) [-666.906] (-665.875) (-666.320) -- 0:00:42
288500 -- (-665.710) (-669.822) [-667.370] (-666.227) * (-669.082) (-665.970) (-666.596) [-666.507] -- 0:00:41
289000 -- (-665.739) (-669.092) (-667.013) [-665.917] * (-668.389) (-668.837) [-666.273] (-673.588) -- 0:00:41
289500 -- (-668.336) (-669.419) (-666.179) [-667.363] * (-667.735) (-667.860) (-665.979) [-665.823] -- 0:00:41
290000 -- (-665.461) (-670.360) (-665.528) [-667.057] * (-666.185) (-668.104) [-666.207] (-665.531) -- 0:00:41
Average standard deviation of split frequencies: 0.011925
290500 -- (-668.273) (-667.223) [-665.906] (-667.183) * (-666.042) (-667.226) (-669.802) [-666.628] -- 0:00:41
291000 -- (-672.347) [-667.123] (-668.061) (-669.794) * (-665.567) (-667.818) [-667.878] (-665.642) -- 0:00:41
291500 -- (-669.050) (-666.875) [-666.275] (-672.250) * (-667.005) [-665.642] (-670.749) (-665.655) -- 0:00:41
292000 -- [-666.497] (-666.812) (-666.166) (-670.694) * [-666.331] (-665.534) (-666.629) (-666.544) -- 0:00:41
292500 -- (-672.860) [-666.459] (-667.807) (-668.569) * (-666.489) (-667.186) [-667.238] (-669.938) -- 0:00:41
293000 -- [-670.588] (-666.216) (-668.466) (-670.972) * (-665.458) (-666.430) [-669.648] (-666.811) -- 0:00:41
293500 -- (-668.636) [-665.932] (-669.688) (-667.949) * (-666.966) (-666.095) (-666.572) [-665.893] -- 0:00:40
294000 -- (-665.416) [-666.506] (-666.100) (-665.580) * (-668.720) (-666.712) [-669.246] (-666.075) -- 0:00:40
294500 -- (-665.111) [-669.862] (-665.734) (-665.661) * (-669.709) (-668.356) (-666.711) [-665.876] -- 0:00:40
295000 -- (-669.999) (-674.426) (-666.979) [-665.208] * (-670.806) [-667.780] (-667.768) (-665.915) -- 0:00:40
Average standard deviation of split frequencies: 0.012179
295500 -- (-669.713) [-673.295] (-666.389) (-665.023) * (-669.635) [-666.336] (-667.104) (-667.319) -- 0:00:42
296000 -- (-667.662) (-668.934) (-666.806) [-665.337] * (-669.404) (-665.451) [-666.897] (-666.296) -- 0:00:42
296500 -- (-667.183) (-672.059) [-669.549] (-671.175) * (-668.727) (-665.625) (-665.685) [-666.384] -- 0:00:42
297000 -- (-667.112) (-668.711) [-667.080] (-666.882) * (-667.020) (-665.751) (-668.593) [-665.375] -- 0:00:42
297500 -- [-668.075] (-665.772) (-667.409) (-666.695) * (-669.215) (-665.069) [-667.858] (-667.272) -- 0:00:42
298000 -- (-667.049) (-666.122) [-665.753] (-673.131) * (-665.955) (-665.319) [-667.100] (-666.748) -- 0:00:42
298500 -- (-666.191) (-668.711) [-666.954] (-668.324) * [-667.267] (-664.960) (-672.081) (-666.491) -- 0:00:42
299000 -- (-668.398) (-667.358) (-668.523) [-669.008] * (-666.186) (-666.128) [-667.968] (-666.319) -- 0:00:42
299500 -- (-668.406) (-666.028) (-666.772) [-665.847] * (-666.975) (-668.011) [-668.624] (-665.767) -- 0:00:42
300000 -- (-666.019) [-666.596] (-667.681) (-665.882) * (-666.888) (-667.758) [-665.933] (-668.163) -- 0:00:42
Average standard deviation of split frequencies: 0.010975
300500 -- (-666.027) (-667.138) [-667.164] (-667.197) * (-667.562) [-667.165] (-667.468) (-666.841) -- 0:00:41
301000 -- [-665.413] (-666.600) (-667.345) (-667.714) * (-669.166) [-665.560] (-666.072) (-671.263) -- 0:00:41
301500 -- [-666.709] (-667.591) (-670.961) (-667.714) * [-666.869] (-665.441) (-665.552) (-670.526) -- 0:00:41
302000 -- (-666.940) [-666.320] (-670.695) (-666.452) * (-665.780) (-668.050) [-665.952] (-665.411) -- 0:00:41
302500 -- (-667.354) [-668.322] (-666.708) (-665.801) * (-665.244) [-667.504] (-667.541) (-665.390) -- 0:00:41
303000 -- (-667.158) (-668.833) [-665.984] (-667.036) * (-665.537) (-667.757) (-666.850) [-667.291] -- 0:00:41
303500 -- (-669.903) (-666.539) (-665.965) [-665.734] * (-666.862) [-667.924] (-667.337) (-665.565) -- 0:00:41
304000 -- (-671.342) (-669.179) [-666.007] (-666.475) * [-667.493] (-671.915) (-666.125) (-666.178) -- 0:00:41
304500 -- (-665.360) (-666.169) (-667.025) [-666.025] * (-666.075) (-673.081) [-667.630] (-667.326) -- 0:00:41
305000 -- (-666.087) (-667.068) [-666.863] (-671.440) * (-666.500) (-669.974) [-667.832] (-667.711) -- 0:00:41
Average standard deviation of split frequencies: 0.010784
305500 -- (-666.976) [-665.632] (-668.511) (-669.658) * (-667.464) [-666.221] (-671.743) (-667.232) -- 0:00:40
306000 -- [-666.136] (-667.047) (-668.370) (-668.175) * (-667.629) [-665.745] (-665.880) (-669.967) -- 0:00:40
306500 -- (-672.414) (-666.369) [-666.265] (-667.198) * (-665.892) (-668.543) [-665.588] (-666.968) -- 0:00:40
307000 -- (-670.641) [-666.225] (-666.027) (-667.032) * [-666.500] (-668.503) (-667.458) (-667.101) -- 0:00:40
307500 -- (-671.087) (-667.426) [-666.471] (-666.244) * (-665.707) (-670.853) (-667.468) [-666.572] -- 0:00:40
308000 -- (-667.431) [-667.272] (-667.356) (-665.039) * (-667.079) (-670.775) [-666.653] (-666.440) -- 0:00:40
308500 -- (-666.292) (-667.068) (-665.668) [-667.125] * (-669.412) [-666.081] (-665.445) (-665.391) -- 0:00:40
309000 -- (-666.737) (-665.708) [-666.889] (-665.920) * [-666.008] (-668.103) (-665.415) (-671.339) -- 0:00:40
309500 -- [-669.102] (-667.137) (-667.653) (-667.845) * [-667.852] (-667.238) (-666.153) (-669.285) -- 0:00:40
310000 -- (-666.403) [-666.311] (-666.542) (-665.171) * (-668.772) (-667.945) [-666.378] (-666.384) -- 0:00:40
Average standard deviation of split frequencies: 0.010242
310500 -- (-665.140) (-666.312) (-669.437) [-669.185] * (-667.391) (-667.810) [-671.359] (-667.686) -- 0:00:39
311000 -- (-666.989) [-667.577] (-669.593) (-670.104) * (-666.927) (-672.853) [-666.711] (-668.633) -- 0:00:39
311500 -- [-668.955] (-665.254) (-673.911) (-668.735) * (-665.690) [-666.821] (-665.545) (-666.530) -- 0:00:39
312000 -- (-665.237) (-667.301) [-670.733] (-667.382) * [-667.036] (-665.381) (-667.443) (-666.803) -- 0:00:39
312500 -- [-665.042] (-666.319) (-670.822) (-665.563) * (-672.387) (-665.996) (-666.467) [-666.938] -- 0:00:41
313000 -- (-666.075) (-670.242) (-666.317) [-669.754] * (-669.899) (-669.035) [-667.329] (-668.793) -- 0:00:41
313500 -- [-666.999] (-668.363) (-666.489) (-669.159) * (-665.623) (-666.599) (-666.043) [-667.310] -- 0:00:41
314000 -- [-670.040] (-670.062) (-666.108) (-667.411) * (-666.286) [-667.205] (-670.177) (-668.076) -- 0:00:41
314500 -- (-665.930) [-667.792] (-666.148) (-665.886) * (-665.513) (-667.664) (-666.621) [-667.571] -- 0:00:41
315000 -- (-666.533) (-668.434) (-665.830) [-667.123] * (-667.381) (-665.203) (-670.976) [-672.784] -- 0:00:41
Average standard deviation of split frequencies: 0.010794
315500 -- [-666.009] (-665.198) (-668.215) (-666.833) * (-669.222) (-667.909) (-667.145) [-666.568] -- 0:00:41
316000 -- (-666.582) (-667.871) [-665.916] (-672.151) * [-665.879] (-667.507) (-669.391) (-667.587) -- 0:00:41
316500 -- (-668.369) (-665.606) [-667.947] (-670.470) * [-665.542] (-666.725) (-671.481) (-665.749) -- 0:00:41
317000 -- (-669.329) (-666.234) [-667.622] (-668.267) * [-668.093] (-667.241) (-668.809) (-665.947) -- 0:00:40
317500 -- (-668.008) (-669.651) (-668.655) [-670.605] * (-668.217) (-665.168) (-669.723) [-669.931] -- 0:00:40
318000 -- [-669.395] (-666.573) (-667.340) (-666.650) * (-670.643) [-667.307] (-667.155) (-665.712) -- 0:00:40
318500 -- (-668.347) (-667.467) [-665.726] (-674.162) * (-674.093) (-667.244) [-665.821] (-666.224) -- 0:00:40
319000 -- (-667.642) [-667.950] (-666.859) (-670.183) * [-668.325] (-669.460) (-668.364) (-665.500) -- 0:00:40
319500 -- [-670.443] (-666.782) (-666.159) (-668.583) * (-667.932) (-668.516) [-671.116] (-669.344) -- 0:00:40
320000 -- (-668.774) (-668.606) (-665.916) [-675.911] * (-666.054) [-670.295] (-667.256) (-668.833) -- 0:00:40
Average standard deviation of split frequencies: 0.010204
320500 -- (-675.056) (-666.201) (-667.276) [-667.192] * (-670.670) (-671.088) [-668.002] (-666.301) -- 0:00:40
321000 -- (-667.516) (-665.864) (-669.934) [-668.729] * (-669.551) [-670.336] (-668.055) (-665.506) -- 0:00:40
321500 -- [-666.308] (-665.268) (-670.052) (-665.407) * (-667.057) (-666.489) [-666.784] (-667.641) -- 0:00:40
322000 -- [-667.846] (-666.664) (-669.834) (-666.048) * [-665.995] (-668.432) (-668.916) (-666.807) -- 0:00:40
322500 -- [-669.661] (-667.189) (-667.590) (-670.232) * (-666.717) (-667.643) (-667.636) [-666.750] -- 0:00:39
323000 -- [-676.086] (-667.252) (-667.210) (-671.929) * [-669.094] (-667.036) (-669.846) (-669.683) -- 0:00:39
323500 -- (-671.563) (-667.851) (-666.725) [-666.259] * (-666.052) [-665.842] (-669.203) (-667.372) -- 0:00:39
324000 -- (-665.679) (-668.163) [-667.339] (-665.626) * (-665.579) [-669.060] (-670.341) (-666.846) -- 0:00:39
324500 -- (-668.490) (-666.292) (-666.518) [-667.116] * (-669.670) [-667.991] (-667.381) (-667.566) -- 0:00:39
325000 -- (-667.235) (-670.195) (-666.427) [-665.627] * (-670.679) (-668.554) (-669.193) [-669.063] -- 0:00:39
Average standard deviation of split frequencies: 0.010037
325500 -- (-666.131) [-667.794] (-666.233) (-674.459) * (-668.727) (-667.127) (-666.051) [-666.370] -- 0:00:39
326000 -- (-665.554) [-670.674] (-674.871) (-671.623) * (-666.231) (-666.913) [-667.181] (-667.509) -- 0:00:39
326500 -- (-666.583) [-667.396] (-674.080) (-668.403) * (-668.195) [-666.786] (-670.802) (-665.268) -- 0:00:39
327000 -- (-669.371) [-665.280] (-665.409) (-673.583) * (-669.441) [-666.386] (-666.876) (-667.173) -- 0:00:39
327500 -- [-667.682] (-672.117) (-669.928) (-665.951) * [-665.555] (-666.778) (-668.908) (-665.480) -- 0:00:39
328000 -- [-666.438] (-666.169) (-669.208) (-665.904) * [-668.890] (-666.693) (-666.798) (-666.956) -- 0:00:38
328500 -- (-666.355) [-668.318] (-669.016) (-666.006) * (-669.297) (-665.429) (-667.248) [-667.356] -- 0:00:38
329000 -- [-667.092] (-667.973) (-665.845) (-666.673) * (-668.595) [-667.008] (-665.790) (-666.206) -- 0:00:38
329500 -- (-668.211) (-667.029) (-665.935) [-666.170] * [-668.063] (-669.225) (-668.929) (-666.525) -- 0:00:40
330000 -- (-672.397) (-665.268) (-666.641) [-669.975] * (-666.983) [-668.452] (-671.335) (-667.547) -- 0:00:40
Average standard deviation of split frequencies: 0.010482
330500 -- [-669.501] (-665.897) (-666.130) (-666.285) * [-666.691] (-669.097) (-666.962) (-668.382) -- 0:00:40
331000 -- (-667.991) (-665.851) (-667.024) [-667.993] * [-665.918] (-669.182) (-665.701) (-668.536) -- 0:00:40
331500 -- (-665.117) (-672.080) (-666.445) [-664.976] * (-664.938) (-671.258) [-666.846] (-667.082) -- 0:00:40
332000 -- [-666.556] (-666.212) (-667.278) (-665.554) * (-665.059) [-668.819] (-666.064) (-667.264) -- 0:00:40
332500 -- (-666.298) [-666.353] (-668.211) (-666.329) * (-665.505) (-665.912) (-666.579) [-671.097] -- 0:00:40
333000 -- (-666.779) (-670.607) (-669.380) [-669.760] * (-665.128) (-668.620) [-666.605] (-665.483) -- 0:00:40
333500 -- (-669.181) [-665.338] (-668.823) (-668.892) * (-665.304) [-669.480] (-667.996) (-670.443) -- 0:00:39
334000 -- (-669.043) [-666.765] (-666.912) (-668.624) * (-665.603) [-666.196] (-669.716) (-669.992) -- 0:00:39
334500 -- (-668.971) (-666.049) (-668.482) [-666.298] * (-668.868) [-666.461] (-666.433) (-666.323) -- 0:00:39
335000 -- (-670.237) (-668.530) (-666.260) [-666.132] * (-667.203) (-669.169) [-666.187] (-666.128) -- 0:00:39
Average standard deviation of split frequencies: 0.009078
335500 -- (-672.843) [-668.264] (-666.628) (-669.150) * (-667.775) (-667.209) (-667.474) [-668.707] -- 0:00:39
336000 -- (-671.259) [-666.141] (-669.836) (-667.434) * (-667.290) (-667.684) (-666.157) [-666.197] -- 0:00:39
336500 -- (-672.094) (-669.812) [-666.199] (-665.615) * (-668.011) (-669.199) (-666.613) [-666.459] -- 0:00:39
337000 -- (-666.030) [-669.557] (-666.680) (-666.836) * [-665.259] (-666.370) (-666.368) (-667.586) -- 0:00:39
337500 -- (-667.031) [-665.526] (-671.313) (-667.047) * (-664.908) (-665.627) (-670.156) [-667.228] -- 0:00:39
338000 -- (-672.099) (-677.922) [-667.512] (-665.539) * (-668.514) (-666.592) [-669.738] (-668.967) -- 0:00:39
338500 -- (-667.126) (-669.594) [-666.611] (-666.848) * (-665.161) (-667.703) [-666.128] (-670.292) -- 0:00:39
339000 -- (-669.448) (-667.599) [-666.595] (-666.586) * (-667.110) (-673.013) (-665.543) [-668.559] -- 0:00:38
339500 -- (-668.006) (-668.772) (-665.805) [-668.667] * (-665.778) (-665.265) [-667.273] (-665.905) -- 0:00:38
340000 -- (-667.440) (-671.699) (-666.768) [-667.559] * (-668.212) [-666.585] (-666.706) (-668.710) -- 0:00:38
Average standard deviation of split frequencies: 0.010256
340500 -- (-668.742) [-667.458] (-668.696) (-665.384) * [-667.312] (-665.113) (-667.492) (-673.623) -- 0:00:38
341000 -- (-666.586) (-665.750) [-665.769] (-666.507) * (-666.041) [-669.746] (-668.931) (-668.959) -- 0:00:38
341500 -- (-666.798) [-667.477] (-666.137) (-668.581) * (-671.410) (-676.715) [-669.002] (-669.200) -- 0:00:38
342000 -- [-665.579] (-666.736) (-668.943) (-669.968) * (-675.363) (-666.825) [-666.091] (-668.971) -- 0:00:38
342500 -- (-665.889) [-665.614] (-669.110) (-669.442) * (-669.328) (-665.257) [-666.584] (-665.464) -- 0:00:38
343000 -- (-666.767) (-666.335) [-665.591] (-665.905) * (-667.411) (-672.448) (-666.988) [-669.456] -- 0:00:38
343500 -- (-667.207) (-665.471) [-666.475] (-666.059) * (-666.858) (-668.538) (-671.040) [-668.012] -- 0:00:38
344000 -- (-668.465) (-667.340) [-665.880] (-667.676) * (-667.124) (-666.164) [-667.220] (-670.837) -- 0:00:38
344500 -- (-666.662) [-666.090] (-665.503) (-666.507) * [-665.510] (-666.314) (-666.679) (-666.300) -- 0:00:38
345000 -- (-667.636) (-667.956) (-665.966) [-666.191] * (-666.450) (-669.137) (-666.231) [-666.896] -- 0:00:37
Average standard deviation of split frequencies: 0.010819
345500 -- (-668.338) (-665.404) (-668.762) [-666.170] * (-665.797) (-668.331) (-666.965) [-666.452] -- 0:00:39
346000 -- (-671.076) (-665.527) [-669.791] (-665.205) * [-667.426] (-669.264) (-666.893) (-666.010) -- 0:00:39
346500 -- [-666.262] (-666.796) (-668.106) (-670.122) * (-677.777) (-670.836) (-667.674) [-665.610] -- 0:00:39
347000 -- (-665.199) (-666.909) [-667.270] (-668.543) * (-669.156) (-671.012) [-666.899] (-668.353) -- 0:00:39
347500 -- (-665.269) (-670.334) (-665.383) [-665.895] * (-668.862) (-670.462) [-666.342] (-667.776) -- 0:00:39
348000 -- [-665.553] (-667.521) (-667.935) (-666.746) * (-668.426) (-672.223) [-666.175] (-671.402) -- 0:00:39
348500 -- [-666.270] (-666.928) (-671.270) (-665.737) * (-665.510) (-672.381) (-667.158) [-668.083] -- 0:00:39
349000 -- (-665.569) [-665.814] (-669.495) (-668.170) * (-669.068) (-667.802) (-668.808) [-669.233] -- 0:00:39
349500 -- (-668.354) (-668.298) (-667.439) [-666.536] * [-665.808] (-668.249) (-665.863) (-665.100) -- 0:00:39
350000 -- (-671.169) (-665.459) (-671.908) [-667.032] * (-669.153) (-665.472) [-668.975] (-665.370) -- 0:00:39
Average standard deviation of split frequencies: 0.011229
350500 -- [-671.439] (-669.307) (-665.649) (-666.062) * (-668.739) (-665.554) [-668.793] (-665.253) -- 0:00:38
351000 -- (-666.518) (-667.181) [-668.364] (-671.302) * (-670.258) [-665.577] (-668.163) (-665.600) -- 0:00:38
351500 -- (-667.706) (-670.299) (-669.342) [-669.144] * (-667.332) [-665.888] (-669.255) (-666.521) -- 0:00:38
352000 -- (-669.437) [-672.228] (-666.926) (-672.577) * (-666.521) (-671.311) [-665.670] (-665.455) -- 0:00:38
352500 -- [-666.369] (-665.255) (-667.094) (-667.621) * (-665.209) (-666.005) (-667.942) [-669.251] -- 0:00:38
353000 -- (-668.675) [-668.724] (-669.228) (-669.841) * (-670.005) [-665.961] (-669.415) (-667.822) -- 0:00:38
353500 -- (-669.408) [-666.653] (-666.977) (-667.811) * (-668.278) (-669.036) [-665.618] (-666.199) -- 0:00:38
354000 -- (-669.386) (-667.089) (-668.315) [-667.831] * (-669.835) (-671.078) (-667.944) [-668.367] -- 0:00:38
354500 -- [-666.322] (-667.071) (-666.786) (-666.326) * (-670.677) (-666.986) [-668.002] (-666.698) -- 0:00:38
355000 -- (-670.556) [-666.391] (-669.294) (-667.141) * (-667.567) (-667.929) (-667.688) [-671.996] -- 0:00:38
Average standard deviation of split frequencies: 0.011606
355500 -- (-668.833) (-665.187) (-667.102) [-671.277] * (-667.563) (-665.627) (-665.498) [-667.821] -- 0:00:38
356000 -- (-668.883) (-668.631) (-668.941) [-669.336] * (-667.136) (-666.639) (-667.624) [-667.670] -- 0:00:37
356500 -- (-668.360) (-667.853) [-668.002] (-671.970) * (-665.094) (-669.049) [-665.883] (-669.589) -- 0:00:37
357000 -- (-667.503) [-669.589] (-666.407) (-669.616) * [-668.666] (-666.636) (-665.963) (-671.345) -- 0:00:37
357500 -- (-667.041) [-667.608] (-666.495) (-671.414) * (-666.967) [-667.349] (-665.113) (-666.770) -- 0:00:37
358000 -- (-666.928) (-667.350) (-665.418) [-665.952] * (-665.886) [-666.805] (-665.287) (-666.388) -- 0:00:37
358500 -- (-667.402) [-666.827] (-665.442) (-665.602) * [-666.868] (-664.964) (-666.421) (-668.112) -- 0:00:37
359000 -- (-667.314) (-667.301) [-667.698] (-667.485) * (-668.891) (-666.233) (-667.604) [-671.472] -- 0:00:37
359500 -- (-668.208) (-668.372) (-668.353) [-666.431] * [-665.779] (-666.184) (-670.272) (-669.153) -- 0:00:37
360000 -- (-668.334) (-670.508) [-666.930] (-666.307) * [-666.167] (-665.624) (-667.243) (-668.441) -- 0:00:37
Average standard deviation of split frequencies: 0.012417
360500 -- (-669.162) [-668.496] (-666.673) (-666.537) * (-667.611) (-666.448) [-668.146] (-671.240) -- 0:00:37
361000 -- (-666.668) [-668.321] (-667.324) (-666.495) * (-666.905) (-666.572) (-668.131) [-669.328] -- 0:00:38
361500 -- (-667.744) (-667.275) (-667.703) [-666.479] * (-666.638) (-669.941) [-669.959] (-670.365) -- 0:00:38
362000 -- (-666.203) [-667.376] (-673.529) (-667.680) * (-666.078) [-667.585] (-669.815) (-670.055) -- 0:00:38
362500 -- (-665.628) (-666.314) [-667.972] (-670.833) * [-669.260] (-667.021) (-669.083) (-669.935) -- 0:00:38
363000 -- (-669.080) (-666.251) (-668.750) [-667.471] * (-670.027) (-666.673) (-672.236) [-666.349] -- 0:00:38
363500 -- (-666.399) (-665.172) [-667.071] (-665.529) * (-670.179) (-666.733) [-666.195] (-666.797) -- 0:00:38
364000 -- (-665.874) [-667.404] (-667.629) (-671.313) * [-666.506] (-665.384) (-667.021) (-665.998) -- 0:00:38
364500 -- [-667.050] (-665.842) (-665.585) (-667.585) * [-665.906] (-667.588) (-666.533) (-666.800) -- 0:00:38
365000 -- (-669.959) [-665.976] (-668.312) (-668.007) * [-666.473] (-666.187) (-666.764) (-669.271) -- 0:00:38
Average standard deviation of split frequencies: 0.011592
365500 -- (-665.330) (-666.058) (-666.589) [-665.974] * [-665.520] (-665.999) (-665.905) (-672.599) -- 0:00:38
366000 -- (-668.623) [-665.181] (-671.276) (-668.543) * [-665.682] (-667.292) (-668.411) (-665.616) -- 0:00:38
366500 -- (-667.319) [-669.551] (-667.539) (-668.884) * (-667.697) [-668.934] (-665.872) (-670.636) -- 0:00:38
367000 -- [-669.137] (-669.159) (-667.923) (-666.027) * (-667.548) (-666.897) (-666.701) [-667.412] -- 0:00:37
367500 -- (-665.765) (-667.580) (-668.123) [-668.892] * (-670.474) (-665.589) (-669.452) [-669.386] -- 0:00:37
368000 -- (-666.346) (-670.522) (-667.580) [-666.020] * (-669.930) (-666.327) [-665.830] (-668.058) -- 0:00:37
368500 -- [-675.009] (-668.932) (-667.325) (-668.204) * (-666.504) (-668.834) [-666.320] (-670.848) -- 0:00:37
369000 -- (-671.456) (-671.254) [-668.185] (-667.613) * [-665.736] (-666.694) (-669.299) (-667.513) -- 0:00:37
369500 -- [-668.036] (-667.504) (-666.796) (-667.529) * (-665.870) [-666.483] (-670.349) (-666.412) -- 0:00:37
370000 -- (-669.758) (-667.963) (-668.520) [-664.996] * [-667.322] (-667.066) (-672.897) (-666.932) -- 0:00:37
Average standard deviation of split frequencies: 0.011729
370500 -- (-666.459) [-667.379] (-667.758) (-667.034) * [-668.657] (-671.317) (-668.121) (-667.929) -- 0:00:37
371000 -- (-666.164) (-665.830) (-676.680) [-667.189] * (-668.349) [-668.939] (-668.107) (-670.021) -- 0:00:37
371500 -- (-666.668) (-668.051) [-668.957] (-665.282) * (-666.749) (-666.835) [-668.807] (-666.119) -- 0:00:37
372000 -- (-665.821) (-668.711) [-666.760] (-669.671) * (-666.948) [-665.779] (-671.293) (-670.065) -- 0:00:37
372500 -- (-667.317) [-665.571] (-667.930) (-666.422) * (-666.499) [-665.873] (-672.172) (-668.040) -- 0:00:37
373000 -- (-668.476) [-665.583] (-666.665) (-667.295) * [-668.073] (-666.190) (-666.219) (-668.578) -- 0:00:36
373500 -- (-668.586) (-666.218) [-666.112] (-668.068) * (-667.589) [-666.517] (-666.840) (-666.474) -- 0:00:36
374000 -- (-665.187) (-665.347) [-665.761] (-666.820) * (-670.681) [-667.297] (-665.769) (-676.951) -- 0:00:36
374500 -- [-665.687] (-665.738) (-667.430) (-667.239) * (-670.205) [-665.962] (-666.243) (-676.232) -- 0:00:36
375000 -- (-665.687) [-672.269] (-667.016) (-668.559) * (-670.961) (-670.514) [-666.366] (-670.132) -- 0:00:36
Average standard deviation of split frequencies: 0.011632
375500 -- (-664.957) (-666.928) (-670.797) [-666.409] * (-666.123) [-666.184] (-670.272) (-671.380) -- 0:00:36
376000 -- [-668.126] (-673.344) (-667.418) (-667.413) * [-668.003] (-665.547) (-665.238) (-666.510) -- 0:00:36
376500 -- [-667.384] (-669.120) (-666.486) (-667.655) * (-664.913) (-669.884) [-665.965] (-667.223) -- 0:00:36
377000 -- (-665.255) (-668.711) (-666.154) [-666.633] * (-666.393) [-666.094] (-666.845) (-668.160) -- 0:00:36
377500 -- (-669.057) (-666.088) (-665.276) [-665.918] * (-666.078) (-672.231) [-666.578] (-667.376) -- 0:00:36
378000 -- (-666.857) (-666.772) [-665.326] (-665.261) * (-667.288) (-667.562) (-665.720) [-666.205] -- 0:00:37
378500 -- (-666.694) (-666.055) [-666.134] (-665.460) * (-668.258) (-666.899) [-667.270] (-666.682) -- 0:00:37
379000 -- (-666.025) (-669.153) (-666.900) [-665.854] * [-669.685] (-669.144) (-667.365) (-664.804) -- 0:00:37
379500 -- (-666.103) (-667.809) [-669.626] (-666.639) * (-667.879) (-674.120) [-665.809] (-668.304) -- 0:00:37
380000 -- (-668.220) (-667.631) (-665.510) [-667.409] * (-665.912) [-667.806] (-667.505) (-668.115) -- 0:00:37
Average standard deviation of split frequencies: 0.010708
380500 -- (-666.370) (-671.058) [-667.450] (-667.824) * [-672.216] (-668.707) (-671.227) (-666.109) -- 0:00:37
381000 -- (-667.405) (-666.360) (-666.228) [-665.414] * (-665.988) (-667.343) (-669.057) [-666.093] -- 0:00:37
381500 -- (-666.035) (-666.364) (-672.041) [-668.579] * (-668.300) [-669.330] (-669.670) (-670.273) -- 0:00:37
382000 -- [-667.438] (-667.834) (-665.735) (-666.886) * [-665.366] (-669.212) (-666.427) (-667.289) -- 0:00:37
382500 -- (-666.535) [-665.860] (-665.809) (-667.925) * (-667.945) (-666.333) [-671.826] (-665.603) -- 0:00:37
383000 -- (-666.581) (-665.929) (-665.658) [-667.846] * (-668.416) (-667.378) (-668.732) [-665.800] -- 0:00:37
383500 -- [-665.361] (-666.528) (-666.364) (-668.906) * (-668.420) (-667.016) [-666.289] (-667.139) -- 0:00:36
384000 -- (-665.484) (-668.000) (-664.994) [-665.265] * [-665.753] (-671.528) (-665.352) (-666.374) -- 0:00:36
384500 -- (-666.132) (-668.634) [-665.977] (-665.265) * (-666.659) (-667.748) (-665.564) [-666.152] -- 0:00:36
385000 -- (-668.061) [-667.403] (-669.733) (-665.265) * (-666.083) (-666.438) [-667.759] (-665.575) -- 0:00:36
Average standard deviation of split frequencies: 0.011506
385500 -- (-666.331) [-666.311] (-667.361) (-665.431) * (-666.083) (-667.696) [-665.528] (-665.212) -- 0:00:36
386000 -- (-666.766) [-665.586] (-666.413) (-665.800) * (-666.768) [-666.866] (-666.210) (-665.538) -- 0:00:36
386500 -- (-667.541) (-665.893) (-667.075) [-668.109] * (-667.575) (-670.781) (-665.965) [-665.330] -- 0:00:36
387000 -- (-666.576) (-668.683) (-667.787) [-666.928] * (-665.968) (-667.099) [-666.343] (-666.767) -- 0:00:36
387500 -- (-668.709) (-669.252) (-665.744) [-671.130] * (-669.733) (-670.707) [-665.431] (-670.536) -- 0:00:36
388000 -- [-669.378] (-668.992) (-664.823) (-670.833) * (-667.065) (-665.803) [-666.699] (-666.020) -- 0:00:36
388500 -- (-667.281) [-667.387] (-665.417) (-665.650) * (-666.603) [-666.270] (-669.621) (-666.163) -- 0:00:36
389000 -- [-666.234] (-666.855) (-665.007) (-665.982) * (-666.600) [-667.393] (-666.289) (-666.525) -- 0:00:36
389500 -- [-665.319] (-666.182) (-665.788) (-667.667) * (-667.364) (-666.841) [-667.317] (-665.924) -- 0:00:36
390000 -- [-667.250] (-667.296) (-666.325) (-666.561) * [-665.996] (-666.788) (-665.190) (-666.390) -- 0:00:35
Average standard deviation of split frequencies: 0.011368
390500 -- [-666.774] (-666.973) (-670.939) (-665.510) * [-669.113] (-668.142) (-666.229) (-666.555) -- 0:00:35
391000 -- (-669.400) [-668.744] (-672.647) (-666.117) * (-667.112) (-668.180) (-666.381) [-666.160] -- 0:00:35
391500 -- (-666.943) (-668.862) [-666.810] (-668.236) * (-669.193) (-665.942) (-670.350) [-668.568] -- 0:00:35
392000 -- (-669.048) (-667.252) [-665.406] (-669.486) * [-666.604] (-667.096) (-666.618) (-666.932) -- 0:00:35
392500 -- [-667.222] (-671.416) (-666.838) (-667.799) * (-668.064) [-666.642] (-666.276) (-666.618) -- 0:00:35
393000 -- (-665.698) [-668.908] (-665.938) (-667.706) * (-671.358) (-667.412) (-667.459) [-665.862] -- 0:00:35
393500 -- [-666.524] (-665.634) (-667.650) (-665.671) * (-668.181) [-665.818] (-666.824) (-667.112) -- 0:00:35
394000 -- [-667.807] (-668.505) (-665.232) (-665.869) * (-667.351) [-665.164] (-668.324) (-665.961) -- 0:00:35
394500 -- (-668.019) (-673.236) (-665.378) [-669.365] * (-670.146) (-666.151) [-669.166] (-667.470) -- 0:00:35
395000 -- (-665.617) (-672.495) [-665.699] (-669.610) * (-666.214) (-666.759) (-667.289) [-667.335] -- 0:00:36
Average standard deviation of split frequencies: 0.010515
395500 -- [-667.853] (-665.822) (-665.796) (-666.540) * [-666.763] (-665.452) (-666.192) (-666.772) -- 0:00:36
396000 -- [-668.734] (-665.541) (-667.144) (-669.323) * [-666.255] (-665.813) (-670.367) (-672.088) -- 0:00:36
396500 -- [-666.534] (-668.634) (-666.845) (-665.886) * (-667.047) (-665.784) (-666.294) [-668.452] -- 0:00:36
397000 -- (-669.000) (-667.269) (-665.882) [-668.921] * [-665.599] (-666.421) (-666.803) (-665.212) -- 0:00:36
397500 -- (-670.352) [-668.030] (-669.136) (-669.644) * [-667.487] (-667.584) (-666.307) (-666.734) -- 0:00:36
398000 -- (-668.912) (-666.877) (-669.661) [-671.073] * (-670.444) [-666.171] (-668.274) (-666.882) -- 0:00:36
398500 -- (-667.905) [-666.008] (-667.704) (-669.369) * (-668.219) (-665.653) (-667.574) [-666.671] -- 0:00:36
399000 -- (-668.369) (-667.138) (-667.475) [-666.354] * (-669.949) (-668.065) (-667.774) [-666.609] -- 0:00:36
399500 -- (-667.242) [-669.142] (-671.257) (-666.407) * (-668.218) [-667.232] (-668.461) (-671.830) -- 0:00:36
400000 -- (-666.790) (-669.337) [-666.180] (-665.683) * (-666.490) (-666.155) (-669.254) [-668.517] -- 0:00:36
Average standard deviation of split frequencies: 0.010720
400500 -- [-666.149] (-667.854) (-667.962) (-667.500) * (-665.577) (-666.048) (-666.937) [-665.486] -- 0:00:35
401000 -- (-664.942) (-665.501) (-667.011) [-666.275] * [-666.787] (-667.616) (-671.392) (-665.813) -- 0:00:35
401500 -- (-672.438) [-665.356] (-666.985) (-665.613) * (-665.967) (-671.502) (-668.880) [-668.631] -- 0:00:35
402000 -- (-678.068) (-665.512) [-668.023] (-669.150) * [-667.216] (-671.848) (-667.179) (-668.256) -- 0:00:35
402500 -- (-666.649) (-665.444) (-668.520) [-668.265] * [-667.564] (-673.665) (-668.616) (-667.416) -- 0:00:35
403000 -- [-667.368] (-666.607) (-671.031) (-669.488) * (-668.974) [-672.297] (-669.235) (-667.855) -- 0:00:35
403500 -- (-667.856) [-666.103] (-668.550) (-668.482) * [-667.478] (-665.945) (-668.071) (-668.117) -- 0:00:35
404000 -- (-666.131) (-667.399) [-668.280] (-668.152) * [-667.443] (-665.573) (-667.894) (-667.809) -- 0:00:35
404500 -- [-665.294] (-667.642) (-667.890) (-666.902) * (-665.706) [-666.277] (-668.368) (-670.638) -- 0:00:35
405000 -- (-668.037) (-666.430) (-669.615) [-666.636] * (-666.520) (-668.458) (-668.777) [-669.049] -- 0:00:35
Average standard deviation of split frequencies: 0.010643
405500 -- (-665.174) (-666.416) [-666.312] (-666.180) * (-666.501) [-669.350] (-667.314) (-672.424) -- 0:00:35
406000 -- (-666.195) (-669.583) [-666.199] (-666.886) * [-668.796] (-666.984) (-667.616) (-667.597) -- 0:00:35
406500 -- [-667.136] (-665.112) (-666.971) (-667.995) * (-668.401) (-666.520) (-667.513) [-667.728] -- 0:00:35
407000 -- [-665.888] (-666.610) (-668.569) (-668.490) * [-665.915] (-666.066) (-669.058) (-669.107) -- 0:00:34
407500 -- [-667.545] (-667.482) (-668.642) (-667.430) * (-667.162) (-667.643) [-666.686] (-668.707) -- 0:00:34
408000 -- [-666.406] (-666.672) (-668.712) (-667.831) * [-665.777] (-668.468) (-670.278) (-666.337) -- 0:00:34
408500 -- (-665.914) (-669.983) (-667.444) [-664.998] * [-666.166] (-668.112) (-667.878) (-667.136) -- 0:00:34
409000 -- (-667.348) (-666.176) (-667.168) [-666.622] * (-669.506) (-668.839) (-666.955) [-668.602] -- 0:00:34
409500 -- (-665.790) (-671.336) [-668.856] (-669.863) * (-666.602) [-666.573] (-668.111) (-666.305) -- 0:00:34
410000 -- (-668.970) (-670.783) [-665.744] (-665.659) * (-666.686) [-666.493] (-667.057) (-667.000) -- 0:00:34
Average standard deviation of split frequencies: 0.010650
410500 -- (-667.649) [-668.396] (-668.475) (-666.018) * (-667.240) (-667.673) [-667.991] (-666.554) -- 0:00:34
411000 -- (-668.767) [-667.263] (-668.495) (-666.863) * [-665.614] (-666.406) (-665.738) (-666.899) -- 0:00:34
411500 -- (-667.796) [-665.562] (-668.754) (-666.279) * (-666.965) (-665.055) [-668.669] (-670.245) -- 0:00:35
412000 -- (-666.630) (-668.449) (-666.725) [-665.399] * (-666.939) (-667.057) [-669.473] (-668.604) -- 0:00:35
412500 -- [-666.813] (-670.507) (-671.099) (-666.311) * [-666.258] (-668.146) (-669.171) (-666.993) -- 0:00:35
413000 -- [-666.257] (-667.300) (-670.801) (-666.541) * (-669.551) (-673.399) [-668.025] (-667.879) -- 0:00:35
413500 -- [-666.143] (-666.547) (-667.503) (-667.763) * [-665.803] (-670.343) (-670.921) (-668.861) -- 0:00:35
414000 -- [-666.329] (-668.802) (-666.999) (-665.905) * (-667.448) (-667.793) (-666.907) [-666.584] -- 0:00:35
414500 -- (-672.222) [-665.607] (-669.430) (-670.777) * [-667.015] (-669.032) (-671.036) (-668.657) -- 0:00:35
415000 -- (-666.549) [-666.091] (-667.031) (-667.372) * (-665.270) [-667.141] (-667.485) (-670.192) -- 0:00:35
Average standard deviation of split frequencies: 0.011269
415500 -- (-668.712) [-670.847] (-668.690) (-666.294) * (-665.426) [-667.218] (-671.546) (-670.077) -- 0:00:35
416000 -- (-665.119) (-666.942) [-668.093] (-666.727) * (-667.894) (-668.306) [-666.799] (-665.582) -- 0:00:35
416500 -- (-665.973) (-666.589) (-671.831) [-667.615] * (-666.514) (-667.725) (-668.101) [-665.334] -- 0:00:35
417000 -- (-666.994) (-666.863) [-669.811] (-668.269) * (-666.167) [-665.484] (-668.823) (-667.501) -- 0:00:34
417500 -- [-667.764] (-675.344) (-668.045) (-667.978) * (-665.511) [-666.614] (-673.299) (-667.732) -- 0:00:34
418000 -- (-665.990) (-670.782) [-665.615] (-666.238) * [-665.870] (-667.049) (-665.543) (-668.161) -- 0:00:34
418500 -- (-668.592) (-667.518) (-666.229) [-666.300] * (-670.580) (-669.916) [-667.445] (-668.815) -- 0:00:34
419000 -- (-668.027) [-667.426] (-666.806) (-667.485) * [-666.390] (-666.786) (-667.222) (-667.237) -- 0:00:34
419500 -- (-667.138) (-666.253) (-666.251) [-666.698] * (-666.302) (-665.946) [-666.981] (-668.498) -- 0:00:34
420000 -- (-666.684) (-669.978) [-666.903] (-666.526) * [-666.293] (-667.644) (-666.671) (-669.839) -- 0:00:34
Average standard deviation of split frequencies: 0.011602
420500 -- (-666.156) (-667.579) [-665.713] (-667.952) * (-666.250) [-665.589] (-668.749) (-669.576) -- 0:00:34
421000 -- (-667.868) [-666.975] (-665.802) (-668.181) * (-666.951) (-668.025) (-674.584) [-672.146] -- 0:00:34
421500 -- (-665.767) (-665.370) (-672.882) [-668.881] * (-667.172) (-665.766) [-669.849] (-667.190) -- 0:00:34
422000 -- (-667.756) [-667.649] (-672.308) (-666.813) * (-668.488) (-668.002) [-667.805] (-672.201) -- 0:00:34
422500 -- [-666.345] (-670.717) (-669.351) (-665.649) * (-670.754) (-670.573) (-666.703) [-671.746] -- 0:00:34
423000 -- (-664.952) (-666.378) (-665.921) [-668.760] * [-667.730] (-666.294) (-668.250) (-668.059) -- 0:00:34
423500 -- (-667.199) [-665.840] (-667.246) (-669.569) * (-666.096) [-665.027] (-669.179) (-668.855) -- 0:00:34
424000 -- (-669.113) (-667.025) [-666.735] (-667.837) * (-667.236) [-666.678] (-666.036) (-674.133) -- 0:00:33
424500 -- (-675.899) (-665.417) (-666.132) [-670.144] * (-666.051) (-666.884) (-666.364) [-664.929] -- 0:00:33
425000 -- (-669.966) [-665.142] (-666.877) (-675.819) * (-666.915) (-665.397) (-671.341) [-667.034] -- 0:00:33
Average standard deviation of split frequencies: 0.011196
425500 -- (-667.627) (-669.704) (-670.842) [-668.454] * (-665.725) (-665.377) (-668.716) [-669.903] -- 0:00:33
426000 -- (-666.053) (-668.850) [-665.562] (-668.382) * (-665.960) (-666.535) [-665.697] (-665.518) -- 0:00:33
426500 -- (-669.958) [-668.218] (-668.353) (-668.290) * [-665.966] (-665.465) (-666.361) (-665.016) -- 0:00:33
427000 -- (-670.822) (-670.860) (-668.794) [-665.920] * (-669.083) (-667.939) [-666.360] (-665.762) -- 0:00:33
427500 -- [-669.220] (-666.838) (-666.722) (-665.284) * (-669.288) (-669.377) (-665.922) [-666.294] -- 0:00:33
428000 -- (-670.961) (-669.148) (-672.036) [-669.230] * (-670.932) [-665.805] (-671.337) (-666.615) -- 0:00:33
428500 -- [-667.774] (-667.722) (-666.322) (-667.510) * (-670.641) [-665.218] (-670.291) (-667.182) -- 0:00:34
429000 -- (-667.639) [-667.858] (-667.706) (-666.079) * (-666.572) [-666.626] (-667.425) (-665.722) -- 0:00:34
429500 -- (-666.820) [-665.579] (-665.869) (-667.184) * (-667.949) (-666.348) [-670.223] (-666.076) -- 0:00:34
430000 -- (-666.049) (-668.397) [-665.684] (-665.572) * (-667.730) [-667.915] (-667.614) (-666.454) -- 0:00:34
Average standard deviation of split frequencies: 0.011010
430500 -- (-665.449) (-666.825) [-666.600] (-665.616) * [-666.150] (-666.936) (-666.962) (-666.117) -- 0:00:34
431000 -- (-666.689) [-666.209] (-665.686) (-666.697) * (-670.143) (-669.284) [-667.629] (-667.721) -- 0:00:34
431500 -- (-669.883) [-665.735] (-668.486) (-667.393) * (-668.424) [-665.160] (-665.487) (-666.307) -- 0:00:34
432000 -- (-668.904) (-665.789) [-667.167] (-670.929) * (-667.447) (-665.140) (-666.916) [-667.423] -- 0:00:34
432500 -- [-669.680] (-666.125) (-665.347) (-667.714) * [-666.225] (-666.588) (-667.300) (-670.014) -- 0:00:34
433000 -- (-669.331) (-665.337) (-666.683) [-668.102] * (-666.698) (-666.640) [-666.829] (-667.826) -- 0:00:34
433500 -- (-669.776) (-666.445) [-668.676] (-667.580) * (-666.780) (-670.142) [-667.540] (-668.461) -- 0:00:33
434000 -- (-667.644) [-667.389] (-670.398) (-665.971) * (-665.573) (-668.401) [-667.337] (-671.494) -- 0:00:33
434500 -- [-668.363] (-666.388) (-668.670) (-665.650) * (-669.399) (-667.028) [-667.213] (-668.978) -- 0:00:33
435000 -- [-667.393] (-666.840) (-666.443) (-667.402) * (-666.023) (-668.276) [-666.646] (-670.890) -- 0:00:33
Average standard deviation of split frequencies: 0.010558
435500 -- (-665.498) (-666.430) (-666.365) [-667.035] * (-668.754) (-670.317) (-666.086) [-667.303] -- 0:00:33
436000 -- (-665.792) [-666.522] (-670.897) (-669.818) * [-666.574] (-670.173) (-669.571) (-667.248) -- 0:00:33
436500 -- (-668.727) (-666.583) (-665.379) [-666.747] * (-670.972) (-667.436) [-668.135] (-669.069) -- 0:00:33
437000 -- (-669.463) (-669.017) (-665.528) [-666.114] * (-670.933) [-667.669] (-666.594) (-667.269) -- 0:00:33
437500 -- (-667.572) (-665.739) (-665.612) [-670.796] * (-668.038) (-669.599) (-670.681) [-671.206] -- 0:00:33
438000 -- (-666.290) (-666.956) (-665.649) [-668.010] * (-670.237) (-668.280) [-671.742] (-666.587) -- 0:00:33
438500 -- (-669.404) (-666.847) (-666.893) [-667.318] * (-671.815) [-666.886] (-670.995) (-667.475) -- 0:00:33
439000 -- (-669.744) (-666.762) (-668.768) [-668.072] * (-666.382) (-668.712) (-670.103) [-665.786] -- 0:00:33
439500 -- (-667.228) [-666.431] (-668.891) (-667.732) * (-667.789) (-667.213) [-668.364] (-665.523) -- 0:00:33
440000 -- [-669.755] (-667.633) (-667.369) (-668.672) * [-665.109] (-665.682) (-666.416) (-665.406) -- 0:00:33
Average standard deviation of split frequencies: 0.010635
440500 -- [-667.738] (-666.268) (-670.063) (-667.422) * (-668.389) (-670.463) (-665.915) [-665.618] -- 0:00:33
441000 -- (-666.172) (-668.009) (-666.341) [-665.361] * (-666.497) (-667.212) [-668.007] (-666.266) -- 0:00:32
441500 -- [-665.882] (-667.131) (-671.884) (-666.024) * (-666.562) (-666.052) (-666.504) [-665.406] -- 0:00:32
442000 -- (-670.565) (-667.114) (-670.008) [-666.024] * (-665.839) (-666.909) (-665.719) [-666.494] -- 0:00:32
442500 -- [-666.579] (-670.307) (-667.741) (-665.088) * (-667.351) (-666.425) (-668.069) [-665.345] -- 0:00:32
443000 -- [-668.060] (-665.605) (-666.573) (-667.245) * (-669.399) [-665.828] (-668.769) (-665.608) -- 0:00:32
443500 -- (-666.067) (-666.882) (-665.754) [-665.852] * (-671.329) [-666.890] (-666.723) (-667.333) -- 0:00:32
444000 -- (-667.274) [-667.706] (-666.778) (-665.797) * (-667.647) (-665.170) (-666.996) [-665.587] -- 0:00:32
444500 -- (-669.743) [-670.156] (-667.870) (-666.531) * (-666.321) (-669.116) (-666.115) [-666.438] -- 0:00:32
445000 -- (-667.089) (-669.634) (-669.049) [-667.106] * (-671.830) [-669.487] (-666.395) (-665.339) -- 0:00:32
Average standard deviation of split frequencies: 0.010259
445500 -- (-667.133) (-670.560) (-666.741) [-666.809] * (-665.357) [-667.068] (-667.570) (-665.402) -- 0:00:33
446000 -- (-666.429) (-668.195) [-666.938] (-668.339) * [-666.261] (-667.581) (-667.450) (-666.749) -- 0:00:33
446500 -- (-666.914) (-666.315) (-666.410) [-665.033] * (-666.780) (-669.837) [-667.414] (-666.566) -- 0:00:33
447000 -- [-666.006] (-667.095) (-668.489) (-665.098) * [-670.090] (-666.240) (-666.253) (-665.156) -- 0:00:33
447500 -- [-668.345] (-667.151) (-665.949) (-667.376) * [-668.282] (-667.625) (-666.563) (-667.560) -- 0:00:33
448000 -- (-669.782) (-666.751) [-667.252] (-666.467) * (-669.562) (-665.338) (-670.071) [-665.706] -- 0:00:33
448500 -- (-670.887) (-671.439) (-668.114) [-666.954] * (-665.964) [-666.231] (-671.011) (-665.847) -- 0:00:33
449000 -- (-668.101) [-665.558] (-669.563) (-667.469) * (-666.068) (-668.785) [-668.269] (-670.128) -- 0:00:33
449500 -- [-669.968] (-665.779) (-669.654) (-666.361) * [-667.297] (-666.933) (-667.032) (-669.243) -- 0:00:33
450000 -- (-666.991) [-669.807] (-667.205) (-667.436) * (-672.103) [-666.610] (-666.141) (-665.659) -- 0:00:33
Average standard deviation of split frequencies: 0.010706
450500 -- (-666.667) (-670.255) (-668.348) [-669.075] * (-667.484) (-666.081) (-667.501) [-667.175] -- 0:00:32
451000 -- (-666.123) [-669.419] (-665.333) (-670.969) * (-667.404) (-669.065) (-665.272) [-667.590] -- 0:00:32
451500 -- (-671.278) (-670.285) (-665.068) [-666.425] * (-670.462) (-666.105) [-667.273] (-665.689) -- 0:00:32
452000 -- [-668.888] (-668.288) (-667.189) (-665.286) * (-668.008) (-667.049) (-667.734) [-666.812] -- 0:00:32
452500 -- (-666.997) [-665.341] (-667.526) (-666.588) * [-665.180] (-667.470) (-665.718) (-665.932) -- 0:00:32
453000 -- (-668.167) (-666.184) [-670.220] (-665.493) * (-665.693) (-671.167) (-667.108) [-666.233] -- 0:00:32
453500 -- (-667.859) [-668.469] (-668.294) (-668.637) * [-666.477] (-670.390) (-672.775) (-668.030) -- 0:00:32
454000 -- [-665.773] (-666.197) (-666.803) (-666.139) * (-667.304) (-669.622) (-667.539) [-667.255] -- 0:00:32
454500 -- (-665.965) (-670.955) [-666.601] (-665.261) * [-667.588] (-669.774) (-667.469) (-667.929) -- 0:00:32
455000 -- (-666.699) (-668.074) [-668.151] (-665.498) * [-668.313] (-669.528) (-669.037) (-671.762) -- 0:00:32
Average standard deviation of split frequencies: 0.009878
455500 -- (-669.056) (-668.421) [-667.694] (-669.795) * (-667.068) (-674.969) [-667.974] (-669.500) -- 0:00:32
456000 -- (-666.473) [-668.858] (-665.899) (-676.450) * (-668.081) [-667.418] (-670.585) (-665.871) -- 0:00:32
456500 -- (-667.405) (-674.266) (-666.685) [-669.330] * [-666.357] (-669.182) (-667.257) (-669.407) -- 0:00:32
457000 -- (-666.004) [-666.472] (-670.483) (-670.790) * (-666.770) (-668.689) (-668.412) [-665.633] -- 0:00:32
457500 -- (-669.465) [-665.749] (-668.668) (-666.795) * [-667.107] (-667.285) (-669.925) (-666.881) -- 0:00:32
458000 -- (-668.336) (-667.426) (-667.567) [-668.008] * (-667.906) [-666.350] (-667.596) (-665.919) -- 0:00:31
458500 -- (-666.987) (-666.210) [-665.512] (-669.186) * (-666.722) [-667.873] (-666.657) (-667.751) -- 0:00:31
459000 -- (-666.312) [-670.397] (-670.732) (-666.952) * (-669.027) (-670.250) (-668.065) [-669.059] -- 0:00:31
459500 -- (-671.539) (-669.377) (-668.329) [-666.661] * (-670.771) (-668.233) [-668.083] (-666.051) -- 0:00:31
460000 -- [-669.800] (-666.048) (-668.302) (-667.185) * (-668.644) (-667.754) [-665.367] (-668.471) -- 0:00:31
Average standard deviation of split frequencies: 0.009270
460500 -- (-665.453) (-667.223) (-667.815) [-666.546] * [-668.098] (-667.877) (-667.326) (-667.567) -- 0:00:31
461000 -- (-666.754) [-666.387] (-665.004) (-671.459) * (-669.592) [-666.200] (-665.340) (-666.245) -- 0:00:31
461500 -- (-666.878) [-665.699] (-666.113) (-666.831) * [-669.476] (-666.382) (-665.511) (-668.315) -- 0:00:31
462000 -- (-666.602) [-666.043] (-666.003) (-667.420) * [-670.902] (-670.833) (-666.964) (-665.772) -- 0:00:31
462500 -- (-666.242) (-665.608) [-668.421] (-666.176) * (-670.099) (-667.353) (-666.939) [-665.841] -- 0:00:32
463000 -- (-666.497) (-665.444) (-668.614) [-668.762] * (-668.205) (-664.838) (-666.567) [-667.622] -- 0:00:32
463500 -- (-666.533) (-671.481) [-667.468] (-667.645) * (-669.036) (-666.935) [-670.978] (-666.273) -- 0:00:32
464000 -- [-667.449] (-668.133) (-667.685) (-665.900) * (-668.851) (-665.645) (-665.845) [-666.671] -- 0:00:32
464500 -- (-669.297) (-667.518) (-668.758) [-666.008] * (-667.411) [-665.458] (-666.068) (-666.639) -- 0:00:32
465000 -- [-666.416] (-669.282) (-669.630) (-665.878) * (-666.089) [-665.637] (-665.486) (-668.425) -- 0:00:32
Average standard deviation of split frequencies: 0.009640
465500 -- [-666.266] (-665.612) (-667.121) (-665.573) * (-667.022) [-667.308] (-665.394) (-668.207) -- 0:00:32
466000 -- (-667.022) (-666.107) [-668.637] (-666.435) * (-669.498) [-665.649] (-666.248) (-669.384) -- 0:00:32
466500 -- (-668.130) (-666.868) [-670.360] (-669.653) * (-668.416) (-666.669) [-665.845] (-667.249) -- 0:00:32
467000 -- [-665.394] (-667.360) (-668.105) (-666.646) * (-668.964) [-673.016] (-668.586) (-668.372) -- 0:00:31
467500 -- (-666.442) (-666.357) [-668.762] (-665.282) * (-665.411) (-666.234) (-670.079) [-669.173] -- 0:00:31
468000 -- [-666.075] (-670.762) (-667.467) (-667.193) * [-665.413] (-666.058) (-668.657) (-666.141) -- 0:00:31
468500 -- (-665.779) [-666.016] (-668.034) (-667.734) * (-667.156) [-667.609] (-670.023) (-666.927) -- 0:00:31
469000 -- [-667.202] (-667.355) (-668.503) (-665.562) * [-665.701] (-665.496) (-668.838) (-665.663) -- 0:00:31
469500 -- (-668.390) [-665.386] (-666.423) (-666.600) * (-665.144) [-665.103] (-665.660) (-665.995) -- 0:00:31
470000 -- (-668.975) (-667.011) [-666.136] (-664.981) * [-668.951] (-665.295) (-665.787) (-667.288) -- 0:00:31
Average standard deviation of split frequencies: 0.009368
470500 -- (-668.948) (-667.135) [-665.216] (-667.652) * (-668.697) [-667.070] (-665.733) (-665.665) -- 0:00:31
471000 -- (-668.315) [-669.216] (-665.283) (-666.287) * (-668.912) [-668.240] (-666.099) (-665.872) -- 0:00:31
471500 -- (-667.664) (-667.240) [-665.650] (-667.260) * (-669.125) (-666.841) [-666.875] (-666.841) -- 0:00:31
472000 -- (-668.443) (-668.062) (-667.626) [-668.446] * (-674.245) (-667.824) (-667.823) [-667.204] -- 0:00:31
472500 -- (-667.179) [-669.623] (-668.383) (-674.459) * (-675.505) (-669.478) [-669.446] (-667.679) -- 0:00:31
473000 -- (-665.958) (-666.078) [-665.926] (-668.277) * (-668.615) (-666.325) (-670.810) [-666.593] -- 0:00:31
473500 -- [-668.248] (-668.357) (-666.969) (-665.019) * (-668.281) (-666.528) [-666.640] (-667.160) -- 0:00:31
474000 -- (-669.840) (-665.607) (-669.363) [-666.393] * [-668.207] (-668.818) (-666.830) (-665.519) -- 0:00:31
474500 -- [-666.197] (-667.688) (-667.696) (-665.367) * [-670.914] (-671.718) (-667.241) (-666.469) -- 0:00:31
475000 -- [-666.285] (-671.894) (-668.562) (-671.405) * (-667.966) [-666.647] (-667.981) (-668.435) -- 0:00:30
Average standard deviation of split frequencies: 0.009962
475500 -- [-666.311] (-666.615) (-666.233) (-668.221) * (-666.945) (-666.877) [-665.846] (-667.383) -- 0:00:30
476000 -- (-667.690) (-668.717) [-667.820] (-666.820) * (-668.924) (-667.506) (-668.868) [-665.159] -- 0:00:30
476500 -- (-666.337) (-667.804) [-667.713] (-671.135) * (-668.871) (-666.476) (-666.313) [-665.306] -- 0:00:30
477000 -- (-666.187) [-667.041] (-671.419) (-670.571) * (-666.909) (-669.506) [-668.139] (-668.330) -- 0:00:30
477500 -- (-665.436) [-666.885] (-667.848) (-668.867) * (-666.103) (-667.587) [-667.177] (-668.657) -- 0:00:30
478000 -- (-668.788) (-666.725) (-667.322) [-669.284] * (-668.864) (-666.390) (-668.093) [-670.125] -- 0:00:30
478500 -- [-668.093] (-665.705) (-672.843) (-666.153) * (-670.115) (-665.849) (-665.695) [-668.333] -- 0:00:30
479000 -- (-670.098) (-665.983) [-668.098] (-666.773) * (-668.218) [-665.639] (-665.758) (-666.079) -- 0:00:30
479500 -- (-666.066) (-665.604) [-666.884] (-665.490) * [-670.118] (-665.205) (-666.362) (-666.904) -- 0:00:31
480000 -- (-665.563) (-666.080) [-667.347] (-666.696) * (-666.276) (-666.567) (-666.575) [-666.137] -- 0:00:31
Average standard deviation of split frequencies: 0.010327
480500 -- (-665.440) [-668.688] (-670.455) (-666.795) * (-665.108) (-668.081) (-665.880) [-668.874] -- 0:00:31
481000 -- (-668.711) [-667.188] (-667.232) (-667.549) * (-665.905) (-665.877) (-667.248) [-672.149] -- 0:00:31
481500 -- [-665.810] (-669.264) (-666.402) (-670.697) * (-667.650) (-666.014) [-666.271] (-666.037) -- 0:00:31
482000 -- (-665.674) (-665.717) [-667.963] (-672.224) * (-667.466) (-666.224) [-667.914] (-669.483) -- 0:00:31
482500 -- [-666.080] (-667.981) (-667.081) (-672.713) * (-668.763) (-665.740) [-666.724] (-668.201) -- 0:00:31
483000 -- (-665.199) [-665.878] (-666.466) (-668.669) * (-669.446) (-670.616) [-665.456] (-666.651) -- 0:00:31
483500 -- [-666.535] (-669.410) (-669.269) (-665.091) * (-666.011) (-667.449) [-668.152] (-667.783) -- 0:00:30
484000 -- (-671.720) (-668.397) [-666.206] (-668.770) * (-665.974) (-667.792) [-666.650] (-668.589) -- 0:00:30
484500 -- (-665.366) [-668.266] (-666.339) (-666.820) * (-665.670) (-672.253) (-666.286) [-667.358] -- 0:00:30
485000 -- (-670.096) [-669.121] (-668.604) (-666.606) * (-670.653) (-668.590) [-667.915] (-666.400) -- 0:00:30
Average standard deviation of split frequencies: 0.009871
485500 -- (-667.175) [-667.984] (-666.760) (-667.862) * [-667.132] (-668.847) (-668.750) (-667.026) -- 0:00:30
486000 -- (-667.953) (-669.624) [-667.404] (-674.256) * (-666.068) (-667.104) (-667.103) [-665.715] -- 0:00:30
486500 -- (-668.757) (-666.625) [-667.715] (-666.628) * (-667.357) (-667.454) (-669.146) [-666.593] -- 0:00:30
487000 -- (-669.057) (-666.984) [-669.806] (-670.051) * [-667.053] (-666.893) (-666.357) (-667.565) -- 0:00:30
487500 -- [-667.422] (-666.989) (-666.784) (-672.542) * [-666.823] (-666.852) (-668.661) (-669.341) -- 0:00:30
488000 -- (-667.934) (-666.588) [-668.152] (-665.957) * (-667.155) [-668.217] (-668.687) (-666.511) -- 0:00:30
488500 -- (-667.063) (-667.159) [-666.364] (-665.535) * (-670.809) (-667.221) (-665.423) [-666.476] -- 0:00:30
489000 -- [-667.876] (-670.073) (-667.466) (-669.628) * [-667.285] (-666.163) (-666.648) (-666.562) -- 0:00:30
489500 -- (-670.052) (-666.724) [-667.511] (-666.233) * (-669.393) [-665.989] (-666.251) (-666.764) -- 0:00:30
490000 -- (-668.246) (-668.559) (-671.078) [-666.442] * (-669.584) (-665.877) [-665.450] (-665.371) -- 0:00:30
Average standard deviation of split frequencies: 0.010286
490500 -- (-670.360) [-665.187] (-671.995) (-670.224) * (-666.728) (-665.976) [-667.051] (-667.212) -- 0:00:30
491000 -- (-668.653) (-667.861) (-667.879) [-665.860] * (-668.403) (-668.628) [-666.723] (-666.646) -- 0:00:30
491500 -- (-673.567) (-665.883) [-667.614] (-665.863) * (-670.080) [-667.562] (-666.312) (-665.399) -- 0:00:30
492000 -- [-668.241] (-667.809) (-668.657) (-666.780) * (-667.721) (-667.605) (-666.505) [-666.837] -- 0:00:29
492500 -- (-668.289) [-667.704] (-666.607) (-666.838) * (-668.191) (-668.349) (-667.384) [-669.334] -- 0:00:29
493000 -- (-666.845) (-667.148) [-665.676] (-672.689) * (-665.338) [-666.027] (-668.779) (-669.050) -- 0:00:29
493500 -- (-666.186) (-665.921) (-666.055) [-666.896] * (-665.343) (-671.087) (-667.337) [-671.186] -- 0:00:29
494000 -- (-668.671) (-665.276) [-665.935] (-666.549) * (-664.868) (-665.663) [-666.322] (-668.219) -- 0:00:29
494500 -- (-671.946) [-666.526] (-668.068) (-666.087) * [-666.999] (-667.349) (-668.116) (-666.746) -- 0:00:29
495000 -- (-668.746) (-669.255) (-667.209) [-665.693] * [-665.385] (-665.404) (-668.291) (-668.922) -- 0:00:29
Average standard deviation of split frequencies: 0.010566
495500 -- [-670.445] (-669.497) (-669.117) (-669.440) * [-665.298] (-668.274) (-666.873) (-668.606) -- 0:00:29
496000 -- [-667.174] (-665.210) (-667.734) (-667.185) * (-668.903) (-665.582) (-666.225) [-665.784] -- 0:00:30
496500 -- (-667.695) (-665.152) [-665.519] (-666.763) * (-667.313) [-667.275] (-666.468) (-666.363) -- 0:00:30
497000 -- [-672.346] (-668.745) (-666.838) (-668.069) * (-666.865) [-666.458] (-666.968) (-666.586) -- 0:00:30
497500 -- (-666.235) (-672.549) (-668.294) [-666.270] * (-665.954) (-669.733) [-665.439] (-665.665) -- 0:00:30
498000 -- [-668.997] (-672.756) (-669.507) (-667.561) * (-665.954) [-669.696] (-667.030) (-666.980) -- 0:00:30
498500 -- [-668.772] (-666.473) (-669.104) (-666.214) * (-665.469) [-665.511] (-668.695) (-665.720) -- 0:00:30
499000 -- (-669.910) (-666.984) [-667.434] (-666.371) * [-669.283] (-665.296) (-667.470) (-665.722) -- 0:00:30
499500 -- [-666.529] (-669.790) (-667.930) (-666.930) * (-667.756) (-664.941) [-667.084] (-666.770) -- 0:00:30
500000 -- (-671.278) (-667.898) [-666.639] (-665.559) * [-665.803] (-667.740) (-665.500) (-666.864) -- 0:00:30
Average standard deviation of split frequencies: 0.010136
500500 -- [-667.088] (-667.039) (-665.419) (-665.289) * (-665.776) (-665.935) (-666.115) [-667.869] -- 0:00:29
501000 -- (-666.021) [-665.942] (-666.318) (-666.388) * [-665.395] (-666.607) (-671.151) (-668.041) -- 0:00:29
501500 -- (-665.837) [-667.703] (-672.831) (-666.786) * [-665.986] (-668.163) (-665.249) (-665.882) -- 0:00:29
502000 -- (-671.652) (-667.221) [-669.131] (-666.247) * [-665.265] (-670.389) (-665.251) (-665.752) -- 0:00:29
502500 -- (-666.625) [-667.516] (-666.971) (-666.486) * (-666.836) (-668.194) (-668.133) [-666.243] -- 0:00:29
503000 -- (-666.423) (-669.467) [-667.162] (-666.501) * [-669.134] (-667.750) (-669.284) (-670.922) -- 0:00:29
503500 -- [-666.292] (-671.261) (-667.260) (-673.146) * (-666.388) (-667.427) (-666.110) [-666.411] -- 0:00:29
504000 -- (-669.925) [-667.851] (-668.116) (-670.302) * [-672.569] (-670.614) (-665.749) (-673.332) -- 0:00:29
504500 -- [-665.603] (-669.030) (-668.397) (-665.840) * (-668.248) [-671.037] (-666.036) (-666.323) -- 0:00:29
505000 -- (-665.400) (-665.923) [-667.339] (-666.698) * [-670.537] (-667.767) (-668.372) (-668.917) -- 0:00:29
Average standard deviation of split frequencies: 0.009974
505500 -- [-665.820] (-668.418) (-665.420) (-666.264) * (-670.924) (-665.129) [-666.831] (-667.186) -- 0:00:29
506000 -- (-668.099) (-665.743) (-665.623) [-667.900] * (-669.114) (-665.888) (-667.356) [-665.468] -- 0:00:29
506500 -- (-667.120) [-668.802] (-665.510) (-669.635) * (-667.646) [-666.882] (-669.905) (-668.077) -- 0:00:29
507000 -- (-667.311) (-666.169) [-668.337] (-668.414) * (-668.451) (-668.478) (-668.555) [-666.432] -- 0:00:29
507500 -- (-670.016) (-669.521) [-667.026] (-666.086) * [-666.761] (-667.746) (-666.573) (-666.535) -- 0:00:29
508000 -- (-669.185) (-668.291) [-667.584] (-666.833) * [-667.057] (-669.000) (-667.464) (-669.328) -- 0:00:29
508500 -- (-667.261) [-669.231] (-668.870) (-666.166) * [-666.786] (-669.277) (-670.395) (-665.765) -- 0:00:28
509000 -- [-666.689] (-666.528) (-668.585) (-669.941) * [-665.818] (-665.691) (-667.895) (-668.576) -- 0:00:28
509500 -- (-666.243) [-666.692] (-671.767) (-666.989) * (-667.131) [-669.206] (-665.215) (-665.889) -- 0:00:28
510000 -- [-668.161] (-665.870) (-668.450) (-666.261) * (-669.454) (-667.781) [-670.379] (-665.875) -- 0:00:28
Average standard deviation of split frequencies: 0.009828
510500 -- [-665.210] (-667.703) (-667.473) (-666.451) * (-671.298) [-672.811] (-667.288) (-666.061) -- 0:00:28
511000 -- (-666.585) (-665.317) [-667.034] (-668.746) * (-674.677) (-672.080) [-667.693] (-667.599) -- 0:00:28
511500 -- (-666.107) (-665.069) (-666.225) [-667.975] * (-668.381) (-667.504) (-664.978) [-665.252] -- 0:00:28
512000 -- (-665.947) (-665.070) (-665.729) [-667.666] * (-666.700) [-666.175] (-665.170) (-667.017) -- 0:00:28
512500 -- (-667.209) (-668.989) [-667.946] (-671.003) * (-665.883) (-668.886) (-665.299) [-667.783] -- 0:00:28
513000 -- (-668.947) [-668.977] (-665.837) (-670.830) * (-667.508) (-668.997) [-665.470] (-665.473) -- 0:00:29
513500 -- [-666.893] (-669.770) (-668.254) (-667.149) * (-666.749) (-669.076) [-665.607] (-666.870) -- 0:00:29
514000 -- (-667.363) (-670.802) [-666.268] (-670.873) * (-666.916) (-667.080) [-667.258] (-669.014) -- 0:00:29
514500 -- (-670.402) (-666.725) [-668.269] (-669.138) * (-666.326) [-667.026] (-668.543) (-668.971) -- 0:00:29
515000 -- [-669.504] (-665.876) (-666.830) (-666.075) * (-666.695) (-666.661) [-666.812] (-666.112) -- 0:00:29
Average standard deviation of split frequencies: 0.009935
515500 -- (-668.099) [-664.956] (-667.295) (-667.058) * (-666.200) (-667.069) (-667.526) [-667.191] -- 0:00:29
516000 -- [-671.570] (-667.365) (-665.749) (-665.573) * [-666.000] (-666.835) (-665.580) (-667.279) -- 0:00:29
516500 -- (-673.151) (-666.399) [-665.739] (-670.207) * (-667.033) (-668.608) (-669.935) [-667.784] -- 0:00:29
517000 -- (-666.058) (-666.402) [-665.739] (-666.268) * (-664.935) (-669.604) (-665.358) [-667.210] -- 0:00:28
517500 -- [-666.218] (-667.231) (-667.307) (-666.770) * (-668.939) (-667.712) [-666.820] (-668.695) -- 0:00:28
518000 -- [-668.053] (-666.172) (-669.359) (-666.331) * (-672.103) [-665.990] (-665.878) (-665.934) -- 0:00:28
518500 -- (-668.575) (-669.668) [-665.169] (-667.151) * (-670.203) (-667.329) [-669.238] (-669.882) -- 0:00:28
519000 -- (-669.468) (-670.791) [-671.618] (-667.173) * (-666.730) (-669.492) [-666.111] (-668.517) -- 0:00:28
519500 -- (-666.545) (-669.131) (-667.998) [-665.636] * (-666.008) (-668.681) [-666.610] (-669.332) -- 0:00:28
520000 -- (-667.781) [-667.233] (-671.998) (-668.860) * (-675.404) (-666.184) [-667.115] (-668.064) -- 0:00:28
Average standard deviation of split frequencies: 0.009733
520500 -- (-665.437) (-665.681) [-667.243] (-665.070) * (-672.331) (-668.396) (-666.534) [-668.642] -- 0:00:28
521000 -- (-666.403) (-666.215) (-666.463) [-665.168] * (-670.153) [-666.572] (-666.186) (-668.041) -- 0:00:28
521500 -- (-668.398) [-667.422] (-670.353) (-666.404) * (-668.454) (-665.268) (-666.390) [-666.532] -- 0:00:28
522000 -- (-665.642) (-666.905) (-668.171) [-668.274] * (-665.911) [-665.387] (-668.935) (-665.427) -- 0:00:28
522500 -- (-666.867) (-667.384) (-670.711) [-666.899] * [-672.670] (-668.677) (-668.465) (-667.850) -- 0:00:28
523000 -- [-668.431] (-668.406) (-667.986) (-665.958) * (-667.609) (-670.367) (-666.201) [-666.121] -- 0:00:28
523500 -- (-667.884) (-670.443) (-667.803) [-665.807] * (-666.043) (-666.869) (-665.361) [-667.866] -- 0:00:28
524000 -- (-668.123) (-666.362) (-666.400) [-665.904] * (-665.316) [-666.616] (-667.083) (-666.097) -- 0:00:28
524500 -- (-669.299) (-666.257) [-667.504] (-666.380) * [-665.316] (-667.946) (-669.173) (-666.444) -- 0:00:28
525000 -- (-665.568) (-665.387) (-665.963) [-667.993] * (-664.951) [-665.001] (-666.930) (-665.319) -- 0:00:28
Average standard deviation of split frequencies: 0.009298
525500 -- [-666.679] (-668.958) (-669.349) (-666.080) * [-665.632] (-667.331) (-665.919) (-666.448) -- 0:00:27
526000 -- (-665.609) (-665.955) (-666.962) [-666.359] * (-671.465) (-670.453) [-665.411] (-665.690) -- 0:00:27
526500 -- (-669.536) (-665.530) (-665.504) [-665.371] * (-668.040) (-668.270) (-667.243) [-665.780] -- 0:00:27
527000 -- (-669.415) (-666.625) [-665.921] (-667.171) * (-667.332) [-667.561] (-666.226) (-666.979) -- 0:00:27
527500 -- [-665.502] (-666.546) (-667.012) (-665.642) * (-668.684) [-671.746] (-666.268) (-668.894) -- 0:00:27
528000 -- (-666.095) (-666.212) (-674.228) [-670.583] * (-668.837) [-668.687] (-668.627) (-667.830) -- 0:00:27
528500 -- (-665.732) [-665.201] (-667.371) (-676.331) * (-666.480) [-668.740] (-667.080) (-666.698) -- 0:00:27
529000 -- (-665.743) (-665.149) (-669.719) [-666.221] * [-667.378] (-670.400) (-668.400) (-665.930) -- 0:00:27
529500 -- (-665.532) [-665.082] (-666.296) (-666.871) * [-667.989] (-669.397) (-667.014) (-667.338) -- 0:00:27
530000 -- (-666.129) (-666.934) (-665.027) [-668.181] * (-667.600) (-668.349) [-671.859] (-666.999) -- 0:00:28
Average standard deviation of split frequencies: 0.008717
530500 -- (-667.293) [-666.307] (-665.556) (-665.578) * [-667.242] (-667.247) (-665.978) (-666.283) -- 0:00:28
531000 -- [-667.860] (-672.371) (-666.223) (-666.206) * (-667.614) (-670.327) [-667.999] (-669.347) -- 0:00:28
531500 -- (-671.747) (-669.633) (-667.497) [-668.898] * [-666.723] (-669.381) (-668.038) (-671.067) -- 0:00:28
532000 -- (-665.849) (-669.180) (-665.045) [-667.374] * (-667.055) [-670.424] (-669.905) (-667.418) -- 0:00:28
532500 -- (-670.763) (-670.162) [-665.113] (-667.196) * [-668.820] (-667.350) (-665.779) (-667.549) -- 0:00:28
533000 -- (-668.428) [-668.574] (-667.087) (-666.163) * (-671.672) (-665.291) (-666.388) [-666.791] -- 0:00:28
533500 -- (-667.686) (-666.378) [-670.597] (-671.783) * (-669.503) (-665.426) [-666.883] (-666.478) -- 0:00:27
534000 -- (-669.728) [-666.329] (-671.499) (-666.096) * [-665.329] (-665.149) (-669.723) (-666.467) -- 0:00:27
534500 -- [-668.369] (-666.735) (-666.461) (-669.920) * [-665.021] (-665.220) (-665.630) (-666.978) -- 0:00:27
535000 -- (-670.022) [-666.152] (-668.676) (-667.049) * (-664.864) (-665.145) [-665.362] (-668.223) -- 0:00:27
Average standard deviation of split frequencies: 0.008740
535500 -- (-669.338) (-666.076) [-666.595] (-665.802) * (-669.541) (-666.104) (-667.330) [-666.775] -- 0:00:27
536000 -- (-668.839) (-666.396) (-667.371) [-668.279] * [-667.128] (-665.239) (-670.769) (-666.000) -- 0:00:27
536500 -- (-667.888) (-667.266) (-667.256) [-667.349] * (-668.607) [-665.525] (-669.614) (-670.815) -- 0:00:27
537000 -- (-666.652) (-667.107) [-666.544] (-666.733) * (-666.059) (-665.364) [-667.400] (-670.815) -- 0:00:27
537500 -- (-665.681) (-666.843) (-666.126) [-667.634] * (-665.883) (-667.247) (-666.214) [-671.301] -- 0:00:27
538000 -- [-665.986] (-665.563) (-665.456) (-671.220) * (-667.765) (-668.034) [-665.352] (-672.580) -- 0:00:27
538500 -- [-666.577] (-666.838) (-666.093) (-669.795) * (-669.923) [-665.413] (-666.077) (-666.615) -- 0:00:27
539000 -- [-666.198] (-665.814) (-665.708) (-667.614) * (-667.536) (-665.644) [-667.281] (-665.937) -- 0:00:27
539500 -- [-666.372] (-669.728) (-667.484) (-667.071) * (-666.609) (-665.683) (-674.595) [-671.073] -- 0:00:27
540000 -- [-667.742] (-671.259) (-667.723) (-664.887) * (-669.377) (-666.108) [-671.886] (-666.532) -- 0:00:27
Average standard deviation of split frequencies: 0.009264
540500 -- [-666.973] (-669.535) (-667.383) (-667.265) * (-665.655) (-674.113) (-668.911) [-665.460] -- 0:00:27
541000 -- (-667.817) (-666.922) [-666.683] (-666.142) * (-667.154) (-668.107) (-666.509) [-666.917] -- 0:00:27
541500 -- (-667.682) (-666.842) (-666.290) [-668.063] * [-666.752] (-667.142) (-667.772) (-670.761) -- 0:00:27
542000 -- [-666.554] (-669.035) (-666.325) (-666.032) * (-666.397) (-671.339) [-666.348] (-666.223) -- 0:00:27
542500 -- (-668.090) (-667.769) [-665.678] (-666.383) * (-669.746) (-667.006) [-665.513] (-665.623) -- 0:00:26
543000 -- [-665.946] (-667.240) (-665.714) (-667.167) * [-665.766] (-670.752) (-670.194) (-668.345) -- 0:00:26
543500 -- (-668.789) (-666.296) (-668.431) [-668.156] * [-666.227] (-667.005) (-669.861) (-670.071) -- 0:00:26
544000 -- (-666.099) [-665.670] (-670.648) (-666.897) * [-669.953] (-666.608) (-668.655) (-665.129) -- 0:00:26
544500 -- [-666.783] (-666.531) (-665.666) (-665.366) * [-669.786] (-666.663) (-669.041) (-667.289) -- 0:00:26
545000 -- (-665.596) (-667.122) (-669.712) [-665.334] * (-666.555) (-665.193) [-669.362] (-666.882) -- 0:00:26
Average standard deviation of split frequencies: 0.009173
545500 -- [-668.631] (-665.873) (-665.439) (-665.160) * (-665.338) (-666.075) [-668.253] (-665.354) -- 0:00:26
546000 -- (-667.042) (-665.816) [-665.651] (-669.318) * (-668.237) (-665.822) [-665.173] (-667.303) -- 0:00:26
546500 -- (-666.293) (-665.803) [-665.440] (-668.103) * (-666.112) (-666.685) [-666.092] (-665.856) -- 0:00:27
547000 -- (-669.256) (-668.078) [-666.270] (-667.864) * [-666.476] (-666.860) (-667.187) (-666.321) -- 0:00:27
547500 -- (-666.627) (-670.978) (-666.593) [-667.040] * (-668.164) (-672.161) [-665.854] (-667.497) -- 0:00:27
548000 -- (-666.022) (-667.302) [-665.995] (-669.573) * (-669.074) (-667.299) [-665.735] (-666.374) -- 0:00:27
548500 -- (-667.968) [-665.979] (-665.964) (-667.966) * (-667.505) (-666.327) [-667.785] (-666.338) -- 0:00:27
549000 -- [-666.081] (-667.653) (-671.751) (-667.334) * (-667.642) (-667.212) (-668.776) [-666.037] -- 0:00:27
549500 -- (-672.196) (-667.046) [-666.543] (-666.224) * (-666.178) (-665.650) (-667.498) [-666.085] -- 0:00:27
550000 -- [-665.981] (-668.078) (-665.620) (-667.148) * [-666.756] (-665.462) (-668.090) (-671.553) -- 0:00:27
Average standard deviation of split frequencies: 0.010222
550500 -- (-665.998) (-671.168) (-666.197) [-665.189] * (-671.065) (-665.706) (-669.392) [-668.122] -- 0:00:26
551000 -- (-665.715) (-666.734) (-668.680) [-665.905] * (-672.220) [-669.604] (-667.299) (-665.366) -- 0:00:26
551500 -- [-668.676] (-668.380) (-668.081) (-665.996) * (-665.818) (-666.202) (-667.969) [-669.045] -- 0:00:26
552000 -- [-668.141] (-665.616) (-667.335) (-669.407) * (-667.443) (-668.050) [-667.078] (-666.517) -- 0:00:26
552500 -- [-669.258] (-667.616) (-666.983) (-666.442) * (-666.596) (-672.015) [-669.122] (-667.248) -- 0:00:26
553000 -- (-668.009) (-665.704) (-670.345) [-666.004] * (-670.845) (-670.834) [-666.803] (-667.285) -- 0:00:26
553500 -- (-669.336) (-672.388) [-668.226] (-665.342) * [-669.414] (-670.042) (-668.114) (-666.632) -- 0:00:26
554000 -- (-667.289) (-665.242) (-668.141) [-666.647] * (-668.348) [-666.704] (-665.853) (-666.629) -- 0:00:26
554500 -- (-667.503) (-667.397) (-667.716) [-667.292] * (-668.058) [-668.251] (-669.117) (-667.499) -- 0:00:26
555000 -- (-669.194) (-668.828) [-668.418] (-669.290) * (-675.503) (-669.799) [-667.664] (-667.242) -- 0:00:26
Average standard deviation of split frequencies: 0.010424
555500 -- [-667.348] (-666.210) (-672.553) (-668.565) * (-675.729) (-667.147) [-666.135] (-667.816) -- 0:00:26
556000 -- [-665.586] (-665.683) (-670.658) (-667.361) * (-667.727) (-674.770) (-668.706) [-667.680] -- 0:00:26
556500 -- (-668.627) (-667.752) (-670.481) [-670.018] * (-665.648) (-667.060) (-666.979) [-668.496] -- 0:00:26
557000 -- (-666.774) (-669.881) [-665.538] (-666.184) * (-664.986) [-665.816] (-667.353) (-667.264) -- 0:00:26
557500 -- [-670.016] (-669.243) (-666.507) (-668.227) * [-664.959] (-665.482) (-670.351) (-665.719) -- 0:00:26
558000 -- [-665.363] (-668.713) (-665.841) (-670.203) * (-665.710) (-666.989) (-665.577) [-666.279] -- 0:00:26
558500 -- [-667.599] (-667.307) (-666.294) (-666.392) * [-666.021] (-669.129) (-666.909) (-665.271) -- 0:00:26
559000 -- (-667.935) (-668.495) [-668.164] (-669.108) * (-665.197) (-666.759) (-668.500) [-666.997] -- 0:00:26
559500 -- (-670.337) (-672.152) (-668.384) [-665.981] * (-667.182) (-668.011) [-667.085] (-668.191) -- 0:00:25
560000 -- [-669.953] (-667.091) (-665.826) (-668.592) * [-666.793] (-666.236) (-666.343) (-667.041) -- 0:00:25
Average standard deviation of split frequencies: 0.010314
560500 -- (-667.336) [-667.342] (-666.591) (-665.552) * [-669.241] (-666.617) (-668.725) (-666.990) -- 0:00:25
561000 -- [-667.524] (-666.846) (-666.585) (-665.935) * (-672.308) (-665.463) (-667.330) [-666.840] -- 0:00:25
561500 -- (-666.503) (-668.354) (-667.118) [-665.483] * (-670.325) [-665.872] (-667.854) (-668.989) -- 0:00:25
562000 -- (-669.828) (-669.277) (-669.741) [-666.519] * (-666.202) (-665.692) (-665.529) [-665.952] -- 0:00:25
562500 -- [-666.988] (-670.195) (-668.768) (-665.219) * (-665.586) [-666.678] (-666.426) (-670.567) -- 0:00:25
563000 -- [-667.150] (-665.391) (-668.007) (-668.837) * [-666.673] (-667.830) (-665.550) (-666.515) -- 0:00:25
563500 -- (-669.120) (-666.790) (-666.516) [-669.131] * (-667.423) (-671.841) (-669.676) [-665.020] -- 0:00:26
564000 -- (-666.802) (-666.472) (-666.557) [-672.174] * (-669.807) [-665.371] (-667.989) (-668.057) -- 0:00:26
564500 -- (-665.848) [-665.118] (-666.401) (-666.685) * [-668.413] (-667.879) (-670.570) (-666.035) -- 0:00:26
565000 -- (-668.500) (-666.769) (-667.907) [-665.194] * (-669.387) (-667.289) (-670.315) [-665.847] -- 0:00:26
Average standard deviation of split frequencies: 0.010087
565500 -- (-666.965) (-665.588) (-666.113) [-670.323] * (-665.288) (-677.064) [-667.763] (-668.658) -- 0:00:26
566000 -- (-667.657) [-671.050] (-666.021) (-667.489) * [-665.288] (-667.038) (-666.877) (-666.702) -- 0:00:26
566500 -- (-665.987) [-668.048] (-667.316) (-668.158) * [-665.954] (-666.231) (-667.887) (-668.395) -- 0:00:26
567000 -- (-665.845) (-666.636) (-669.235) [-669.366] * (-667.984) (-667.453) [-667.174] (-668.882) -- 0:00:25
567500 -- (-670.735) [-667.230] (-665.800) (-667.416) * [-666.488] (-666.872) (-667.901) (-666.708) -- 0:00:25
568000 -- (-667.855) (-667.025) [-666.672] (-667.271) * [-665.535] (-670.193) (-669.281) (-669.015) -- 0:00:25
568500 -- (-665.772) (-668.098) (-666.127) [-666.574] * (-668.064) (-670.501) (-667.899) [-665.818] -- 0:00:25
569000 -- (-668.955) [-668.494] (-666.282) (-669.415) * (-666.306) (-666.451) [-669.206] (-668.023) -- 0:00:25
569500 -- [-667.723] (-667.889) (-666.856) (-667.694) * (-665.150) (-668.764) [-667.849] (-668.241) -- 0:00:25
570000 -- [-667.906] (-665.205) (-668.384) (-669.810) * [-666.137] (-667.807) (-667.221) (-666.833) -- 0:00:25
Average standard deviation of split frequencies: 0.010253
570500 -- [-666.540] (-669.484) (-671.027) (-673.268) * (-665.438) [-669.947] (-667.196) (-666.643) -- 0:00:25
571000 -- (-670.406) (-668.780) [-670.544] (-665.843) * (-667.310) (-667.002) (-667.274) [-667.389] -- 0:00:25
571500 -- (-667.400) (-667.711) [-667.714] (-666.891) * (-667.926) (-670.747) [-666.926] (-668.365) -- 0:00:25
572000 -- (-666.636) [-667.327] (-668.913) (-666.507) * (-667.224) (-670.142) (-666.959) [-667.942] -- 0:00:25
572500 -- (-666.146) (-666.990) [-668.907] (-669.025) * (-667.241) (-667.104) (-665.840) [-666.969] -- 0:00:25
573000 -- (-671.378) (-669.648) [-668.064] (-666.660) * (-666.333) [-667.113] (-669.108) (-668.187) -- 0:00:25
573500 -- [-665.846] (-674.975) (-667.161) (-667.776) * (-667.148) (-667.895) [-666.241] (-667.207) -- 0:00:25
574000 -- (-665.597) (-668.544) [-668.282] (-668.063) * (-670.301) (-667.685) [-667.199] (-669.283) -- 0:00:25
574500 -- (-665.484) (-667.081) (-665.721) [-666.418] * (-667.988) [-667.506] (-667.656) (-666.656) -- 0:00:25
575000 -- (-666.191) (-666.051) [-666.176] (-667.836) * [-665.638] (-667.979) (-665.556) (-665.373) -- 0:00:25
Average standard deviation of split frequencies: 0.009166
575500 -- (-668.528) [-666.623] (-666.876) (-666.491) * (-670.225) (-669.903) (-667.980) [-669.948] -- 0:00:25
576000 -- (-666.801) [-666.870] (-666.100) (-669.313) * (-666.678) (-669.388) [-666.953] (-665.199) -- 0:00:25
576500 -- (-667.162) [-665.968] (-665.291) (-667.890) * (-668.001) (-667.378) [-666.057] (-666.442) -- 0:00:24
577000 -- (-668.787) [-666.819] (-665.048) (-665.321) * [-667.546] (-669.558) (-667.167) (-668.326) -- 0:00:24
577500 -- (-666.298) (-666.134) [-667.105] (-666.077) * (-666.830) (-666.258) [-667.512] (-669.518) -- 0:00:24
578000 -- (-675.919) [-668.236] (-665.648) (-669.729) * (-665.907) (-666.959) (-667.192) [-669.687] -- 0:00:24
578500 -- (-669.695) (-671.406) [-667.961] (-670.053) * (-666.063) [-667.122] (-667.899) (-666.673) -- 0:00:24
579000 -- (-668.799) [-667.402] (-668.192) (-671.458) * (-666.197) (-668.965) (-667.144) [-668.066] -- 0:00:24
579500 -- (-666.726) (-666.990) (-667.286) [-677.340] * (-668.769) (-666.450) [-666.986] (-667.210) -- 0:00:24
580000 -- [-671.092] (-667.485) (-667.615) (-669.179) * (-667.770) (-667.089) [-668.193] (-667.419) -- 0:00:24
Average standard deviation of split frequencies: 0.009093
580500 -- [-667.108] (-671.719) (-669.903) (-668.075) * [-665.103] (-668.153) (-669.675) (-666.576) -- 0:00:25
581000 -- (-667.087) [-670.476] (-667.578) (-665.962) * (-667.477) (-666.027) [-666.200] (-666.903) -- 0:00:25
581500 -- [-667.080] (-670.747) (-666.225) (-666.948) * (-666.163) [-665.671] (-666.347) (-667.865) -- 0:00:25
582000 -- (-665.395) (-668.249) (-666.350) [-668.127] * (-666.483) (-665.192) (-669.186) [-667.374] -- 0:00:25
582500 -- (-666.773) [-667.488] (-668.484) (-666.252) * [-667.876] (-667.038) (-669.904) (-665.697) -- 0:00:25
583000 -- (-665.489) [-666.081] (-668.665) (-665.555) * (-669.328) (-667.110) [-666.563] (-666.967) -- 0:00:25
583500 -- [-666.836] (-666.143) (-667.596) (-668.762) * [-666.023] (-667.486) (-666.861) (-665.904) -- 0:00:24
584000 -- [-668.099] (-666.823) (-666.677) (-668.066) * (-665.882) [-666.663] (-667.017) (-671.649) -- 0:00:24
584500 -- (-669.818) (-668.052) [-666.373] (-666.577) * [-670.097] (-666.550) (-670.801) (-677.927) -- 0:00:24
585000 -- (-668.330) (-667.418) [-670.728] (-667.706) * [-665.935] (-665.997) (-669.571) (-669.535) -- 0:00:24
Average standard deviation of split frequencies: 0.008447
585500 -- [-669.274] (-667.756) (-666.935) (-666.107) * (-666.867) [-665.749] (-667.551) (-669.157) -- 0:00:24
586000 -- (-670.815) [-669.911] (-667.951) (-667.384) * (-668.505) [-668.285] (-666.965) (-668.518) -- 0:00:24
586500 -- (-669.195) (-666.776) [-670.300] (-667.114) * (-669.818) (-667.088) [-668.015] (-669.628) -- 0:00:24
587000 -- (-669.398) [-666.255] (-665.582) (-669.906) * (-668.554) (-667.249) (-666.321) [-669.166] -- 0:00:24
587500 -- (-668.837) [-667.080] (-665.405) (-665.666) * (-666.997) (-667.776) (-666.040) [-669.969] -- 0:00:24
588000 -- (-666.286) [-667.862] (-666.785) (-668.305) * (-668.702) [-667.584] (-667.254) (-667.608) -- 0:00:24
588500 -- (-666.108) (-666.082) (-666.078) [-668.376] * (-668.084) [-668.000] (-667.845) (-669.223) -- 0:00:24
589000 -- (-667.545) [-667.274] (-667.058) (-668.718) * (-667.235) (-669.528) (-669.374) [-668.735] -- 0:00:24
589500 -- (-666.303) (-667.619) (-666.856) [-667.144] * (-672.269) (-669.483) (-668.811) [-666.510] -- 0:00:24
590000 -- [-665.685] (-669.565) (-671.075) (-665.915) * (-669.719) (-668.936) [-666.434] (-668.130) -- 0:00:24
Average standard deviation of split frequencies: 0.008979
590500 -- (-666.853) [-670.920] (-667.908) (-666.174) * (-670.211) (-669.199) [-665.916] (-667.001) -- 0:00:24
591000 -- [-665.264] (-666.083) (-666.141) (-666.873) * (-666.503) (-668.472) (-665.842) [-665.090] -- 0:00:24
591500 -- (-668.827) (-665.726) [-666.111] (-666.259) * (-665.503) [-668.273] (-667.193) (-665.069) -- 0:00:24
592000 -- (-671.407) [-670.183] (-665.925) (-671.003) * (-666.982) [-667.334] (-668.172) (-666.165) -- 0:00:24
592500 -- (-668.741) [-667.415] (-666.167) (-668.706) * (-668.806) (-666.488) (-665.260) [-665.413] -- 0:00:24
593000 -- (-666.829) (-667.143) (-665.825) [-666.838] * (-669.298) (-669.786) [-665.588] (-670.889) -- 0:00:24
593500 -- (-667.877) (-666.613) [-665.330] (-670.037) * (-665.477) (-669.372) [-666.600] (-666.404) -- 0:00:23
594000 -- (-668.927) (-671.833) [-666.115] (-667.250) * (-668.604) [-666.432] (-666.804) (-666.727) -- 0:00:23
594500 -- [-667.762] (-666.873) (-667.467) (-668.640) * [-671.122] (-667.047) (-669.732) (-666.874) -- 0:00:23
595000 -- (-670.623) [-667.652] (-666.034) (-668.701) * (-667.228) (-667.466) [-667.657] (-670.665) -- 0:00:23
Average standard deviation of split frequencies: 0.008648
595500 -- (-666.005) (-665.549) (-665.945) [-665.600] * (-665.336) [-667.683] (-667.187) (-665.806) -- 0:00:23
596000 -- (-666.008) (-670.159) [-665.574] (-665.816) * (-668.798) (-668.084) [-670.767] (-666.820) -- 0:00:23
596500 -- [-665.769] (-667.865) (-669.093) (-665.827) * (-666.018) [-667.833] (-667.493) (-667.678) -- 0:00:23
597000 -- (-666.599) [-667.267] (-667.459) (-665.976) * (-670.923) (-668.478) (-664.930) [-667.220] -- 0:00:24
597500 -- (-669.183) (-665.424) [-670.169] (-668.655) * [-667.605] (-666.554) (-665.419) (-665.641) -- 0:00:24
598000 -- (-668.529) [-665.566] (-670.297) (-668.153) * [-668.191] (-666.752) (-666.137) (-668.924) -- 0:00:24
598500 -- [-667.326] (-666.686) (-667.951) (-665.693) * (-666.453) (-666.379) (-672.780) [-667.360] -- 0:00:24
599000 -- (-667.129) (-666.913) [-667.640] (-667.622) * [-666.553] (-666.797) (-666.647) (-665.715) -- 0:00:24
599500 -- (-667.217) (-666.542) (-670.272) [-666.983] * (-668.287) [-666.917] (-667.086) (-668.913) -- 0:00:24
600000 -- (-667.637) [-665.635] (-673.601) (-668.745) * (-666.157) (-667.525) [-666.019] (-667.461) -- 0:00:24
Average standard deviation of split frequencies: 0.008894
600500 -- (-667.859) (-667.745) [-666.069] (-666.768) * [-666.703] (-666.966) (-666.067) (-665.781) -- 0:00:23
601000 -- (-667.398) (-667.914) [-665.057] (-665.534) * (-671.387) [-670.929] (-667.069) (-668.119) -- 0:00:23
601500 -- (-666.898) (-666.429) (-666.864) [-666.182] * (-669.023) (-666.044) (-667.320) [-666.619] -- 0:00:23
602000 -- (-666.631) (-668.664) [-666.773] (-670.143) * (-669.224) [-667.628] (-672.892) (-665.816) -- 0:00:23
602500 -- (-670.254) (-667.454) [-668.693] (-666.363) * [-670.180] (-668.049) (-673.610) (-668.875) -- 0:00:23
603000 -- (-665.637) (-665.865) [-668.314] (-666.873) * (-671.143) (-668.318) (-669.207) [-667.126] -- 0:00:23
603500 -- (-668.716) [-666.394] (-667.810) (-667.321) * [-667.811] (-667.385) (-666.685) (-665.558) -- 0:00:23
604000 -- (-667.462) (-667.543) (-674.573) [-668.886] * (-665.437) (-667.201) [-667.401] (-666.547) -- 0:00:23
604500 -- (-665.722) (-667.436) (-668.591) [-666.609] * [-667.137] (-665.893) (-668.045) (-670.822) -- 0:00:23
605000 -- (-667.930) [-665.074] (-667.443) (-666.588) * [-668.434] (-672.401) (-666.466) (-668.150) -- 0:00:23
Average standard deviation of split frequencies: 0.008816
605500 -- (-665.881) (-666.214) (-664.956) [-668.514] * [-665.845] (-668.784) (-666.311) (-668.855) -- 0:00:23
606000 -- (-668.661) (-668.729) (-665.677) [-666.020] * [-668.412] (-668.430) (-669.265) (-667.627) -- 0:00:23
606500 -- [-665.962] (-668.052) (-666.346) (-670.072) * (-666.980) (-665.407) [-666.137] (-666.036) -- 0:00:23
607000 -- (-666.198) (-668.870) (-668.597) [-667.273] * (-666.724) [-667.867] (-666.998) (-667.785) -- 0:00:23
607500 -- (-666.937) (-668.577) (-666.248) [-665.473] * (-666.241) (-667.284) [-665.867] (-668.930) -- 0:00:23
608000 -- (-667.635) (-667.751) (-666.135) [-669.730] * (-667.323) (-672.010) [-665.300] (-666.593) -- 0:00:23
608500 -- (-665.635) (-672.044) (-667.853) [-667.651] * (-667.790) (-665.840) [-665.908] (-670.770) -- 0:00:23
609000 -- [-668.337] (-667.835) (-667.955) (-668.234) * (-668.121) (-667.719) [-666.174] (-671.201) -- 0:00:23
609500 -- [-666.265] (-668.608) (-671.091) (-667.519) * (-669.879) [-665.813] (-671.051) (-668.289) -- 0:00:23
610000 -- (-668.538) (-667.007) [-668.346] (-667.358) * (-668.164) [-669.631] (-665.872) (-667.652) -- 0:00:23
Average standard deviation of split frequencies: 0.008955
610500 -- (-668.499) [-665.269] (-670.172) (-669.930) * (-666.972) (-668.812) (-667.716) [-666.341] -- 0:00:22
611000 -- [-666.121] (-668.886) (-666.898) (-667.644) * (-668.788) (-669.474) (-669.546) [-666.051] -- 0:00:22
611500 -- (-665.664) [-666.802] (-666.796) (-667.904) * (-669.441) (-669.577) (-666.826) [-667.387] -- 0:00:22
612000 -- (-666.595) [-666.935] (-667.661) (-665.358) * (-667.525) (-667.476) (-667.206) [-667.069] -- 0:00:22
612500 -- (-667.434) (-666.154) [-669.970] (-666.249) * (-670.579) (-672.123) (-667.820) [-668.643] -- 0:00:22
613000 -- (-665.896) [-665.885] (-670.798) (-668.700) * (-667.081) (-672.006) (-667.598) [-665.871] -- 0:00:22
613500 -- (-665.755) (-666.861) (-667.918) [-666.330] * (-666.681) (-667.073) [-666.836] (-672.694) -- 0:00:23
614000 -- [-665.245] (-666.515) (-670.602) (-667.676) * (-668.197) [-667.553] (-667.143) (-670.993) -- 0:00:23
614500 -- [-665.459] (-668.105) (-666.594) (-667.634) * (-669.020) (-669.376) (-665.535) [-666.824] -- 0:00:23
615000 -- (-667.308) (-667.096) (-667.583) [-668.702] * (-668.040) [-665.883] (-666.636) (-666.135) -- 0:00:23
Average standard deviation of split frequencies: 0.009327
615500 -- (-669.405) [-666.038] (-668.426) (-666.690) * (-669.694) (-670.094) [-668.244] (-665.082) -- 0:00:23
616000 -- (-673.834) (-665.744) [-666.089] (-667.087) * (-667.794) (-667.456) [-668.176] (-668.663) -- 0:00:23
616500 -- (-670.249) (-665.394) (-666.552) [-670.119] * (-666.864) (-669.035) [-667.075] (-670.545) -- 0:00:23
617000 -- [-668.253] (-666.256) (-674.208) (-665.645) * (-671.617) (-669.040) [-668.848] (-666.937) -- 0:00:22
617500 -- (-667.536) (-667.797) (-665.869) [-667.495] * (-667.020) (-667.696) (-670.641) [-667.136] -- 0:00:22
618000 -- [-665.250] (-665.718) (-666.205) (-667.065) * (-667.258) (-666.531) [-667.907] (-667.517) -- 0:00:22
618500 -- (-667.787) [-666.835] (-665.038) (-668.191) * (-666.941) (-667.307) [-667.464] (-665.105) -- 0:00:22
619000 -- (-665.716) (-669.842) [-665.900] (-670.768) * [-667.160] (-666.222) (-668.389) (-669.434) -- 0:00:22
619500 -- (-668.753) (-667.156) [-668.232] (-667.056) * (-667.323) [-668.817] (-670.331) (-670.816) -- 0:00:22
620000 -- [-667.435] (-665.350) (-666.716) (-667.771) * (-667.081) (-667.969) [-665.491] (-667.082) -- 0:00:22
Average standard deviation of split frequencies: 0.009067
620500 -- (-669.042) [-666.117] (-666.613) (-669.052) * (-665.519) (-665.974) [-667.074] (-667.096) -- 0:00:22
621000 -- (-665.789) (-668.098) [-665.660] (-669.899) * (-666.894) (-666.028) [-667.150] (-668.174) -- 0:00:22
621500 -- (-666.655) (-669.718) (-666.671) [-667.796] * [-668.607] (-675.643) (-666.347) (-666.428) -- 0:00:22
622000 -- (-665.773) (-666.538) [-666.509] (-666.407) * [-669.550] (-667.674) (-668.808) (-665.739) -- 0:00:22
622500 -- (-666.662) [-667.061] (-666.132) (-666.391) * (-667.821) (-667.218) (-666.994) [-667.773] -- 0:00:22
623000 -- (-667.053) [-666.879] (-665.714) (-665.960) * (-667.993) [-665.406] (-667.505) (-667.733) -- 0:00:22
623500 -- [-666.628] (-666.560) (-668.172) (-672.736) * (-669.338) (-670.791) (-666.975) [-665.421] -- 0:00:22
624000 -- (-666.302) (-664.893) [-665.698] (-667.115) * [-666.675] (-669.265) (-665.305) (-666.738) -- 0:00:22
624500 -- (-665.134) (-666.089) [-666.268] (-666.070) * (-668.067) [-667.809] (-668.015) (-668.732) -- 0:00:22
625000 -- (-668.783) (-665.349) [-666.930] (-668.836) * (-665.816) (-673.728) [-672.014] (-668.737) -- 0:00:22
Average standard deviation of split frequencies: 0.009084
625500 -- (-666.862) (-668.044) (-667.311) [-670.424] * (-667.103) (-667.732) (-667.829) [-666.781] -- 0:00:22
626000 -- (-665.390) [-666.591] (-665.975) (-668.019) * (-667.575) [-665.053] (-669.559) (-669.258) -- 0:00:22
626500 -- [-666.592] (-670.558) (-666.289) (-667.045) * [-667.572] (-667.583) (-665.831) (-668.445) -- 0:00:22
627000 -- [-664.929] (-667.374) (-665.623) (-665.615) * (-667.201) [-666.585] (-665.794) (-668.963) -- 0:00:22
627500 -- (-666.026) (-667.513) (-666.747) [-665.930] * (-666.692) [-665.820] (-665.800) (-667.632) -- 0:00:21
628000 -- (-666.026) (-673.900) (-665.833) [-666.532] * [-669.364] (-669.088) (-668.108) (-666.592) -- 0:00:21
628500 -- [-664.931] (-667.165) (-667.735) (-672.658) * [-665.385] (-665.869) (-672.624) (-668.740) -- 0:00:21
629000 -- (-665.589) [-667.253] (-667.163) (-669.424) * (-665.532) (-665.501) (-666.711) [-669.405] -- 0:00:21
629500 -- [-665.384] (-665.567) (-666.184) (-668.154) * (-666.513) [-666.741] (-665.345) (-666.716) -- 0:00:21
630000 -- [-665.807] (-669.335) (-667.950) (-667.068) * (-667.399) (-671.608) (-664.972) [-666.367] -- 0:00:21
Average standard deviation of split frequencies: 0.009343
630500 -- (-668.552) (-666.892) (-667.174) [-665.500] * (-667.115) (-670.773) [-666.286] (-667.539) -- 0:00:22
631000 -- (-665.527) [-665.415] (-666.773) (-667.530) * (-669.021) [-668.217] (-665.703) (-670.174) -- 0:00:22
631500 -- [-668.034] (-665.452) (-667.750) (-671.979) * (-666.990) (-668.699) (-667.247) [-665.710] -- 0:00:22
632000 -- (-668.527) [-666.983] (-666.467) (-667.127) * (-666.591) (-669.224) (-668.606) [-666.113] -- 0:00:22
632500 -- (-666.911) [-666.059] (-667.360) (-668.416) * (-666.494) [-666.332] (-666.683) (-669.405) -- 0:00:22
633000 -- (-667.506) (-666.569) [-665.713] (-668.279) * (-665.641) [-666.561] (-666.017) (-669.245) -- 0:00:22
633500 -- [-667.195] (-666.698) (-666.148) (-666.874) * (-665.678) (-666.117) [-669.165] (-669.570) -- 0:00:21
634000 -- (-667.169) (-667.485) [-666.133] (-668.751) * (-667.353) [-668.776] (-665.792) (-668.171) -- 0:00:21
634500 -- [-668.680] (-671.216) (-667.971) (-667.632) * [-667.588] (-668.053) (-666.451) (-667.714) -- 0:00:21
635000 -- [-667.338] (-673.945) (-669.586) (-667.326) * (-668.296) (-666.043) [-665.684] (-668.720) -- 0:00:21
Average standard deviation of split frequencies: 0.009497
635500 -- (-670.657) (-676.714) [-667.467] (-666.544) * (-671.224) (-666.698) [-665.948] (-668.139) -- 0:00:21
636000 -- (-674.495) [-668.788] (-669.320) (-667.016) * (-669.645) (-669.006) [-667.865] (-669.184) -- 0:00:21
636500 -- (-666.061) [-670.153] (-670.014) (-669.347) * (-671.154) (-665.878) (-669.385) [-668.109] -- 0:00:21
637000 -- (-669.368) (-666.833) (-672.560) [-667.732] * (-667.015) (-666.841) [-666.681] (-666.978) -- 0:00:21
637500 -- [-665.188] (-669.545) (-665.987) (-668.278) * (-665.560) (-667.986) [-667.577] (-666.526) -- 0:00:21
638000 -- (-665.712) (-667.982) [-665.556] (-666.384) * [-665.423] (-671.069) (-666.035) (-666.227) -- 0:00:21
638500 -- (-667.478) (-666.694) [-665.331] (-665.343) * [-666.353] (-665.524) (-665.972) (-667.887) -- 0:00:21
639000 -- (-666.107) (-669.998) (-665.596) [-673.260] * [-665.897] (-667.107) (-665.285) (-667.517) -- 0:00:21
639500 -- [-665.817] (-670.023) (-665.619) (-668.046) * (-667.306) [-666.821] (-667.542) (-669.780) -- 0:00:21
640000 -- (-666.495) (-666.829) [-666.516] (-665.182) * (-668.173) [-665.310] (-667.575) (-667.629) -- 0:00:21
Average standard deviation of split frequencies: 0.009887
640500 -- [-665.391] (-667.466) (-665.781) (-666.591) * (-665.555) (-665.198) (-667.210) [-666.550] -- 0:00:21
641000 -- (-668.768) [-667.673] (-666.227) (-667.352) * (-669.643) (-668.361) (-666.998) [-666.460] -- 0:00:21
641500 -- (-666.239) [-665.865] (-672.758) (-672.469) * (-668.637) (-666.300) [-665.918] (-668.979) -- 0:00:21
642000 -- (-668.763) [-666.176] (-668.911) (-669.015) * [-665.795] (-667.900) (-667.720) (-671.745) -- 0:00:21
642500 -- [-667.878] (-667.671) (-666.166) (-667.238) * [-665.377] (-667.049) (-666.717) (-672.417) -- 0:00:21
643000 -- [-665.384] (-665.168) (-666.946) (-667.622) * (-666.245) (-665.127) (-666.424) [-670.951] -- 0:00:21
643500 -- (-665.979) (-671.831) (-667.680) [-665.694] * (-666.758) [-665.130] (-669.609) (-668.520) -- 0:00:21
644000 -- (-666.846) (-666.567) [-670.798] (-665.178) * [-667.035] (-665.533) (-670.101) (-671.367) -- 0:00:21
644500 -- (-669.028) [-666.120] (-666.599) (-666.473) * (-670.501) [-666.099] (-667.483) (-666.369) -- 0:00:20
645000 -- (-668.111) (-666.819) [-666.429] (-665.317) * (-666.203) (-668.841) (-666.872) [-665.404] -- 0:00:20
Average standard deviation of split frequencies: 0.009658
645500 -- (-669.576) (-666.959) [-666.275] (-666.030) * (-666.675) (-669.662) (-666.326) [-666.771] -- 0:00:20
646000 -- (-668.975) (-666.817) [-666.970] (-669.959) * [-667.201] (-671.357) (-667.037) (-665.664) -- 0:00:20
646500 -- (-674.233) (-665.967) (-666.018) [-668.200] * [-669.743] (-667.389) (-669.490) (-666.164) -- 0:00:20
647000 -- (-669.676) [-665.567] (-666.166) (-670.662) * [-668.356] (-667.525) (-666.729) (-668.274) -- 0:00:20
647500 -- [-667.608] (-667.878) (-669.664) (-666.287) * (-669.363) (-667.688) [-667.450] (-667.229) -- 0:00:21
648000 -- (-667.534) [-667.557] (-666.145) (-670.026) * (-668.942) (-668.509) [-666.938] (-668.163) -- 0:00:21
648500 -- (-667.315) [-667.615] (-665.722) (-668.680) * (-669.025) (-665.809) (-667.634) [-667.872] -- 0:00:21
649000 -- (-665.457) (-668.400) [-669.072] (-665.664) * (-667.984) (-665.804) (-670.273) [-666.065] -- 0:00:21
649500 -- [-666.143] (-665.845) (-668.309) (-665.609) * (-670.510) (-667.512) [-665.071] (-667.526) -- 0:00:21
650000 -- (-665.899) (-666.992) (-664.964) [-668.014] * (-666.503) [-667.304] (-665.123) (-666.233) -- 0:00:21
Average standard deviation of split frequencies: 0.009333
650500 -- (-668.990) (-670.671) [-665.116] (-665.725) * (-666.436) (-669.553) [-665.226] (-665.799) -- 0:00:20
651000 -- (-666.429) (-670.377) (-665.823) [-666.354] * (-669.181) (-666.818) [-665.746] (-668.751) -- 0:00:20
651500 -- (-667.093) (-667.763) (-668.302) [-668.696] * (-671.018) (-666.167) [-668.506] (-666.832) -- 0:00:20
652000 -- (-667.218) (-666.554) [-666.379] (-667.031) * (-666.808) (-670.722) [-667.340] (-666.199) -- 0:00:20
652500 -- (-667.407) (-669.581) [-665.581] (-666.672) * (-667.829) (-670.625) (-668.288) [-668.230] -- 0:00:20
653000 -- [-666.314] (-665.394) (-670.232) (-668.262) * (-665.116) [-669.511] (-668.558) (-672.640) -- 0:00:20
653500 -- [-665.733] (-666.525) (-666.616) (-666.848) * (-665.592) (-668.315) (-666.860) [-666.748] -- 0:00:20
654000 -- (-666.907) [-667.479] (-665.963) (-677.896) * (-667.483) [-665.653] (-669.458) (-666.215) -- 0:00:20
654500 -- (-665.001) (-666.800) [-670.387] (-670.151) * (-669.695) [-666.522] (-669.866) (-669.403) -- 0:00:20
655000 -- [-665.500] (-666.962) (-667.538) (-668.312) * [-666.218] (-667.070) (-666.774) (-671.644) -- 0:00:20
Average standard deviation of split frequencies: 0.009252
655500 -- (-666.571) (-667.876) [-667.183] (-669.282) * (-668.340) (-667.731) [-666.036] (-671.091) -- 0:00:20
656000 -- (-669.649) [-667.859] (-671.126) (-668.878) * (-665.452) (-670.318) (-669.526) [-666.939] -- 0:00:20
656500 -- [-668.010] (-665.379) (-665.948) (-666.719) * (-666.321) [-667.558] (-666.853) (-666.771) -- 0:00:20
657000 -- (-666.498) (-666.689) [-666.466] (-666.860) * (-665.736) (-665.878) (-668.631) [-665.823] -- 0:00:20
657500 -- (-665.680) (-668.711) (-666.890) [-666.824] * (-665.674) [-665.930] (-668.535) (-669.644) -- 0:00:20
658000 -- (-668.238) (-669.073) [-666.288] (-665.914) * [-665.058] (-665.663) (-665.811) (-672.090) -- 0:00:20
658500 -- (-670.617) (-675.319) (-666.735) [-666.911] * (-668.007) (-665.698) [-668.069] (-666.455) -- 0:00:20
659000 -- (-669.535) (-668.525) [-666.827] (-666.374) * (-667.146) (-668.424) (-667.427) [-665.374] -- 0:00:20
659500 -- (-669.011) (-669.361) [-667.672] (-665.460) * [-665.940] (-667.655) (-673.941) (-666.093) -- 0:00:20
660000 -- (-669.654) (-665.378) [-665.940] (-665.951) * [-665.861] (-667.002) (-668.825) (-667.360) -- 0:00:20
Average standard deviation of split frequencies: 0.009499
660500 -- (-667.330) (-667.772) (-675.011) [-665.165] * [-666.996] (-665.977) (-667.021) (-666.987) -- 0:00:20
661000 -- (-666.264) [-666.916] (-667.609) (-666.787) * (-668.249) (-666.207) (-669.486) [-667.242] -- 0:00:20
661500 -- (-665.919) (-670.102) (-667.515) [-667.333] * (-665.140) (-667.703) [-665.770] (-669.245) -- 0:00:19
662000 -- [-667.913] (-667.735) (-670.359) (-667.569) * (-665.561) (-669.699) (-668.574) [-669.102] -- 0:00:19
662500 -- (-669.135) (-665.403) [-665.263] (-670.353) * (-665.941) (-671.396) (-670.520) [-670.114] -- 0:00:19
663000 -- [-666.071] (-666.852) (-665.207) (-671.944) * (-668.139) (-665.848) [-669.788] (-670.022) -- 0:00:19
663500 -- [-668.448] (-667.392) (-666.758) (-667.085) * (-670.761) (-666.159) (-668.149) [-670.503] -- 0:00:19
664000 -- [-666.226] (-668.183) (-667.059) (-666.521) * [-666.633] (-666.501) (-667.352) (-675.575) -- 0:00:20
664500 -- (-665.780) (-668.854) [-665.972] (-671.079) * (-666.159) [-667.340] (-668.690) (-674.825) -- 0:00:20
665000 -- [-668.360] (-665.292) (-665.734) (-666.541) * (-668.439) (-666.833) [-665.216] (-666.954) -- 0:00:20
Average standard deviation of split frequencies: 0.009688
665500 -- (-665.413) (-669.064) (-667.200) [-667.110] * (-667.583) (-666.520) [-665.658] (-672.367) -- 0:00:20
666000 -- (-665.871) (-668.389) (-668.867) [-665.251] * (-666.969) (-667.065) [-666.017] (-668.997) -- 0:00:20
666500 -- [-665.212] (-670.349) (-667.103) (-665.759) * (-665.497) [-668.244] (-666.379) (-667.867) -- 0:00:20
667000 -- [-666.401] (-667.484) (-670.240) (-665.914) * (-665.466) [-666.050] (-665.995) (-667.575) -- 0:00:19
667500 -- (-671.647) (-673.561) [-668.122] (-665.587) * (-665.406) [-666.205] (-667.116) (-665.976) -- 0:00:19
668000 -- (-666.674) (-668.298) (-666.875) [-666.277] * [-667.708] (-668.304) (-666.387) (-668.388) -- 0:00:19
668500 -- (-669.718) [-665.335] (-667.131) (-665.716) * (-669.319) [-670.890] (-667.774) (-673.838) -- 0:00:19
669000 -- (-669.144) [-665.904] (-668.358) (-666.890) * (-666.286) [-666.453] (-665.930) (-667.788) -- 0:00:19
669500 -- (-668.412) [-667.855] (-670.074) (-667.377) * [-665.325] (-666.599) (-667.671) (-669.504) -- 0:00:19
670000 -- [-669.859] (-666.886) (-669.698) (-670.717) * (-665.506) [-667.231] (-670.572) (-667.579) -- 0:00:19
Average standard deviation of split frequencies: 0.010016
670500 -- (-666.695) (-669.755) (-665.455) [-665.907] * (-666.131) [-666.293] (-667.872) (-667.722) -- 0:00:19
671000 -- (-675.138) (-668.763) [-667.492] (-667.298) * (-668.518) (-666.677) [-667.980] (-670.402) -- 0:00:19
671500 -- [-667.851] (-667.895) (-666.696) (-667.448) * (-671.659) (-666.680) [-665.566] (-666.882) -- 0:00:19
672000 -- (-666.763) [-667.839] (-666.034) (-665.554) * (-666.774) (-671.186) (-665.118) [-665.478] -- 0:00:19
672500 -- [-667.163] (-665.770) (-666.792) (-665.063) * (-667.680) (-666.951) (-667.429) [-666.190] -- 0:00:19
673000 -- [-666.688] (-667.680) (-667.570) (-668.441) * (-668.715) [-669.353] (-668.446) (-671.031) -- 0:00:19
673500 -- [-669.241] (-667.099) (-667.453) (-672.055) * (-669.848) [-666.537] (-668.361) (-667.115) -- 0:00:19
674000 -- [-670.216] (-666.118) (-667.530) (-667.236) * (-665.822) (-669.406) [-666.316] (-671.800) -- 0:00:19
674500 -- (-669.729) [-665.639] (-667.607) (-668.252) * [-665.720] (-666.714) (-665.631) (-667.436) -- 0:00:19
675000 -- (-668.287) (-668.083) [-668.229] (-666.295) * (-666.402) [-665.929] (-665.936) (-667.884) -- 0:00:19
Average standard deviation of split frequencies: 0.009517
675500 -- (-668.389) [-665.494] (-666.263) (-665.307) * [-666.149] (-667.404) (-665.464) (-671.666) -- 0:00:19
676000 -- (-666.233) (-671.794) (-667.700) [-665.385] * (-665.327) (-666.808) [-667.782] (-666.544) -- 0:00:19
676500 -- (-669.730) (-667.131) (-668.491) [-666.544] * (-670.628) (-667.373) [-668.248] (-671.504) -- 0:00:19
677000 -- (-669.640) (-670.682) [-667.717] (-666.077) * [-667.055] (-667.366) (-670.098) (-665.453) -- 0:00:19
677500 -- (-670.174) [-669.281] (-666.218) (-666.146) * (-666.982) (-666.004) [-666.584] (-668.476) -- 0:00:19
678000 -- (-668.547) (-671.147) (-666.147) [-666.129] * [-666.142] (-667.614) (-668.889) (-666.121) -- 0:00:18
678500 -- (-669.902) (-669.674) (-666.053) [-665.533] * (-665.517) [-668.254] (-669.780) (-666.151) -- 0:00:18
679000 -- (-665.890) (-668.748) (-670.191) [-666.852] * (-665.647) (-666.090) (-668.535) [-667.347] -- 0:00:18
679500 -- (-667.188) (-666.989) (-671.681) [-667.378] * [-665.461] (-671.860) (-668.498) (-668.208) -- 0:00:18
680000 -- [-667.254] (-670.272) (-665.721) (-665.611) * (-669.039) (-672.402) [-667.232] (-665.576) -- 0:00:18
Average standard deviation of split frequencies: 0.009912
680500 -- (-668.834) (-669.571) (-668.039) [-666.417] * (-667.829) (-669.064) [-666.049] (-665.205) -- 0:00:18
681000 -- (-665.631) [-666.628] (-670.551) (-669.738) * (-668.723) [-666.325] (-671.306) (-668.653) -- 0:00:19
681500 -- (-668.996) [-666.913] (-668.274) (-666.001) * (-670.340) (-666.286) [-667.521] (-669.742) -- 0:00:19
682000 -- (-665.560) [-668.908] (-668.124) (-668.921) * (-668.451) (-667.394) [-667.355] (-665.198) -- 0:00:19
682500 -- (-669.099) (-666.577) (-669.877) [-666.940] * (-668.136) [-667.652] (-669.225) (-668.361) -- 0:00:19
683000 -- (-669.542) (-666.157) (-667.321) [-668.124] * [-669.120] (-666.631) (-669.833) (-667.221) -- 0:00:19
683500 -- (-667.653) (-666.609) [-667.636] (-667.604) * (-668.329) (-667.551) (-666.400) [-669.138] -- 0:00:18
684000 -- (-666.199) (-667.729) [-668.825] (-669.334) * [-668.587] (-665.173) (-667.483) (-666.410) -- 0:00:18
684500 -- [-668.798] (-668.255) (-666.211) (-665.071) * (-669.268) (-665.295) [-667.819] (-670.347) -- 0:00:18
685000 -- (-669.007) [-667.847] (-672.455) (-670.628) * (-666.519) [-666.234] (-667.586) (-665.548) -- 0:00:18
Average standard deviation of split frequencies: 0.008857
685500 -- (-669.791) [-667.575] (-668.730) (-669.388) * (-665.267) (-671.718) (-667.552) [-667.177] -- 0:00:18
686000 -- (-666.497) (-667.638) (-666.951) [-666.224] * (-665.267) (-666.329) [-669.444] (-665.729) -- 0:00:18
686500 -- (-666.882) (-665.500) [-666.279] (-668.471) * (-667.080) (-667.237) (-669.084) [-665.543] -- 0:00:18
687000 -- (-666.606) [-671.722] (-667.416) (-666.781) * (-669.491) (-665.641) [-667.783] (-668.520) -- 0:00:18
687500 -- (-666.832) (-680.642) (-665.081) [-669.243] * (-667.057) [-666.198] (-672.249) (-667.925) -- 0:00:18
688000 -- [-670.170] (-670.535) (-667.328) (-669.248) * [-665.610] (-666.567) (-665.747) (-667.324) -- 0:00:18
688500 -- (-666.910) (-667.427) [-668.598] (-671.286) * (-668.502) [-668.268] (-665.722) (-667.208) -- 0:00:18
689000 -- [-669.219] (-666.826) (-666.519) (-666.460) * (-671.179) [-666.931] (-666.007) (-669.090) -- 0:00:18
689500 -- (-666.917) [-666.419] (-666.519) (-666.159) * [-668.213] (-666.411) (-666.199) (-667.986) -- 0:00:18
690000 -- (-667.500) [-666.779] (-672.934) (-665.658) * (-671.881) [-666.701] (-668.122) (-670.279) -- 0:00:18
Average standard deviation of split frequencies: 0.009074
690500 -- (-665.525) [-666.057] (-667.133) (-669.529) * (-667.630) (-666.947) [-668.598] (-667.202) -- 0:00:18
691000 -- [-665.730] (-667.421) (-667.357) (-670.473) * [-667.145] (-667.166) (-667.900) (-670.713) -- 0:00:18
691500 -- (-665.626) [-666.722] (-666.499) (-667.514) * (-665.401) (-668.808) (-669.184) [-667.208] -- 0:00:18
692000 -- [-668.655] (-670.604) (-665.992) (-668.357) * (-667.818) (-668.511) (-665.868) [-666.152] -- 0:00:18
692500 -- (-665.885) (-668.937) (-666.481) [-666.132] * (-672.384) (-669.594) (-667.425) [-667.406] -- 0:00:18
693000 -- [-668.389] (-666.014) (-668.118) (-666.664) * [-667.761] (-672.065) (-670.274) (-666.752) -- 0:00:18
693500 -- [-665.079] (-666.448) (-669.026) (-668.067) * (-668.010) (-667.027) [-667.122] (-669.098) -- 0:00:18
694000 -- (-667.417) (-665.302) [-666.743] (-669.304) * (-667.424) (-667.703) (-669.606) [-665.886] -- 0:00:18
694500 -- (-668.256) [-668.222] (-666.218) (-667.609) * (-667.205) (-668.994) (-670.208) [-672.835] -- 0:00:18
695000 -- [-668.480] (-669.403) (-667.646) (-665.425) * (-670.526) (-670.094) [-665.498] (-671.318) -- 0:00:17
Average standard deviation of split frequencies: 0.009059
695500 -- (-668.225) [-671.270] (-667.008) (-665.829) * (-669.248) [-667.345] (-667.565) (-672.938) -- 0:00:17
696000 -- [-667.254] (-667.943) (-669.534) (-666.907) * (-668.023) [-668.516] (-667.396) (-667.111) -- 0:00:17
696500 -- (-665.454) (-666.064) (-665.843) [-667.808] * (-668.005) [-666.929] (-665.626) (-665.438) -- 0:00:17
697000 -- [-665.490] (-665.503) (-665.575) (-664.962) * (-668.117) [-667.041] (-666.673) (-666.110) -- 0:00:17
697500 -- (-668.333) (-667.191) (-665.186) [-665.602] * [-669.330] (-666.797) (-665.730) (-667.063) -- 0:00:17
698000 -- (-666.378) [-666.771] (-668.430) (-666.970) * [-668.127] (-667.466) (-667.975) (-673.195) -- 0:00:18
698500 -- (-666.977) [-669.961] (-666.105) (-670.031) * [-665.871] (-667.153) (-668.528) (-668.240) -- 0:00:18
699000 -- [-666.947] (-665.751) (-666.566) (-665.965) * (-666.729) (-667.894) (-667.684) [-665.542] -- 0:00:18
699500 -- (-670.829) [-665.728] (-668.000) (-667.361) * [-669.529] (-667.022) (-667.146) (-668.161) -- 0:00:18
700000 -- (-668.057) (-667.011) (-666.575) [-674.083] * [-666.713] (-671.162) (-669.435) (-667.039) -- 0:00:18
Average standard deviation of split frequencies: 0.008872
700500 -- (-668.228) [-665.340] (-669.499) (-668.643) * [-665.836] (-667.546) (-666.091) (-666.393) -- 0:00:17
701000 -- (-668.450) (-668.768) [-666.327] (-674.436) * (-666.370) (-666.118) (-669.573) [-668.054] -- 0:00:17
701500 -- [-666.162] (-666.730) (-668.482) (-666.110) * (-671.903) [-667.434] (-665.926) (-666.204) -- 0:00:17
702000 -- (-667.758) (-668.649) [-666.872] (-670.486) * [-667.708] (-667.939) (-666.423) (-667.140) -- 0:00:17
702500 -- [-670.978] (-672.423) (-668.429) (-665.866) * [-666.004] (-670.388) (-666.720) (-668.905) -- 0:00:17
703000 -- (-669.762) (-673.312) (-665.728) [-667.280] * (-674.209) (-668.366) [-666.248] (-669.045) -- 0:00:17
703500 -- (-665.509) (-670.463) (-668.936) [-667.193] * (-666.156) (-668.236) (-668.389) [-666.762] -- 0:00:17
704000 -- (-669.223) (-668.727) [-668.789] (-668.905) * (-670.413) (-666.689) (-671.032) [-665.271] -- 0:00:17
704500 -- (-666.742) (-667.611) [-669.371] (-668.601) * (-670.093) (-667.396) [-666.133] (-665.215) -- 0:00:17
705000 -- (-667.616) (-665.536) (-667.315) [-667.827] * [-669.393] (-666.620) (-666.478) (-665.253) -- 0:00:17
Average standard deviation of split frequencies: 0.008972
705500 -- (-667.568) (-668.320) [-667.319] (-668.005) * [-666.768] (-669.990) (-668.179) (-666.666) -- 0:00:17
706000 -- (-667.652) (-666.804) [-667.259] (-669.604) * (-667.644) [-669.359] (-667.443) (-667.065) -- 0:00:17
706500 -- [-672.354] (-667.937) (-666.307) (-667.073) * (-668.305) (-665.643) [-667.684] (-666.384) -- 0:00:17
707000 -- (-669.182) (-666.433) [-665.648] (-665.758) * [-666.259] (-666.110) (-666.253) (-669.872) -- 0:00:17
707500 -- (-668.533) (-667.588) (-665.880) [-666.535] * (-668.182) (-664.974) [-666.407] (-665.435) -- 0:00:17
708000 -- (-666.249) (-666.849) [-668.515] (-666.274) * (-668.067) (-665.624) [-667.042] (-667.763) -- 0:00:17
708500 -- [-666.468] (-665.627) (-666.825) (-667.811) * (-666.970) (-665.339) (-665.652) [-670.463] -- 0:00:17
709000 -- (-665.646) [-664.804] (-672.220) (-667.935) * (-671.873) (-668.263) (-668.419) [-667.186] -- 0:00:17
709500 -- (-665.147) (-668.909) (-670.545) [-667.056] * (-669.091) (-668.929) (-669.072) [-669.280] -- 0:00:17
710000 -- (-667.661) (-666.557) (-665.370) [-665.679] * [-664.961] (-671.949) (-668.039) (-671.226) -- 0:00:17
Average standard deviation of split frequencies: 0.008996
710500 -- (-668.984) (-666.475) (-665.348) [-667.305] * (-665.823) (-669.261) [-667.052] (-667.368) -- 0:00:17
711000 -- (-670.528) (-666.499) [-668.115] (-669.727) * (-666.034) [-665.358] (-669.576) (-665.200) -- 0:00:17
711500 -- (-666.977) [-669.715] (-668.110) (-670.152) * [-667.197] (-665.509) (-669.077) (-668.907) -- 0:00:17
712000 -- [-667.249] (-667.524) (-668.065) (-670.050) * (-666.193) (-666.365) (-666.012) [-665.332] -- 0:00:16
712500 -- (-669.681) (-668.095) (-669.242) [-670.173] * (-665.359) [-666.686] (-665.470) (-667.666) -- 0:00:16
713000 -- [-665.800] (-666.165) (-665.686) (-668.004) * (-669.959) (-666.496) [-666.092] (-668.137) -- 0:00:16
713500 -- [-665.891] (-666.209) (-665.378) (-668.833) * (-668.162) (-666.900) [-666.664] (-667.737) -- 0:00:16
714000 -- (-665.943) [-671.705] (-664.940) (-666.093) * (-666.144) [-667.632] (-670.722) (-667.827) -- 0:00:16
714500 -- (-669.723) (-666.134) (-667.131) [-666.650] * (-665.324) [-665.513] (-667.481) (-666.890) -- 0:00:17
715000 -- (-668.208) (-668.522) [-668.723] (-666.963) * (-666.350) [-665.266] (-666.548) (-665.091) -- 0:00:17
Average standard deviation of split frequencies: 0.008436
715500 -- (-668.674) (-670.466) (-667.884) [-668.245] * (-671.774) (-665.933) (-666.545) [-665.693] -- 0:00:17
716000 -- (-668.082) (-669.447) [-665.780] (-667.950) * (-668.121) (-665.889) (-667.576) [-666.054] -- 0:00:17
716500 -- (-668.687) (-669.147) [-668.656] (-668.042) * (-666.519) [-666.330] (-667.130) (-666.790) -- 0:00:17
717000 -- (-666.277) [-664.950] (-665.077) (-672.486) * (-668.441) (-666.154) [-665.663] (-671.555) -- 0:00:16
717500 -- (-665.944) [-667.482] (-665.739) (-668.052) * (-666.202) [-665.850] (-670.244) (-666.226) -- 0:00:16
718000 -- (-669.298) (-666.427) (-665.762) [-665.941] * (-668.772) (-666.075) (-671.802) [-665.353] -- 0:00:16
718500 -- [-666.278] (-666.917) (-666.939) (-666.999) * (-666.661) [-665.737] (-666.532) (-667.081) -- 0:00:16
719000 -- [-666.698] (-667.438) (-666.283) (-669.103) * (-665.597) (-667.722) [-666.997] (-668.760) -- 0:00:16
719500 -- [-667.203] (-666.316) (-667.167) (-665.813) * [-666.433] (-665.616) (-667.151) (-667.563) -- 0:00:16
720000 -- (-668.800) [-666.162] (-666.342) (-665.308) * [-668.613] (-666.103) (-667.537) (-667.751) -- 0:00:16
Average standard deviation of split frequencies: 0.008504
720500 -- (-667.787) (-668.280) (-669.915) [-667.529] * (-668.389) [-667.035] (-670.034) (-667.657) -- 0:00:16
721000 -- [-667.564] (-667.080) (-665.518) (-665.687) * (-665.964) [-665.500] (-665.774) (-668.566) -- 0:00:16
721500 -- [-668.061] (-667.842) (-665.917) (-665.124) * (-668.113) [-668.428] (-669.575) (-666.041) -- 0:00:16
722000 -- (-670.074) (-666.636) [-666.034] (-665.498) * [-666.052] (-668.783) (-669.139) (-666.151) -- 0:00:16
722500 -- (-666.911) (-667.173) [-666.371] (-665.579) * (-666.706) (-668.048) (-666.652) [-665.998] -- 0:00:16
723000 -- (-666.883) (-666.930) (-664.991) [-666.213] * (-668.761) [-667.180] (-671.379) (-666.020) -- 0:00:16
723500 -- (-669.980) (-668.846) [-665.599] (-665.895) * (-670.704) (-668.918) (-665.915) [-667.623] -- 0:00:16
724000 -- (-666.648) [-668.496] (-666.298) (-668.650) * [-665.434] (-670.574) (-665.626) (-665.736) -- 0:00:16
724500 -- (-667.770) [-666.531] (-668.146) (-667.722) * (-668.689) (-670.463) [-668.564] (-667.235) -- 0:00:16
725000 -- (-669.321) [-668.622] (-666.153) (-674.562) * [-665.866] (-670.289) (-669.637) (-666.057) -- 0:00:16
Average standard deviation of split frequencies: 0.008319
725500 -- (-667.295) (-667.083) [-666.973] (-666.860) * [-667.234] (-669.998) (-666.434) (-670.831) -- 0:00:16
726000 -- (-667.155) (-670.964) [-667.897] (-666.469) * (-670.500) (-665.862) (-668.117) [-666.942] -- 0:00:16
726500 -- (-678.644) (-668.043) (-665.690) [-665.289] * (-670.338) (-666.145) [-668.026] (-671.327) -- 0:00:16
727000 -- [-666.433] (-666.940) (-665.648) (-666.100) * (-668.615) [-665.864] (-667.198) (-666.422) -- 0:00:16
727500 -- (-667.873) (-666.837) [-667.720] (-666.501) * (-667.694) [-666.394] (-669.791) (-669.599) -- 0:00:16
728000 -- (-665.967) [-668.596] (-667.664) (-671.514) * [-666.692] (-666.147) (-671.793) (-667.806) -- 0:00:16
728500 -- (-665.636) [-668.022] (-668.689) (-670.122) * (-665.905) (-667.722) [-669.299] (-674.772) -- 0:00:16
729000 -- (-670.409) (-669.374) [-666.977] (-670.023) * (-665.293) (-669.261) [-667.221] (-668.755) -- 0:00:15
729500 -- [-670.953] (-666.836) (-666.331) (-668.111) * (-667.256) (-667.134) [-667.593] (-670.251) -- 0:00:15
730000 -- (-666.005) (-666.634) (-666.899) [-666.930] * (-665.187) (-667.638) (-666.257) [-665.733] -- 0:00:15
Average standard deviation of split frequencies: 0.007984
730500 -- (-665.769) (-668.433) (-666.464) [-665.973] * (-665.972) (-665.509) [-668.159] (-668.033) -- 0:00:15
731000 -- (-666.807) (-666.651) [-666.625] (-668.593) * [-666.265] (-669.620) (-668.086) (-666.109) -- 0:00:15
731500 -- (-668.305) (-673.528) (-669.959) [-667.862] * [-667.459] (-666.335) (-666.621) (-669.377) -- 0:00:16
732000 -- (-666.885) (-667.309) [-669.037] (-667.948) * (-669.263) [-664.922] (-668.496) (-665.352) -- 0:00:16
732500 -- (-668.342) [-665.342] (-666.578) (-667.952) * (-671.741) [-664.922] (-668.315) (-668.275) -- 0:00:16
733000 -- [-667.960] (-665.747) (-665.514) (-667.368) * [-667.896] (-667.185) (-668.687) (-666.331) -- 0:00:16
733500 -- (-665.346) (-665.957) [-665.329] (-666.669) * (-666.441) (-669.524) (-674.696) [-665.885] -- 0:00:15
734000 -- [-665.724] (-667.046) (-666.270) (-669.706) * (-667.278) (-667.565) (-670.683) [-666.047] -- 0:00:15
734500 -- (-667.653) (-669.902) (-667.007) [-669.435] * (-665.846) (-669.297) (-667.674) [-668.774] -- 0:00:15
735000 -- (-668.035) [-667.378] (-667.475) (-666.437) * (-668.502) [-668.393] (-666.022) (-667.827) -- 0:00:15
Average standard deviation of split frequencies: 0.007966
735500 -- (-666.775) (-666.992) [-668.698] (-666.999) * [-669.362] (-667.828) (-668.972) (-669.007) -- 0:00:15
736000 -- (-666.389) (-665.639) (-665.646) [-665.588] * [-667.975] (-666.248) (-666.710) (-669.003) -- 0:00:15
736500 -- (-665.980) [-665.755] (-666.643) (-667.745) * [-669.564] (-670.290) (-671.331) (-669.777) -- 0:00:15
737000 -- (-669.580) [-665.191] (-666.924) (-665.089) * (-669.614) [-667.376] (-667.170) (-670.600) -- 0:00:15
737500 -- (-669.055) [-668.785] (-666.902) (-665.557) * (-667.422) [-667.470] (-665.897) (-669.519) -- 0:00:15
738000 -- (-667.006) (-665.584) [-665.617] (-665.088) * (-672.357) [-669.248] (-666.231) (-670.155) -- 0:00:15
738500 -- (-667.277) (-666.827) (-667.292) [-665.934] * [-667.767] (-669.447) (-665.723) (-666.384) -- 0:00:15
739000 -- [-666.220] (-667.410) (-671.172) (-665.442) * (-667.672) (-667.334) [-665.983] (-667.002) -- 0:00:15
739500 -- (-667.729) [-666.055] (-672.535) (-666.164) * (-666.393) (-668.867) (-667.980) [-669.437] -- 0:00:15
740000 -- [-666.507] (-666.961) (-669.041) (-669.037) * [-665.573] (-665.420) (-665.530) (-668.285) -- 0:00:15
Average standard deviation of split frequencies: 0.007638
740500 -- (-671.064) (-668.165) [-669.779] (-665.417) * [-666.801] (-666.643) (-666.677) (-667.224) -- 0:00:15
741000 -- (-670.783) [-669.424] (-668.413) (-665.555) * (-666.317) [-668.128] (-665.604) (-666.964) -- 0:00:15
741500 -- (-668.301) (-668.444) [-667.032] (-668.158) * (-667.280) [-666.007] (-667.790) (-666.429) -- 0:00:15
742000 -- (-669.178) [-667.376] (-666.761) (-669.852) * (-668.030) (-668.442) (-667.325) [-666.278] -- 0:00:15
742500 -- [-667.127] (-669.183) (-668.395) (-672.175) * (-665.569) (-670.759) [-667.261] (-666.709) -- 0:00:15
743000 -- (-674.384) [-665.604] (-672.707) (-667.306) * (-665.292) [-666.917] (-666.684) (-665.693) -- 0:00:15
743500 -- (-667.169) [-668.584] (-666.621) (-668.454) * [-666.442] (-668.678) (-666.525) (-666.532) -- 0:00:15
744000 -- [-667.657] (-667.832) (-668.027) (-666.484) * (-665.838) (-667.814) [-664.978] (-667.668) -- 0:00:15
744500 -- (-666.801) [-667.943] (-666.941) (-665.039) * (-666.902) (-669.501) [-669.894] (-667.415) -- 0:00:15
745000 -- (-666.182) (-667.040) (-667.137) [-667.142] * (-670.817) (-666.830) [-671.378] (-665.655) -- 0:00:15
Average standard deviation of split frequencies: 0.007662
745500 -- (-666.245) (-669.185) (-667.453) [-666.707] * (-668.327) (-669.137) [-665.894] (-668.920) -- 0:00:15
746000 -- (-665.748) [-666.657] (-667.938) (-668.269) * [-666.249] (-665.507) (-666.700) (-666.986) -- 0:00:14
746500 -- (-666.938) (-665.416) (-667.443) [-666.173] * [-666.810] (-666.479) (-666.187) (-664.835) -- 0:00:14
747000 -- [-666.330] (-666.686) (-668.179) (-667.240) * (-666.326) (-666.519) (-665.892) [-668.333] -- 0:00:14
747500 -- [-667.824] (-666.434) (-671.579) (-672.043) * [-665.370] (-667.304) (-666.171) (-665.624) -- 0:00:14
748000 -- (-665.234) (-665.239) (-666.245) [-666.190] * (-665.639) (-666.164) (-668.936) [-665.825] -- 0:00:14
748500 -- [-666.129] (-666.273) (-670.134) (-668.774) * (-669.279) [-673.625] (-668.645) (-667.766) -- 0:00:15
749000 -- (-666.282) (-667.789) [-667.616] (-665.604) * (-668.406) (-671.838) (-667.703) [-669.249] -- 0:00:15
749500 -- [-666.191] (-670.362) (-665.750) (-665.536) * (-665.717) (-670.388) (-666.286) [-667.165] -- 0:00:15
750000 -- (-667.224) (-668.429) [-668.457] (-666.817) * (-668.732) (-667.910) [-666.899] (-667.455) -- 0:00:15
Average standard deviation of split frequencies: 0.007654
750500 -- [-666.226] (-668.873) (-666.471) (-667.787) * (-667.445) [-666.417] (-665.435) (-669.417) -- 0:00:14
751000 -- (-667.917) (-669.772) [-665.413] (-666.154) * [-667.873] (-669.989) (-665.783) (-667.467) -- 0:00:14
751500 -- [-665.063] (-673.059) (-666.547) (-666.288) * (-667.731) [-667.064] (-667.612) (-666.219) -- 0:00:14
752000 -- (-666.418) (-668.180) [-665.786] (-665.970) * [-666.506] (-666.891) (-668.245) (-666.451) -- 0:00:14
752500 -- (-666.936) (-671.640) (-665.672) [-665.896] * (-667.335) [-666.356] (-669.305) (-666.683) -- 0:00:14
753000 -- (-667.399) [-668.209] (-666.052) (-665.760) * (-666.051) (-666.579) [-668.472] (-666.407) -- 0:00:14
753500 -- [-667.400] (-665.555) (-667.013) (-668.068) * (-669.755) (-668.729) (-669.396) [-666.423] -- 0:00:14
754000 -- [-667.128] (-667.886) (-665.897) (-669.932) * (-673.445) [-667.398] (-667.761) (-669.448) -- 0:00:14
754500 -- (-669.376) (-669.833) (-668.244) [-666.851] * (-667.568) (-665.966) [-668.057] (-669.157) -- 0:00:14
755000 -- [-665.456] (-667.759) (-666.786) (-666.685) * (-670.677) [-666.723] (-667.785) (-666.425) -- 0:00:14
Average standard deviation of split frequencies: 0.007950
755500 -- (-668.698) [-667.176] (-667.402) (-665.979) * (-669.227) (-670.593) (-666.539) [-667.461] -- 0:00:14
756000 -- (-667.221) (-665.070) (-665.765) [-673.520] * (-665.498) [-669.091] (-667.829) (-670.877) -- 0:00:14
756500 -- (-666.640) (-669.644) [-668.621] (-667.692) * (-668.203) (-665.968) [-666.668] (-672.095) -- 0:00:14
757000 -- (-665.888) [-668.873] (-670.421) (-668.887) * [-670.260] (-667.314) (-665.804) (-667.480) -- 0:00:14
757500 -- (-666.165) (-667.230) (-668.259) [-667.722] * (-665.780) (-665.256) [-665.234] (-668.062) -- 0:00:14
758000 -- (-668.561) [-665.437] (-668.387) (-665.969) * [-666.328] (-665.908) (-667.071) (-668.838) -- 0:00:14
758500 -- (-666.881) (-666.337) [-666.924] (-665.879) * [-669.423] (-666.231) (-678.295) (-666.444) -- 0:00:14
759000 -- (-670.392) [-666.095] (-667.072) (-666.149) * (-666.579) (-667.659) (-672.101) [-668.951] -- 0:00:14
759500 -- (-668.479) (-665.899) [-667.664] (-666.807) * (-665.802) [-668.144] (-667.850) (-670.534) -- 0:00:14
760000 -- (-667.524) (-671.526) [-667.149] (-665.215) * (-665.545) [-668.039] (-667.497) (-666.445) -- 0:00:14
Average standard deviation of split frequencies: 0.008095
760500 -- (-666.631) (-667.139) [-665.532] (-666.281) * (-668.068) (-674.921) [-665.695] (-665.291) -- 0:00:14
761000 -- (-665.781) [-666.036] (-666.082) (-667.629) * [-666.596] (-669.591) (-668.959) (-665.902) -- 0:00:14
761500 -- (-670.795) (-666.603) (-667.936) [-667.217] * (-669.882) (-667.582) [-667.183] (-668.298) -- 0:00:14
762000 -- (-666.276) [-666.021] (-666.853) (-667.277) * (-668.991) (-670.848) (-665.740) [-668.491] -- 0:00:14
762500 -- (-665.171) (-667.847) [-667.285] (-666.620) * (-669.210) [-668.194] (-666.340) (-671.292) -- 0:00:14
763000 -- (-666.607) (-669.837) [-665.423] (-666.393) * [-669.702] (-666.547) (-670.681) (-669.092) -- 0:00:13
763500 -- (-668.311) (-665.818) [-668.109] (-666.898) * (-666.159) [-665.411] (-668.488) (-668.329) -- 0:00:13
764000 -- [-667.276] (-666.749) (-669.771) (-665.182) * [-670.054] (-668.322) (-667.449) (-669.020) -- 0:00:13
764500 -- (-666.387) [-667.146] (-668.867) (-666.821) * [-664.807] (-668.621) (-666.253) (-666.753) -- 0:00:13
765000 -- [-668.568] (-668.296) (-667.035) (-668.594) * (-669.335) (-668.925) [-667.616] (-666.476) -- 0:00:14
Average standard deviation of split frequencies: 0.008116
765500 -- (-669.979) (-669.674) (-668.438) [-668.896] * (-672.220) (-667.524) (-668.407) [-666.872] -- 0:00:14
766000 -- [-666.061] (-667.921) (-667.055) (-667.456) * (-670.368) (-668.411) (-666.443) [-665.742] -- 0:00:14
766500 -- (-666.992) (-670.469) (-668.252) [-666.752] * (-671.204) (-667.088) (-666.587) [-665.214] -- 0:00:14
767000 -- (-667.801) (-667.233) [-667.385] (-668.481) * (-669.970) (-665.822) (-666.449) [-667.180] -- 0:00:13
767500 -- (-666.617) (-667.239) (-667.506) [-666.466] * (-672.148) (-665.662) [-665.399] (-668.063) -- 0:00:13
768000 -- (-673.057) (-667.207) (-669.505) [-666.641] * (-668.441) (-667.375) [-665.491] (-666.893) -- 0:00:13
768500 -- (-666.842) (-666.923) (-670.187) [-667.081] * (-665.721) (-664.966) (-665.801) [-670.933] -- 0:00:13
769000 -- (-666.837) [-667.383] (-667.408) (-665.431) * (-665.837) [-664.940] (-666.710) (-669.419) -- 0:00:13
769500 -- (-666.505) [-666.958] (-668.928) (-668.447) * (-665.159) (-669.421) (-667.125) [-665.823] -- 0:00:13
770000 -- [-667.609] (-669.190) (-668.663) (-668.466) * [-666.181] (-669.541) (-669.426) (-671.585) -- 0:00:13
Average standard deviation of split frequencies: 0.008411
770500 -- (-665.297) [-668.445] (-665.451) (-668.952) * (-669.685) (-669.444) [-665.740] (-666.612) -- 0:00:13
771000 -- (-667.893) (-665.042) (-667.435) [-666.405] * [-667.884] (-671.551) (-666.752) (-671.566) -- 0:00:13
771500 -- (-669.218) (-666.823) [-667.678] (-668.436) * [-666.298] (-672.075) (-671.197) (-666.929) -- 0:00:13
772000 -- (-670.970) (-666.495) (-667.243) [-668.894] * (-669.566) (-669.123) [-668.653] (-666.531) -- 0:00:13
772500 -- (-667.332) (-668.540) [-666.936] (-667.317) * (-667.740) [-671.365] (-667.888) (-665.995) -- 0:00:13
773000 -- (-667.059) [-667.618] (-670.870) (-667.394) * [-665.477] (-667.333) (-666.648) (-665.581) -- 0:00:13
773500 -- (-665.863) [-666.920] (-667.594) (-667.799) * [-669.639] (-668.172) (-668.044) (-664.930) -- 0:00:13
774000 -- [-665.673] (-666.547) (-666.060) (-665.971) * (-665.678) (-666.698) (-668.960) [-667.368] -- 0:00:13
774500 -- (-665.974) [-669.495] (-665.804) (-666.288) * (-665.893) [-668.277] (-671.232) (-665.968) -- 0:00:13
775000 -- (-672.096) [-666.063] (-666.979) (-668.352) * [-667.059] (-666.467) (-674.976) (-667.082) -- 0:00:13
Average standard deviation of split frequencies: 0.008315
775500 -- (-669.531) (-667.931) [-668.041] (-668.009) * [-665.393] (-668.720) (-666.533) (-667.017) -- 0:00:13
776000 -- (-668.199) (-667.157) [-666.135] (-667.774) * (-667.185) (-666.435) [-667.442] (-669.170) -- 0:00:13
776500 -- [-666.292] (-670.079) (-668.858) (-669.354) * (-667.565) (-667.030) (-667.386) [-666.816] -- 0:00:13
777000 -- (-665.835) [-669.869] (-667.782) (-672.061) * (-666.180) (-668.048) (-666.364) [-666.494] -- 0:00:13
777500 -- [-665.760] (-666.029) (-666.072) (-670.704) * [-666.578] (-671.550) (-667.623) (-666.725) -- 0:00:13
778000 -- (-667.263) [-667.211] (-666.260) (-667.754) * (-667.515) [-667.126] (-665.463) (-665.018) -- 0:00:13
778500 -- (-666.292) (-665.938) (-667.046) [-667.073] * (-666.009) (-667.930) (-666.629) [-669.795] -- 0:00:13
779000 -- (-665.657) [-666.342] (-667.028) (-671.361) * [-669.295] (-667.477) (-671.216) (-666.253) -- 0:00:13
779500 -- (-666.494) (-672.603) [-668.130] (-671.472) * (-676.810) (-666.880) (-665.391) [-669.628] -- 0:00:13
780000 -- (-666.301) [-667.168] (-667.867) (-672.953) * (-670.080) (-667.715) (-667.373) [-665.050] -- 0:00:12
Average standard deviation of split frequencies: 0.008378
780500 -- (-665.110) (-667.942) (-665.611) [-666.047] * (-667.296) (-667.156) (-669.159) [-665.380] -- 0:00:12
781000 -- (-667.677) (-669.444) (-665.076) [-668.160] * [-666.707] (-669.902) (-666.438) (-665.637) -- 0:00:12
781500 -- (-669.874) (-667.269) [-665.252] (-667.647) * (-667.343) [-665.453] (-666.106) (-666.257) -- 0:00:13
782000 -- (-666.869) (-665.742) [-666.083] (-665.718) * (-665.708) (-665.694) (-666.536) [-668.883] -- 0:00:13
782500 -- (-665.804) (-667.166) [-666.827] (-669.791) * [-667.330] (-666.235) (-666.131) (-669.952) -- 0:00:13
783000 -- (-666.591) (-666.154) [-665.427] (-669.810) * (-666.444) (-669.065) [-667.360] (-667.266) -- 0:00:13
783500 -- [-668.619] (-666.984) (-666.283) (-671.560) * (-666.270) [-665.349] (-666.683) (-666.485) -- 0:00:12
784000 -- (-667.683) [-665.691] (-665.507) (-670.847) * (-667.676) (-669.141) [-666.171] (-665.312) -- 0:00:12
784500 -- [-666.651] (-665.310) (-666.613) (-667.384) * (-666.600) (-670.102) [-666.586] (-666.022) -- 0:00:12
785000 -- [-666.741] (-666.155) (-666.894) (-668.655) * (-670.186) [-673.471] (-667.005) (-669.595) -- 0:00:12
Average standard deviation of split frequencies: 0.008134
785500 -- (-666.337) (-666.397) (-665.535) [-668.092] * [-666.943] (-667.306) (-669.223) (-668.014) -- 0:00:12
786000 -- (-668.064) (-669.726) [-665.372] (-667.051) * [-667.187] (-667.661) (-665.658) (-666.479) -- 0:00:12
786500 -- (-667.125) (-666.590) [-666.559] (-667.838) * [-666.771] (-666.033) (-668.405) (-665.982) -- 0:00:12
787000 -- (-672.537) [-666.680] (-670.471) (-670.663) * (-670.851) (-668.717) [-665.757] (-666.797) -- 0:00:12
787500 -- [-674.176] (-666.592) (-673.235) (-665.163) * (-667.965) (-668.638) (-669.630) [-667.103] -- 0:00:12
788000 -- (-665.259) (-666.593) (-669.124) [-670.324] * (-668.813) [-669.063] (-666.913) (-666.794) -- 0:00:12
788500 -- (-666.480) [-670.337] (-671.157) (-667.972) * (-669.298) (-666.953) (-667.984) [-668.957] -- 0:00:12
789000 -- (-669.595) (-670.319) [-669.085] (-671.122) * (-669.077) (-667.018) [-667.148] (-665.802) -- 0:00:12
789500 -- (-667.792) (-672.250) (-667.594) [-669.087] * (-665.880) (-665.965) [-669.681] (-669.967) -- 0:00:12
790000 -- (-668.312) (-668.861) (-668.961) [-668.069] * (-665.699) (-666.094) [-667.308] (-669.222) -- 0:00:12
Average standard deviation of split frequencies: 0.008012
790500 -- (-667.526) (-666.303) (-665.732) [-667.623] * [-674.157] (-665.995) (-666.733) (-665.704) -- 0:00:12
791000 -- (-666.185) (-665.305) (-666.997) [-666.902] * (-671.032) (-666.124) [-665.784] (-665.692) -- 0:00:12
791500 -- (-669.597) [-665.099] (-665.573) (-667.660) * (-671.157) (-666.718) (-665.337) [-668.250] -- 0:00:12
792000 -- (-666.312) [-665.227] (-666.306) (-669.465) * (-668.336) (-666.938) [-665.444] (-667.214) -- 0:00:12
792500 -- (-671.952) (-667.810) (-666.204) [-666.265] * (-668.828) (-669.834) (-666.716) [-667.929] -- 0:00:12
793000 -- [-668.805] (-666.245) (-665.206) (-666.571) * (-666.126) (-668.185) [-667.437] (-668.202) -- 0:00:12
793500 -- [-668.526] (-667.656) (-670.957) (-665.595) * (-666.964) [-666.322] (-667.074) (-670.543) -- 0:00:12
794000 -- [-668.952] (-667.355) (-667.619) (-671.680) * (-666.817) (-669.535) (-667.717) [-667.868] -- 0:00:12
794500 -- (-668.443) (-672.351) (-668.545) [-668.650] * (-666.490) (-669.136) (-665.859) [-667.487] -- 0:00:12
795000 -- (-671.670) (-670.517) (-670.837) [-666.443] * (-667.248) [-667.787] (-668.308) (-665.630) -- 0:00:12
Average standard deviation of split frequencies: 0.008106
795500 -- (-665.960) (-666.753) (-668.569) [-666.607] * (-668.056) (-666.944) [-668.042] (-665.825) -- 0:00:12
796000 -- (-665.629) (-668.064) (-665.888) [-666.066] * (-669.419) (-669.421) [-667.008] (-667.640) -- 0:00:12
796500 -- [-666.102] (-666.284) (-665.814) (-667.212) * (-670.572) (-668.053) [-666.236] (-667.302) -- 0:00:12
797000 -- [-665.534] (-664.934) (-667.396) (-666.626) * (-673.716) [-670.853] (-667.691) (-667.571) -- 0:00:11
797500 -- (-666.963) (-666.314) (-666.202) [-665.387] * [-666.778] (-671.428) (-666.412) (-667.897) -- 0:00:11
798000 -- (-667.198) (-668.846) [-667.538] (-665.672) * [-665.181] (-665.516) (-667.929) (-667.582) -- 0:00:11
798500 -- (-667.735) (-668.722) (-669.961) [-665.393] * [-669.423] (-669.494) (-666.796) (-667.829) -- 0:00:12
799000 -- [-669.504] (-667.491) (-667.043) (-665.264) * (-669.140) [-667.455] (-667.784) (-670.163) -- 0:00:12
799500 -- [-667.873] (-666.908) (-667.359) (-665.453) * (-667.086) (-666.743) [-666.875] (-667.161) -- 0:00:12
800000 -- (-667.524) (-669.334) (-666.121) [-666.128] * [-669.527] (-664.932) (-668.600) (-668.603) -- 0:00:12
Average standard deviation of split frequencies: 0.008427
800500 -- (-668.778) [-666.143] (-667.137) (-668.058) * (-667.470) (-666.689) (-666.025) [-667.365] -- 0:00:11
801000 -- [-666.127] (-665.489) (-667.411) (-668.617) * (-667.707) (-667.119) (-672.532) [-666.317] -- 0:00:11
801500 -- [-669.373] (-667.438) (-667.374) (-668.021) * (-666.746) [-668.332] (-667.580) (-665.876) -- 0:00:11
802000 -- (-667.937) [-667.740] (-672.431) (-668.830) * (-670.160) [-667.367] (-669.323) (-666.616) -- 0:00:11
802500 -- (-666.875) (-666.592) (-672.554) [-666.750] * (-671.191) [-666.010] (-668.759) (-666.264) -- 0:00:11
803000 -- [-667.311] (-667.530) (-669.370) (-666.246) * (-667.858) (-668.111) (-666.298) [-668.800] -- 0:00:11
803500 -- (-668.504) (-667.547) [-666.439] (-666.086) * (-668.111) (-666.326) [-666.543] (-665.819) -- 0:00:11
804000 -- (-667.221) (-665.570) (-665.904) [-668.834] * (-670.849) [-667.090] (-665.017) (-666.279) -- 0:00:11
804500 -- (-667.842) [-669.657] (-668.472) (-669.652) * (-667.454) (-666.456) [-665.744] (-665.983) -- 0:00:11
805000 -- (-667.332) [-669.754] (-673.101) (-669.580) * (-665.735) (-668.889) [-667.728] (-668.940) -- 0:00:11
Average standard deviation of split frequencies: 0.008554
805500 -- (-666.252) (-667.948) [-667.479] (-667.175) * (-668.736) [-670.051] (-667.168) (-666.329) -- 0:00:11
806000 -- (-667.606) (-669.380) [-669.800] (-666.426) * [-668.813] (-665.017) (-667.222) (-665.984) -- 0:00:11
806500 -- (-666.311) [-668.359] (-667.271) (-666.319) * (-668.426) (-667.412) (-667.944) [-667.298] -- 0:00:11
807000 -- (-670.445) (-666.312) (-669.317) [-667.649] * [-667.839] (-665.497) (-669.011) (-673.716) -- 0:00:11
807500 -- (-670.162) [-671.039] (-667.404) (-668.350) * (-666.095) (-665.970) [-671.260] (-669.666) -- 0:00:11
808000 -- (-667.743) (-665.803) (-667.625) [-666.049] * (-672.131) [-668.932] (-669.394) (-667.159) -- 0:00:11
808500 -- [-666.643] (-667.803) (-666.618) (-666.577) * [-669.777] (-665.701) (-666.848) (-665.097) -- 0:00:11
809000 -- (-666.990) [-666.322] (-667.834) (-667.670) * (-670.142) (-667.960) (-666.780) [-667.276] -- 0:00:11
809500 -- (-666.214) (-667.517) (-669.014) [-665.914] * (-672.753) (-666.940) (-665.815) [-666.307] -- 0:00:11
810000 -- (-667.352) (-669.531) (-665.584) [-668.034] * (-669.061) (-666.005) [-668.836] (-668.672) -- 0:00:11
Average standard deviation of split frequencies: 0.008395
810500 -- (-667.414) (-666.897) [-666.631] (-667.105) * (-666.877) (-667.895) [-665.929] (-666.629) -- 0:00:11
811000 -- (-665.880) (-666.922) (-666.586) [-668.457] * (-667.107) (-667.188) [-667.382] (-666.045) -- 0:00:11
811500 -- (-666.146) (-665.662) (-666.467) [-666.841] * [-673.312] (-666.324) (-668.527) (-665.949) -- 0:00:11
812000 -- [-666.484] (-669.547) (-667.883) (-666.162) * (-667.866) (-671.673) [-669.743] (-666.029) -- 0:00:11
812500 -- (-666.065) (-665.866) [-667.552] (-667.499) * (-665.287) (-665.398) (-670.748) [-665.138] -- 0:00:11
813000 -- (-668.052) (-667.016) (-667.264) [-668.967] * (-665.716) [-666.679] (-668.006) (-672.729) -- 0:00:11
813500 -- (-666.993) (-665.976) [-667.074] (-667.677) * (-666.876) (-666.207) [-666.251] (-665.505) -- 0:00:11
814000 -- (-665.583) (-669.051) (-667.730) [-666.183] * [-666.387] (-668.051) (-672.240) (-666.454) -- 0:00:10
814500 -- (-666.285) (-668.040) (-666.856) [-669.800] * (-669.819) [-666.630] (-668.977) (-665.637) -- 0:00:10
815000 -- (-666.218) (-665.972) (-667.948) [-671.249] * (-668.311) (-669.083) (-666.772) [-665.374] -- 0:00:10
Average standard deviation of split frequencies: 0.008413
815500 -- (-667.352) (-670.869) (-668.036) [-666.033] * [-667.805] (-670.427) (-672.855) (-666.400) -- 0:00:11
816000 -- (-666.306) (-666.168) [-668.846] (-665.471) * (-669.650) (-670.912) [-671.576] (-668.945) -- 0:00:11
816500 -- [-666.508] (-666.832) (-668.067) (-665.238) * [-668.224] (-672.106) (-671.627) (-669.677) -- 0:00:11
817000 -- (-671.780) (-665.468) [-666.169] (-669.037) * [-665.847] (-670.772) (-668.336) (-671.242) -- 0:00:10
817500 -- (-665.404) (-666.137) [-667.179] (-668.185) * (-668.011) (-672.378) [-668.605] (-668.325) -- 0:00:10
818000 -- (-669.744) (-665.789) (-665.499) [-667.051] * (-666.628) [-667.553] (-666.187) (-666.233) -- 0:00:10
818500 -- (-670.083) (-664.993) [-665.457] (-667.283) * (-667.453) [-667.238] (-666.834) (-667.094) -- 0:00:10
819000 -- (-665.767) (-667.822) [-668.106] (-665.754) * (-668.648) [-669.338] (-668.163) (-667.223) -- 0:00:10
819500 -- (-671.784) (-666.417) (-666.380) [-667.013] * (-669.121) (-665.277) [-667.876] (-669.751) -- 0:00:10
820000 -- (-671.033) (-667.400) (-666.862) [-667.181] * (-665.903) (-668.770) (-667.210) [-666.848] -- 0:00:10
Average standard deviation of split frequencies: 0.008580
820500 -- [-666.793] (-666.089) (-667.193) (-665.291) * [-665.912] (-668.512) (-666.752) (-666.410) -- 0:00:10
821000 -- (-666.535) (-668.656) (-667.496) [-665.711] * (-667.693) (-670.758) (-664.936) [-668.518] -- 0:00:10
821500 -- [-665.986] (-665.749) (-665.577) (-666.620) * (-667.567) (-666.079) (-665.900) [-666.374] -- 0:00:10
822000 -- (-666.777) (-666.358) [-665.619] (-666.871) * (-667.357) (-667.409) [-667.136] (-667.199) -- 0:00:10
822500 -- (-666.868) (-669.338) (-668.562) [-667.004] * (-667.228) (-668.694) (-671.255) [-668.175] -- 0:00:10
823000 -- (-666.060) [-666.407] (-666.721) (-668.553) * (-667.443) (-670.499) [-665.553] (-672.310) -- 0:00:10
823500 -- (-666.914) [-665.497] (-668.081) (-666.886) * (-665.693) [-667.074] (-665.066) (-667.424) -- 0:00:10
824000 -- (-667.174) (-665.653) [-666.567] (-668.439) * (-668.306) [-667.558] (-665.075) (-665.921) -- 0:00:10
824500 -- [-666.403] (-665.907) (-670.971) (-665.921) * [-665.052] (-671.460) (-665.542) (-669.289) -- 0:00:10
825000 -- (-668.558) [-670.762] (-666.290) (-665.536) * [-665.517] (-666.728) (-667.893) (-666.025) -- 0:00:10
Average standard deviation of split frequencies: 0.008168
825500 -- (-671.246) [-668.432] (-667.114) (-666.497) * (-665.435) (-667.880) [-668.565] (-670.681) -- 0:00:10
826000 -- (-666.028) (-666.535) (-668.665) [-668.820] * (-672.082) [-667.287] (-668.181) (-667.103) -- 0:00:10
826500 -- (-666.629) (-667.036) [-668.123] (-667.202) * (-668.117) (-665.268) [-665.159] (-666.529) -- 0:00:10
827000 -- (-666.955) (-665.753) [-665.086] (-668.228) * (-671.672) [-667.782] (-666.647) (-670.431) -- 0:00:10
827500 -- (-665.368) (-666.403) [-666.206] (-666.376) * (-669.601) (-667.648) (-666.391) [-670.177] -- 0:00:10
828000 -- (-665.199) [-665.427] (-672.661) (-668.676) * (-666.904) [-666.711] (-668.199) (-668.734) -- 0:00:10
828500 -- (-667.634) [-665.472] (-672.703) (-666.694) * (-669.141) [-665.958] (-668.032) (-669.091) -- 0:00:10
829000 -- (-669.533) (-667.908) (-665.331) [-666.121] * (-670.480) [-665.989] (-670.416) (-668.496) -- 0:00:10
829500 -- (-667.642) (-666.866) [-665.564] (-669.377) * (-670.287) [-666.161] (-669.175) (-667.918) -- 0:00:10
830000 -- (-672.075) (-669.644) [-670.902] (-666.214) * (-668.066) [-666.103] (-666.893) (-666.506) -- 0:00:10
Average standard deviation of split frequencies: 0.008335
830500 -- [-669.267] (-665.836) (-667.077) (-667.929) * (-666.178) (-669.262) [-667.385] (-668.779) -- 0:00:10
831000 -- (-672.608) [-667.940] (-665.929) (-665.964) * [-668.510] (-668.038) (-666.671) (-667.614) -- 0:00:09
831500 -- (-669.339) (-665.282) (-667.213) [-666.345] * (-666.551) [-667.283] (-666.909) (-667.439) -- 0:00:09
832000 -- (-669.859) (-665.112) [-668.786] (-665.404) * [-667.920] (-666.428) (-669.118) (-666.168) -- 0:00:10
832500 -- (-667.735) (-666.219) (-668.800) [-665.969] * (-665.787) (-665.378) (-671.235) [-667.968] -- 0:00:10
833000 -- [-668.023] (-667.020) (-665.995) (-666.447) * [-665.179] (-669.168) (-665.129) (-669.399) -- 0:00:10
833500 -- (-668.818) (-666.656) (-668.857) [-670.385] * [-666.493] (-666.785) (-667.322) (-670.320) -- 0:00:09
834000 -- (-667.454) [-665.407] (-666.125) (-670.347) * [-667.823] (-666.047) (-671.597) (-671.799) -- 0:00:09
834500 -- (-668.681) [-667.498] (-667.160) (-669.076) * (-669.429) [-667.172] (-671.231) (-667.083) -- 0:00:09
835000 -- (-667.034) (-667.042) (-667.036) [-666.887] * [-666.485] (-665.965) (-668.063) (-666.848) -- 0:00:09
Average standard deviation of split frequencies: 0.008956
835500 -- (-665.220) [-665.450] (-668.296) (-669.832) * (-666.672) (-666.600) (-668.347) [-668.154] -- 0:00:09
836000 -- (-665.594) [-667.287] (-669.333) (-668.619) * (-674.049) (-666.137) [-669.002] (-666.849) -- 0:00:09
836500 -- (-665.693) (-666.883) (-667.300) [-667.273] * (-665.901) (-670.793) (-668.588) [-670.732] -- 0:00:09
837000 -- (-666.691) [-666.405] (-666.300) (-669.028) * [-666.151] (-667.607) (-666.907) (-667.761) -- 0:00:09
837500 -- (-665.541) (-668.471) [-666.364] (-670.456) * (-670.199) (-667.970) [-668.973] (-667.625) -- 0:00:09
838000 -- (-666.117) [-666.023] (-665.998) (-669.241) * (-668.206) (-668.938) (-672.949) [-669.614] -- 0:00:09
838500 -- (-667.931) (-665.343) (-666.317) [-667.900] * (-669.881) (-665.999) (-667.266) [-666.688] -- 0:00:09
839000 -- (-667.558) (-665.275) [-665.878] (-665.701) * (-674.764) (-666.350) [-667.471] (-667.784) -- 0:00:09
839500 -- (-667.350) (-668.795) [-669.622] (-666.184) * [-666.487] (-665.946) (-667.281) (-667.009) -- 0:00:09
840000 -- (-667.301) (-669.095) [-665.521] (-667.889) * [-666.181] (-665.451) (-671.707) (-667.824) -- 0:00:09
Average standard deviation of split frequencies: 0.008411
840500 -- [-665.338] (-667.695) (-665.718) (-665.610) * (-667.945) (-667.172) [-666.603] (-665.805) -- 0:00:09
841000 -- [-670.204] (-667.116) (-665.403) (-669.848) * (-668.143) [-666.524] (-666.857) (-667.354) -- 0:00:09
841500 -- (-666.991) (-666.841) (-667.695) [-667.664] * (-668.246) (-665.740) (-669.472) [-666.053] -- 0:00:09
842000 -- (-667.071) (-669.190) [-666.690] (-668.331) * (-665.900) [-666.181] (-665.203) (-667.033) -- 0:00:09
842500 -- (-665.545) (-668.964) (-669.227) [-665.156] * [-668.415] (-666.528) (-665.479) (-670.450) -- 0:00:09
843000 -- [-666.174] (-665.598) (-667.050) (-665.204) * [-666.589] (-665.683) (-666.349) (-669.860) -- 0:00:09
843500 -- (-666.583) (-667.063) (-668.206) [-668.275] * (-670.199) [-667.507] (-665.848) (-666.998) -- 0:00:09
844000 -- (-665.653) (-668.015) (-666.381) [-666.000] * (-667.170) [-670.403] (-665.783) (-667.677) -- 0:00:09
844500 -- [-665.324] (-667.111) (-667.562) (-666.318) * [-666.778] (-667.267) (-667.830) (-668.747) -- 0:00:09
845000 -- [-666.112] (-668.179) (-666.434) (-667.016) * (-666.950) [-670.555] (-665.847) (-669.621) -- 0:00:09
Average standard deviation of split frequencies: 0.008915
845500 -- (-665.164) [-666.334] (-665.795) (-668.420) * (-667.469) [-669.965] (-665.035) (-670.327) -- 0:00:09
846000 -- [-665.735] (-667.906) (-666.275) (-666.419) * [-670.185] (-665.472) (-668.940) (-671.072) -- 0:00:09
846500 -- (-667.268) [-666.075] (-666.284) (-666.221) * (-670.830) (-665.569) (-667.886) [-669.536] -- 0:00:09
847000 -- (-667.135) [-667.540] (-666.495) (-665.629) * (-667.123) (-666.198) (-668.459) [-667.510] -- 0:00:09
847500 -- [-666.820] (-666.130) (-669.166) (-665.882) * (-668.184) (-667.559) (-666.867) [-665.416] -- 0:00:08
848000 -- (-668.138) (-668.191) (-666.528) [-664.891] * [-667.291] (-667.373) (-666.821) (-669.445) -- 0:00:08
848500 -- (-667.429) (-668.569) (-667.256) [-665.987] * (-668.017) (-668.095) [-665.875] (-667.353) -- 0:00:08
849000 -- (-669.343) (-667.181) [-669.054] (-665.472) * (-666.659) [-668.947] (-667.513) (-666.564) -- 0:00:09
849500 -- (-665.947) (-668.062) [-665.503] (-666.472) * (-668.261) (-665.364) (-671.677) [-665.118] -- 0:00:09
850000 -- (-667.227) (-665.750) (-668.886) [-665.903] * [-667.987] (-665.731) (-665.985) (-664.958) -- 0:00:09
Average standard deviation of split frequencies: 0.009095
850500 -- [-665.869] (-666.219) (-666.169) (-666.974) * (-669.467) (-666.656) (-667.018) [-666.479] -- 0:00:08
851000 -- (-665.553) (-666.667) [-667.527] (-667.476) * [-667.887] (-666.891) (-667.345) (-667.856) -- 0:00:08
851500 -- [-666.996] (-666.577) (-665.279) (-671.668) * (-666.935) (-667.850) (-669.868) [-667.150] -- 0:00:08
852000 -- (-671.768) (-668.211) [-667.919] (-667.219) * (-666.369) (-668.198) (-669.526) [-667.604] -- 0:00:08
852500 -- [-666.483] (-669.278) (-669.354) (-666.874) * (-670.323) [-666.640] (-668.915) (-669.921) -- 0:00:08
853000 -- (-665.504) [-665.574] (-666.652) (-666.118) * (-667.071) [-666.325] (-672.608) (-667.226) -- 0:00:08
853500 -- (-669.036) (-668.897) (-669.570) [-666.900] * (-669.507) (-668.225) [-670.774] (-667.433) -- 0:00:08
854000 -- (-666.560) (-666.084) [-666.771] (-668.298) * [-667.524] (-665.705) (-666.974) (-666.215) -- 0:00:08
854500 -- (-671.375) [-666.684] (-666.293) (-666.178) * (-667.601) (-666.324) [-667.566] (-667.234) -- 0:00:08
855000 -- (-665.536) (-669.544) (-666.014) [-669.764] * (-666.747) (-668.328) [-667.750] (-665.790) -- 0:00:08
Average standard deviation of split frequencies: 0.009232
855500 -- (-667.763) (-666.457) [-667.682] (-671.831) * [-665.686] (-666.927) (-668.634) (-668.538) -- 0:00:08
856000 -- (-669.275) (-666.922) (-665.884) [-668.416] * [-666.490] (-667.103) (-674.631) (-666.569) -- 0:00:08
856500 -- (-667.733) [-668.305] (-666.115) (-666.769) * [-666.682] (-666.240) (-675.986) (-668.472) -- 0:00:08
857000 -- (-667.906) (-672.950) [-667.886] (-668.779) * (-667.183) (-668.473) [-665.422] (-665.391) -- 0:00:08
857500 -- (-665.833) [-668.881] (-666.263) (-668.779) * (-667.046) (-670.100) (-671.087) [-665.870] -- 0:00:08
858000 -- [-665.775] (-665.998) (-668.053) (-665.739) * [-666.571] (-673.778) (-667.484) (-666.373) -- 0:00:08
858500 -- (-666.995) [-666.863] (-667.181) (-670.690) * (-666.332) (-669.763) [-665.880] (-667.625) -- 0:00:08
859000 -- (-669.066) [-665.539] (-668.202) (-670.086) * [-667.078] (-671.785) (-665.988) (-668.771) -- 0:00:08
859500 -- (-671.734) (-665.948) (-666.793) [-666.530] * (-666.961) (-667.388) [-666.080] (-668.102) -- 0:00:08
860000 -- (-668.481) (-665.051) (-667.243) [-666.210] * (-667.837) [-668.051] (-665.382) (-666.538) -- 0:00:08
Average standard deviation of split frequencies: 0.009072
860500 -- (-675.371) (-669.525) (-667.596) [-668.615] * [-666.962] (-668.295) (-666.293) (-668.130) -- 0:00:08
861000 -- [-667.680] (-668.589) (-666.211) (-674.191) * (-668.111) [-666.348] (-666.748) (-667.525) -- 0:00:08
861500 -- (-666.007) (-668.524) (-667.975) [-671.233] * (-665.914) (-666.496) [-666.296] (-666.137) -- 0:00:08
862000 -- [-665.286] (-665.629) (-667.749) (-666.750) * [-666.058] (-665.928) (-668.934) (-668.130) -- 0:00:08
862500 -- (-665.566) (-669.171) (-665.762) [-666.090] * (-667.956) (-668.115) (-668.142) [-666.160] -- 0:00:08
863000 -- (-666.401) [-667.254] (-668.524) (-666.054) * (-666.681) (-665.886) (-666.461) [-666.577] -- 0:00:08
863500 -- (-666.877) [-666.074] (-665.839) (-668.459) * [-671.217] (-669.067) (-668.838) (-666.956) -- 0:00:08
864000 -- (-665.373) (-668.874) (-669.259) [-666.227] * (-672.687) (-666.567) [-668.346] (-672.763) -- 0:00:08
864500 -- (-665.968) [-665.853] (-669.398) (-665.857) * (-666.922) (-678.971) (-668.283) [-667.538] -- 0:00:07
865000 -- [-666.678] (-668.457) (-665.779) (-671.526) * [-665.793] (-668.688) (-670.939) (-666.929) -- 0:00:07
Average standard deviation of split frequencies: 0.008613
865500 -- [-668.176] (-667.792) (-667.707) (-669.128) * (-670.630) (-668.218) [-666.963] (-665.064) -- 0:00:07
866000 -- (-665.950) [-669.014] (-673.221) (-666.855) * (-665.214) (-666.912) [-667.165] (-666.422) -- 0:00:08
866500 -- (-669.365) (-669.066) [-666.746] (-667.236) * [-667.288] (-666.751) (-665.110) (-668.077) -- 0:00:08
867000 -- [-666.609] (-667.291) (-666.261) (-668.620) * (-666.309) [-666.056] (-665.692) (-665.612) -- 0:00:07
867500 -- (-670.073) (-670.656) [-668.696] (-667.783) * (-666.453) (-670.393) [-667.003] (-666.542) -- 0:00:07
868000 -- (-667.954) [-666.888] (-668.426) (-665.081) * (-666.142) (-668.290) (-667.650) [-667.064] -- 0:00:07
868500 -- (-670.753) [-665.794] (-667.673) (-665.495) * (-665.040) (-669.298) (-666.837) [-666.799] -- 0:00:07
869000 -- (-666.179) (-668.681) (-666.559) [-666.362] * [-665.805] (-666.404) (-669.846) (-667.223) -- 0:00:07
869500 -- [-665.835] (-668.621) (-667.514) (-670.689) * [-665.970] (-668.050) (-667.303) (-667.199) -- 0:00:07
870000 -- (-666.371) (-668.731) [-666.600] (-667.360) * (-665.311) (-670.827) (-668.357) [-666.423] -- 0:00:07
Average standard deviation of split frequencies: 0.008155
870500 -- [-665.535] (-665.406) (-667.849) (-667.171) * (-670.964) (-669.803) (-667.415) [-666.345] -- 0:00:07
871000 -- (-667.639) (-667.490) [-665.699] (-666.398) * (-667.281) (-668.804) (-665.987) [-665.064] -- 0:00:07
871500 -- (-667.756) [-666.438] (-666.090) (-666.278) * (-666.561) [-667.718] (-668.221) (-666.308) -- 0:00:07
872000 -- (-667.599) (-667.802) (-667.426) [-665.729] * [-665.705] (-665.813) (-667.397) (-667.228) -- 0:00:07
872500 -- (-665.923) (-667.635) (-666.551) [-668.156] * [-667.927] (-666.115) (-666.078) (-666.080) -- 0:00:07
873000 -- (-668.308) [-666.879] (-669.024) (-668.655) * (-665.918) [-668.487] (-667.520) (-666.959) -- 0:00:07
873500 -- (-667.970) [-667.834] (-666.358) (-667.019) * [-667.644] (-669.737) (-667.968) (-671.986) -- 0:00:07
874000 -- (-669.385) (-667.705) (-667.928) [-665.269] * (-666.325) (-670.325) (-665.306) [-669.535] -- 0:00:07
874500 -- (-666.717) [-667.063] (-666.097) (-669.463) * (-667.437) (-667.708) [-668.264] (-665.665) -- 0:00:07
875000 -- (-665.980) (-670.683) [-666.139] (-668.613) * (-669.157) (-668.534) [-669.521] (-668.143) -- 0:00:07
Average standard deviation of split frequencies: 0.008139
875500 -- [-671.016] (-667.385) (-669.051) (-673.031) * (-665.382) [-666.863] (-672.187) (-667.779) -- 0:00:07
876000 -- (-667.637) (-666.508) (-673.686) [-667.579] * (-667.840) (-666.990) (-666.154) [-665.840] -- 0:00:07
876500 -- (-667.073) (-665.673) [-666.543] (-673.112) * (-668.789) [-668.216] (-665.536) (-665.559) -- 0:00:07
877000 -- (-665.850) [-666.021] (-665.932) (-667.072) * (-666.440) (-669.346) [-665.634] (-670.431) -- 0:00:07
877500 -- [-668.217] (-666.838) (-665.251) (-666.879) * (-666.435) (-669.621) [-666.224] (-669.218) -- 0:00:07
878000 -- (-668.084) (-666.289) (-665.376) [-668.779] * [-669.970] (-676.509) (-668.009) (-667.636) -- 0:00:07
878500 -- (-668.444) [-665.394] (-665.402) (-665.415) * (-666.695) (-671.570) (-670.761) [-668.521] -- 0:00:07
879000 -- (-668.974) [-666.181] (-665.822) (-666.241) * [-667.057] (-667.725) (-669.772) (-667.925) -- 0:00:07
879500 -- (-668.296) (-667.146) (-670.641) [-667.284] * [-667.005] (-668.159) (-668.683) (-666.746) -- 0:00:07
880000 -- (-668.161) [-668.189] (-666.044) (-668.000) * (-669.448) (-667.529) [-668.143] (-672.189) -- 0:00:07
Average standard deviation of split frequencies: 0.008665
880500 -- (-669.524) [-666.319] (-666.964) (-670.772) * (-666.502) (-669.675) [-665.642] (-666.158) -- 0:00:07
881000 -- (-669.047) (-667.440) (-667.871) [-666.030] * (-666.040) (-672.174) [-667.120] (-667.946) -- 0:00:07
881500 -- (-666.828) (-666.430) (-666.513) [-667.720] * [-665.905] (-666.074) (-669.794) (-670.104) -- 0:00:06
882000 -- (-666.300) [-665.380] (-672.839) (-666.893) * (-666.384) [-667.157] (-666.952) (-667.674) -- 0:00:06
882500 -- (-666.860) [-666.710] (-665.489) (-667.730) * (-667.779) (-666.900) (-667.678) [-669.733] -- 0:00:06
883000 -- (-666.598) [-667.383] (-667.009) (-668.351) * (-666.815) [-667.981] (-668.835) (-666.097) -- 0:00:07
883500 -- (-670.442) (-667.514) [-666.968] (-665.232) * (-667.559) (-669.592) [-667.771] (-666.224) -- 0:00:06
884000 -- [-666.815] (-667.744) (-668.847) (-666.674) * (-666.952) [-668.293] (-667.770) (-668.035) -- 0:00:06
884500 -- (-671.868) (-667.735) [-665.160] (-667.109) * (-669.230) (-668.951) (-666.046) [-668.655] -- 0:00:06
885000 -- (-666.038) [-666.092] (-665.728) (-667.023) * [-668.649] (-666.736) (-665.402) (-666.554) -- 0:00:06
Average standard deviation of split frequencies: 0.008413
885500 -- (-667.168) (-665.346) [-665.959] (-666.032) * [-668.084] (-670.850) (-668.104) (-665.981) -- 0:00:06
886000 -- (-668.463) (-665.084) (-668.325) [-667.028] * [-667.062] (-669.275) (-671.687) (-665.640) -- 0:00:06
886500 -- (-669.494) (-666.324) (-665.943) [-667.704] * (-665.165) (-666.978) (-671.256) [-665.589] -- 0:00:06
887000 -- (-671.264) (-665.671) [-666.252] (-665.257) * (-665.977) (-669.775) [-668.918] (-666.715) -- 0:00:06
887500 -- (-666.871) (-666.257) [-667.685] (-667.787) * (-667.894) [-666.425] (-665.363) (-666.978) -- 0:00:06
888000 -- (-667.613) [-665.497] (-665.391) (-669.391) * (-667.642) (-665.603) (-665.965) [-667.283] -- 0:00:06
888500 -- (-669.866) [-666.886] (-666.999) (-667.541) * (-671.560) (-666.506) [-666.622] (-668.060) -- 0:00:06
889000 -- (-668.433) (-666.884) [-666.324] (-668.252) * (-667.670) [-666.513] (-666.100) (-668.362) -- 0:00:06
889500 -- (-665.519) [-666.766] (-671.309) (-670.004) * (-667.668) (-670.649) [-667.639] (-666.033) -- 0:00:06
890000 -- (-665.293) [-667.073] (-668.872) (-668.380) * (-668.654) (-667.177) (-666.190) [-668.517] -- 0:00:06
Average standard deviation of split frequencies: 0.008667
890500 -- (-665.904) (-667.774) [-665.387] (-671.046) * [-666.716] (-665.288) (-666.809) (-669.574) -- 0:00:06
891000 -- (-666.844) (-669.287) [-665.109] (-667.832) * (-667.720) (-668.563) (-668.581) [-666.667] -- 0:00:06
891500 -- [-667.765] (-667.697) (-674.910) (-666.265) * (-669.558) [-667.241] (-670.006) (-666.128) -- 0:00:06
892000 -- (-667.346) (-673.042) (-668.102) [-665.803] * [-672.175] (-665.417) (-669.168) (-668.449) -- 0:00:06
892500 -- [-666.641] (-666.170) (-666.712) (-668.096) * (-667.015) (-667.850) (-667.830) [-667.779] -- 0:00:06
893000 -- (-665.246) (-673.650) (-666.522) [-668.857] * (-668.654) [-667.771] (-665.773) (-668.632) -- 0:00:06
893500 -- [-665.447] (-669.590) (-668.486) (-665.343) * (-671.980) (-667.663) [-667.040] (-667.540) -- 0:00:06
894000 -- (-664.798) [-666.900] (-669.616) (-666.154) * (-670.143) (-666.787) [-665.879] (-667.911) -- 0:00:06
894500 -- [-673.224] (-666.847) (-667.450) (-665.994) * [-667.501] (-666.490) (-670.332) (-668.039) -- 0:00:06
895000 -- (-667.038) (-666.777) [-667.162] (-665.872) * (-666.822) [-666.523] (-669.855) (-668.265) -- 0:00:06
Average standard deviation of split frequencies: 0.008878
895500 -- (-665.151) [-666.369] (-668.922) (-669.957) * (-669.144) [-665.160] (-668.630) (-667.292) -- 0:00:06
896000 -- (-666.198) (-667.632) (-665.979) [-669.518] * (-667.115) (-665.531) [-667.501] (-668.644) -- 0:00:06
896500 -- [-665.864] (-665.490) (-668.993) (-665.916) * [-669.573] (-670.525) (-671.411) (-665.682) -- 0:00:06
897000 -- (-665.439) [-667.759] (-665.971) (-666.243) * [-669.173] (-668.467) (-670.635) (-666.807) -- 0:00:06
897500 -- [-670.704] (-666.654) (-665.561) (-665.656) * [-670.289] (-668.605) (-668.346) (-665.462) -- 0:00:06
898000 -- (-666.078) (-669.400) [-666.145] (-665.795) * (-671.229) (-668.315) (-670.168) [-665.631] -- 0:00:06
898500 -- [-666.428] (-671.498) (-684.456) (-666.093) * (-666.650) [-668.086] (-670.665) (-668.554) -- 0:00:05
899000 -- [-666.450] (-665.189) (-672.585) (-666.096) * (-665.675) (-671.354) [-668.336] (-670.563) -- 0:00:05
899500 -- (-666.707) (-666.560) [-666.972] (-670.795) * (-668.121) (-667.643) (-668.520) [-668.312] -- 0:00:06
900000 -- (-665.800) [-665.460] (-669.035) (-666.062) * (-666.131) (-666.275) [-669.029] (-668.720) -- 0:00:06
Average standard deviation of split frequencies: 0.008734
900500 -- (-669.781) [-667.010] (-665.342) (-666.366) * (-668.620) (-670.125) [-665.260] (-667.411) -- 0:00:05
901000 -- (-667.904) (-668.658) [-665.369] (-666.042) * (-667.357) (-670.005) (-668.993) [-665.598] -- 0:00:05
901500 -- (-665.415) (-667.151) [-665.317] (-666.919) * [-668.821] (-668.478) (-666.794) (-666.693) -- 0:00:05
902000 -- [-665.240] (-667.266) (-667.138) (-666.352) * (-666.392) [-665.192] (-664.947) (-667.041) -- 0:00:05
902500 -- (-666.153) [-668.220] (-667.883) (-669.457) * [-665.731] (-666.108) (-666.211) (-668.928) -- 0:00:05
903000 -- (-670.146) (-666.568) (-669.204) [-669.821] * (-666.643) (-665.553) [-668.463] (-668.150) -- 0:00:05
903500 -- (-665.673) (-665.337) (-668.600) [-668.169] * (-671.075) [-666.568] (-667.594) (-666.408) -- 0:00:05
904000 -- (-666.992) (-668.641) (-669.702) [-669.519] * (-667.204) (-667.252) [-667.667] (-670.008) -- 0:00:05
904500 -- (-669.106) (-669.883) [-667.871] (-665.280) * [-667.852] (-666.776) (-667.810) (-668.945) -- 0:00:05
905000 -- (-667.247) (-668.174) (-668.019) [-671.150] * (-675.616) (-667.914) (-667.310) [-666.493] -- 0:00:05
Average standard deviation of split frequencies: 0.008488
905500 -- (-668.711) (-668.461) (-672.513) [-668.469] * (-673.725) (-665.682) (-667.319) [-666.652] -- 0:00:05
906000 -- (-665.433) (-669.273) (-671.417) [-668.129] * [-673.000] (-666.255) (-665.291) (-666.702) -- 0:00:05
906500 -- (-667.274) [-667.411] (-667.419) (-665.725) * (-667.761) (-667.017) (-668.338) [-665.427] -- 0:00:05
907000 -- [-666.035] (-669.865) (-666.807) (-670.776) * (-667.617) (-670.871) [-668.416] (-669.197) -- 0:00:05
907500 -- (-668.566) (-667.047) (-664.960) [-668.398] * (-667.415) (-668.061) (-667.963) [-666.940] -- 0:00:05
908000 -- (-669.429) [-667.134] (-666.859) (-668.026) * (-669.912) (-668.002) [-665.712] (-667.791) -- 0:00:05
908500 -- (-668.769) (-667.532) (-670.511) [-671.127] * [-671.233] (-666.259) (-665.860) (-668.383) -- 0:00:05
909000 -- (-665.884) (-665.886) (-667.661) [-667.055] * (-675.524) (-667.050) [-665.955] (-668.434) -- 0:00:05
909500 -- (-666.121) [-666.744] (-667.820) (-670.874) * (-669.925) (-667.548) [-667.856] (-666.972) -- 0:00:05
910000 -- (-667.748) (-666.765) (-668.212) [-670.862] * [-666.333] (-666.932) (-665.491) (-666.509) -- 0:00:05
Average standard deviation of split frequencies: 0.008800
910500 -- (-666.990) (-667.725) (-668.396) [-666.609] * (-666.769) (-666.979) [-665.674] (-667.399) -- 0:00:05
911000 -- (-668.162) (-667.454) (-668.542) [-666.346] * (-668.769) (-670.549) [-666.442] (-664.973) -- 0:00:05
911500 -- (-666.574) (-666.570) (-667.531) [-666.278] * (-669.999) (-679.600) [-668.165] (-672.245) -- 0:00:05
912000 -- (-666.793) (-665.906) (-666.226) [-666.300] * [-670.578] (-666.860) (-667.715) (-665.015) -- 0:00:05
912500 -- (-666.716) (-666.437) [-668.695] (-672.137) * (-668.410) (-665.778) [-669.528] (-665.809) -- 0:00:05
913000 -- [-666.178] (-665.861) (-668.499) (-666.764) * [-665.069] (-665.180) (-669.448) (-667.840) -- 0:00:05
913500 -- (-666.718) (-666.080) [-666.796] (-669.859) * (-667.983) [-670.569] (-667.359) (-671.734) -- 0:00:05
914000 -- [-666.175] (-668.838) (-670.418) (-669.516) * (-667.579) (-666.513) [-669.506] (-671.864) -- 0:00:05
914500 -- (-666.923) (-671.751) (-666.849) [-666.892] * [-666.281] (-669.698) (-665.851) (-674.181) -- 0:00:05
915000 -- (-665.329) (-666.446) [-666.621] (-668.622) * (-666.084) (-665.373) [-668.607] (-669.273) -- 0:00:05
Average standard deviation of split frequencies: 0.008813
915500 -- (-665.735) (-666.017) [-666.261] (-667.389) * (-666.222) (-665.415) (-666.004) [-667.926] -- 0:00:04
916000 -- (-666.083) [-666.146] (-670.016) (-675.377) * [-668.178] (-668.728) (-670.499) (-667.410) -- 0:00:05
916500 -- [-666.179] (-667.605) (-667.391) (-670.377) * (-666.965) (-670.950) (-667.821) [-664.829] -- 0:00:05
917000 -- (-671.185) (-667.598) [-667.675] (-668.600) * (-668.611) (-672.055) [-667.695] (-665.578) -- 0:00:04
917500 -- (-666.342) [-665.864] (-667.123) (-668.547) * (-667.441) (-668.487) [-665.683] (-668.434) -- 0:00:04
918000 -- (-666.807) (-666.425) [-669.420] (-667.098) * (-668.933) (-665.819) (-666.310) [-671.827] -- 0:00:04
918500 -- (-668.039) (-672.911) (-664.851) [-669.645] * (-667.344) (-667.977) [-668.210] (-670.719) -- 0:00:04
919000 -- (-666.820) [-668.131] (-664.926) (-671.011) * [-667.274] (-668.401) (-666.605) (-666.591) -- 0:00:04
919500 -- (-679.518) (-666.922) [-665.358] (-670.977) * (-673.781) (-665.341) (-669.244) [-665.771] -- 0:00:04
920000 -- (-668.711) [-666.822] (-669.659) (-668.121) * (-666.788) [-666.411] (-667.281) (-665.607) -- 0:00:04
Average standard deviation of split frequencies: 0.008864
920500 -- (-669.050) (-665.872) (-665.935) [-666.864] * (-666.831) (-666.638) (-666.482) [-667.940] -- 0:00:04
921000 -- (-666.151) [-665.308] (-669.955) (-668.790) * (-667.209) (-665.942) [-667.518] (-668.196) -- 0:00:04
921500 -- (-666.352) (-666.441) (-670.242) [-667.856] * (-666.111) [-665.711] (-666.611) (-666.412) -- 0:00:04
922000 -- [-667.363] (-670.002) (-666.365) (-667.807) * (-672.828) (-665.838) [-666.747] (-667.786) -- 0:00:04
922500 -- (-665.342) (-667.598) (-665.914) [-666.322] * (-670.328) (-671.800) (-667.570) [-666.791] -- 0:00:04
923000 -- (-665.520) (-667.361) [-665.779] (-665.767) * [-673.310] (-670.211) (-668.117) (-668.478) -- 0:00:04
923500 -- (-665.502) (-668.197) [-666.697] (-666.668) * [-667.465] (-669.012) (-666.616) (-666.485) -- 0:00:04
924000 -- [-665.281] (-666.808) (-667.067) (-668.936) * (-667.779) [-669.257] (-666.704) (-667.054) -- 0:00:04
924500 -- (-665.406) [-668.208] (-669.265) (-667.589) * (-667.332) [-671.344] (-669.054) (-666.248) -- 0:00:04
925000 -- [-665.819] (-666.895) (-672.070) (-670.438) * [-666.666] (-666.725) (-665.582) (-668.557) -- 0:00:04
Average standard deviation of split frequencies: 0.009354
925500 -- (-666.109) (-667.633) [-666.174] (-671.537) * (-669.439) (-667.267) (-666.029) [-667.448] -- 0:00:04
926000 -- [-666.050] (-668.228) (-665.567) (-668.858) * [-668.888] (-668.117) (-667.175) (-669.173) -- 0:00:04
926500 -- (-669.236) (-664.769) [-666.404] (-668.814) * (-668.455) (-666.202) [-665.961] (-665.943) -- 0:00:04
927000 -- (-666.890) (-671.999) (-666.490) [-669.419] * (-667.165) (-667.923) (-666.373) [-666.592] -- 0:00:04
927500 -- [-669.173] (-672.423) (-667.937) (-666.668) * (-666.127) (-665.783) (-666.272) [-666.299] -- 0:00:04
928000 -- (-667.439) [-667.053] (-665.723) (-665.477) * [-670.217] (-666.111) (-669.655) (-668.144) -- 0:00:04
928500 -- (-666.564) (-668.812) (-666.962) [-665.348] * (-669.801) (-666.724) [-666.088] (-670.262) -- 0:00:04
929000 -- (-668.435) (-670.645) [-667.911] (-665.191) * [-664.911] (-667.046) (-667.028) (-668.362) -- 0:00:04
929500 -- (-667.814) (-671.966) [-665.498] (-666.159) * (-667.770) (-666.835) [-668.090] (-667.632) -- 0:00:04
930000 -- (-667.250) (-665.607) [-667.926] (-666.038) * [-668.190] (-666.519) (-669.032) (-668.429) -- 0:00:04
Average standard deviation of split frequencies: 0.008991
930500 -- (-665.572) [-668.015] (-667.925) (-670.264) * (-667.604) (-669.966) [-669.647] (-667.935) -- 0:00:04
931000 -- (-666.176) [-667.817] (-668.552) (-667.427) * [-670.660] (-666.560) (-668.782) (-666.563) -- 0:00:04
931500 -- [-671.843] (-665.389) (-666.267) (-667.027) * (-669.261) [-666.110] (-667.849) (-668.275) -- 0:00:04
932000 -- [-667.659] (-668.798) (-667.969) (-668.232) * [-669.331] (-669.201) (-667.555) (-669.850) -- 0:00:04
932500 -- (-668.261) (-666.658) (-668.590) [-665.895] * [-669.430] (-666.878) (-667.330) (-666.961) -- 0:00:03
933000 -- (-667.152) (-665.590) [-667.043] (-666.043) * (-666.255) (-667.618) [-668.945] (-669.534) -- 0:00:04
933500 -- (-667.751) [-666.930] (-666.634) (-669.056) * [-670.240] (-667.313) (-667.514) (-668.471) -- 0:00:03
934000 -- (-667.995) (-665.595) [-665.968] (-669.074) * (-669.840) [-668.761] (-672.987) (-669.024) -- 0:00:03
934500 -- [-668.914] (-667.569) (-665.801) (-670.837) * (-671.721) (-667.862) (-666.830) [-669.180] -- 0:00:03
935000 -- (-667.022) (-670.508) (-665.503) [-665.589] * (-669.870) [-665.981] (-666.048) (-668.250) -- 0:00:03
Average standard deviation of split frequencies: 0.008845
935500 -- (-665.886) (-666.979) (-668.121) [-668.178] * (-671.058) (-665.835) (-668.018) [-667.467] -- 0:00:03
936000 -- [-665.885] (-666.926) (-668.757) (-666.239) * (-670.668) (-667.537) (-667.228) [-666.366] -- 0:00:03
936500 -- (-665.335) [-665.966] (-667.608) (-667.703) * (-665.977) (-669.351) [-667.599] (-665.821) -- 0:00:03
937000 -- (-665.319) (-665.691) (-666.782) [-666.786] * (-665.496) (-671.518) [-665.526] (-667.200) -- 0:00:03
937500 -- [-667.095] (-665.683) (-667.138) (-670.197) * (-666.879) (-668.927) (-667.368) [-666.992] -- 0:00:03
938000 -- (-667.502) (-666.260) [-667.761] (-669.166) * (-670.731) (-667.088) [-666.345] (-665.915) -- 0:00:03
938500 -- (-667.929) (-668.312) [-667.437] (-668.000) * (-666.326) [-667.873] (-666.515) (-668.563) -- 0:00:03
939000 -- (-669.166) (-666.626) [-666.150] (-665.667) * (-665.937) [-668.294] (-665.935) (-666.913) -- 0:00:03
939500 -- (-667.419) [-667.527] (-667.798) (-667.664) * (-669.140) (-667.106) [-665.726] (-666.183) -- 0:00:03
940000 -- (-668.196) (-667.284) [-666.277] (-667.254) * (-666.058) (-667.378) [-667.269] (-666.181) -- 0:00:03
Average standard deviation of split frequencies: 0.008582
940500 -- (-666.236) (-666.080) [-665.486] (-668.175) * (-665.074) [-665.100] (-665.950) (-665.760) -- 0:00:03
941000 -- (-667.687) (-667.195) (-670.659) [-666.883] * (-670.096) (-665.841) (-668.586) [-665.365] -- 0:00:03
941500 -- (-668.024) [-667.153] (-670.539) (-668.051) * (-669.043) [-665.494] (-666.706) (-667.926) -- 0:00:03
942000 -- (-668.468) (-666.171) (-672.104) [-667.080] * (-665.947) (-666.650) [-666.390] (-667.536) -- 0:00:03
942500 -- (-667.973) (-665.064) (-667.114) [-666.688] * [-668.074] (-666.041) (-666.137) (-665.985) -- 0:00:03
943000 -- [-668.954] (-669.690) (-671.221) (-668.579) * (-666.811) (-667.721) (-665.070) [-668.533] -- 0:00:03
943500 -- (-667.847) (-670.463) [-666.890] (-669.444) * [-666.101] (-668.846) (-666.890) (-666.203) -- 0:00:03
944000 -- (-667.025) (-667.447) (-666.073) [-669.924] * (-666.719) (-669.382) (-668.726) [-666.197] -- 0:00:03
944500 -- (-670.213) (-667.938) [-668.409] (-667.009) * (-667.645) (-668.997) [-669.753] (-669.295) -- 0:00:03
945000 -- (-670.884) [-665.281] (-665.144) (-667.491) * [-669.443] (-668.367) (-667.832) (-669.686) -- 0:00:03
Average standard deviation of split frequencies: 0.008720
945500 -- (-670.242) (-665.136) [-665.859] (-665.645) * (-668.843) (-668.072) (-669.194) [-670.672] -- 0:00:03
946000 -- [-666.933] (-669.128) (-666.936) (-667.399) * (-668.878) [-667.627] (-670.287) (-670.012) -- 0:00:03
946500 -- [-666.984] (-667.495) (-671.442) (-667.031) * (-669.858) [-669.963] (-666.617) (-671.113) -- 0:00:03
947000 -- (-670.560) [-667.851] (-672.391) (-667.760) * (-669.990) [-665.602] (-668.404) (-671.348) -- 0:00:03
947500 -- [-666.761] (-665.768) (-666.111) (-666.804) * (-666.499) [-665.268] (-665.953) (-672.876) -- 0:00:03
948000 -- (-666.994) [-665.612] (-669.121) (-667.093) * (-666.064) (-666.747) (-665.568) [-669.347] -- 0:00:03
948500 -- (-664.925) (-666.693) (-669.081) [-667.636] * (-666.740) (-669.547) (-664.930) [-666.491] -- 0:00:03
949000 -- (-665.376) (-667.981) (-671.106) [-666.887] * (-668.349) [-665.383] (-666.366) (-667.267) -- 0:00:03
949500 -- (-668.260) (-666.561) [-670.368] (-669.107) * [-666.080] (-667.459) (-665.933) (-667.915) -- 0:00:02
950000 -- (-667.538) (-667.960) (-672.745) [-669.817] * [-666.494] (-669.073) (-665.956) (-665.691) -- 0:00:03
Average standard deviation of split frequencies: 0.008647
950500 -- [-666.849] (-669.254) (-666.062) (-665.897) * (-666.565) (-670.127) [-665.737] (-664.994) -- 0:00:02
951000 -- [-668.317] (-666.732) (-667.102) (-670.742) * (-667.200) (-666.991) (-667.380) [-666.560] -- 0:00:02
951500 -- (-666.143) (-670.162) [-665.801] (-670.622) * (-670.053) (-667.722) [-668.136] (-666.544) -- 0:00:02
952000 -- [-665.260] (-672.119) (-668.641) (-666.760) * (-667.855) (-665.780) (-668.877) [-665.702] -- 0:00:02
952500 -- (-667.616) (-669.230) [-666.967] (-666.655) * (-669.993) [-665.328] (-665.803) (-668.047) -- 0:00:02
953000 -- (-669.428) (-671.142) [-667.400] (-665.447) * (-669.246) (-670.131) [-665.932] (-666.197) -- 0:00:02
953500 -- (-667.592) (-669.104) [-667.265] (-671.090) * (-666.536) [-665.424] (-667.689) (-668.555) -- 0:00:02
954000 -- (-666.370) (-669.362) [-666.655] (-667.349) * [-667.328] (-667.287) (-666.092) (-665.567) -- 0:00:02
954500 -- (-668.358) (-668.195) (-665.901) [-667.523] * (-668.312) (-668.029) (-666.912) [-665.570] -- 0:00:02
955000 -- [-670.407] (-668.938) (-668.158) (-667.236) * (-668.540) (-669.208) [-669.663] (-667.097) -- 0:00:02
Average standard deviation of split frequencies: 0.008598
955500 -- [-670.443] (-667.712) (-668.127) (-666.926) * [-667.547] (-669.170) (-666.229) (-669.663) -- 0:00:02
956000 -- (-670.193) [-666.516] (-670.227) (-668.726) * (-666.596) [-666.492] (-667.523) (-669.159) -- 0:00:02
956500 -- (-668.762) (-670.801) [-665.640] (-667.764) * [-670.653] (-670.443) (-667.097) (-670.655) -- 0:00:02
957000 -- [-666.048] (-668.370) (-666.053) (-667.290) * (-667.350) (-667.360) [-666.042] (-671.435) -- 0:00:02
957500 -- (-666.000) [-666.462] (-666.721) (-667.954) * [-669.731] (-667.112) (-667.701) (-674.642) -- 0:00:02
958000 -- (-665.866) [-666.321] (-669.082) (-668.139) * (-667.569) (-669.719) (-667.676) [-671.603] -- 0:00:02
958500 -- (-665.607) (-665.808) [-667.377] (-667.867) * (-668.334) (-665.529) [-665.031] (-670.878) -- 0:00:02
959000 -- [-666.517] (-665.186) (-666.975) (-667.536) * (-667.363) (-666.920) (-665.001) [-665.635] -- 0:00:02
959500 -- [-667.353] (-667.521) (-669.338) (-667.020) * (-666.914) [-666.029] (-666.748) (-665.585) -- 0:00:02
960000 -- (-669.513) (-669.392) (-670.582) [-666.096] * [-671.078] (-667.588) (-665.063) (-665.839) -- 0:00:02
Average standard deviation of split frequencies: 0.008311
960500 -- (-667.142) (-668.647) [-666.573] (-668.401) * (-670.923) (-670.192) (-665.815) [-666.009] -- 0:00:02
961000 -- [-667.945] (-673.507) (-667.290) (-675.145) * (-665.681) [-665.903] (-665.278) (-668.632) -- 0:00:02
961500 -- [-666.350] (-671.560) (-667.225) (-673.113) * [-666.699] (-667.212) (-668.855) (-668.879) -- 0:00:02
962000 -- (-665.564) (-667.603) (-670.227) [-668.153] * [-666.001] (-667.356) (-671.739) (-668.099) -- 0:00:02
962500 -- (-665.160) (-668.046) (-668.728) [-667.206] * (-667.481) (-668.817) [-666.221] (-665.568) -- 0:00:02
963000 -- (-669.110) [-666.741] (-666.759) (-668.587) * (-666.226) [-666.719] (-667.483) (-665.715) -- 0:00:02
963500 -- (-666.224) (-669.366) (-670.389) [-667.088] * (-666.975) [-669.216] (-666.409) (-667.333) -- 0:00:02
964000 -- [-666.520] (-667.395) (-668.673) (-666.717) * [-668.176] (-671.381) (-666.181) (-666.677) -- 0:00:02
964500 -- (-671.082) [-666.792] (-667.065) (-669.522) * (-666.642) (-670.918) (-666.045) [-667.488] -- 0:00:02
965000 -- (-668.517) (-666.487) (-667.212) [-666.103] * [-667.152] (-669.117) (-666.062) (-667.115) -- 0:00:02
Average standard deviation of split frequencies: 0.008570
965500 -- (-668.020) (-666.962) [-667.051] (-667.488) * [-666.444] (-667.596) (-667.028) (-669.494) -- 0:00:02
966000 -- (-665.857) [-666.274] (-667.348) (-665.447) * (-666.503) (-666.735) [-668.988] (-666.301) -- 0:00:02
966500 -- (-667.243) [-667.463] (-668.952) (-665.420) * (-667.797) (-669.224) (-668.286) [-674.588] -- 0:00:02
967000 -- [-666.403] (-666.024) (-666.613) (-667.412) * [-667.330] (-667.737) (-668.248) (-669.170) -- 0:00:01
967500 -- [-667.459] (-667.199) (-668.666) (-666.724) * [-666.659] (-665.074) (-667.242) (-672.664) -- 0:00:01
968000 -- [-666.846] (-666.465) (-668.075) (-667.082) * [-666.513] (-667.531) (-669.042) (-666.816) -- 0:00:01
968500 -- (-666.431) (-665.675) (-666.565) [-674.682] * [-665.225] (-666.340) (-669.164) (-669.574) -- 0:00:01
969000 -- (-666.434) (-667.397) [-668.317] (-673.566) * (-666.614) (-666.364) [-667.222] (-670.323) -- 0:00:01
969500 -- [-665.886] (-668.864) (-669.070) (-669.875) * (-668.103) [-666.032] (-665.971) (-668.539) -- 0:00:01
970000 -- (-667.235) [-667.479] (-669.888) (-666.889) * (-665.251) (-666.058) [-667.950] (-666.702) -- 0:00:01
Average standard deviation of split frequencies: 0.008195
970500 -- (-665.736) (-665.689) (-672.407) [-667.460] * (-667.063) (-666.212) [-667.049] (-668.114) -- 0:00:01
971000 -- (-665.825) [-666.498] (-668.976) (-666.196) * (-666.271) [-666.803] (-667.374) (-668.299) -- 0:00:01
971500 -- (-667.732) [-666.316] (-666.815) (-668.728) * (-667.994) (-666.049) [-667.116] (-666.652) -- 0:00:01
972000 -- (-666.819) (-666.055) (-669.980) [-666.092] * (-667.371) (-668.349) (-666.806) [-666.441] -- 0:00:01
972500 -- (-668.472) [-667.748] (-666.734) (-670.054) * (-668.860) [-669.990] (-666.292) (-667.509) -- 0:00:01
973000 -- [-668.130] (-667.592) (-669.287) (-669.981) * (-667.827) (-666.779) (-665.963) [-669.051] -- 0:00:01
973500 -- (-667.854) (-668.434) [-667.695] (-670.496) * (-667.500) (-668.467) (-667.386) [-666.889] -- 0:00:01
974000 -- (-667.963) (-668.971) (-668.587) [-670.063] * [-665.702] (-669.457) (-670.828) (-667.545) -- 0:00:01
974500 -- [-666.950] (-666.142) (-670.747) (-671.446) * (-668.748) [-665.102] (-668.141) (-667.210) -- 0:00:01
975000 -- (-667.941) [-666.046] (-667.432) (-668.198) * [-666.382] (-666.021) (-665.297) (-666.247) -- 0:00:01
Average standard deviation of split frequencies: 0.008211
975500 -- (-667.286) [-669.427] (-665.441) (-666.718) * [-665.676] (-665.365) (-665.800) (-668.177) -- 0:00:01
976000 -- [-669.928] (-666.459) (-665.218) (-667.516) * (-666.000) (-668.296) (-666.114) [-667.358] -- 0:00:01
976500 -- (-665.885) [-669.222] (-666.494) (-667.303) * (-667.308) (-666.611) (-665.541) [-667.389] -- 0:00:01
977000 -- (-671.177) [-666.886] (-667.199) (-671.667) * (-666.333) (-667.013) [-664.898] (-665.190) -- 0:00:01
977500 -- [-668.243] (-666.952) (-670.761) (-667.281) * (-668.644) [-667.470] (-666.377) (-665.463) -- 0:00:01
978000 -- (-666.736) (-666.434) (-668.007) [-665.668] * (-665.363) (-666.952) [-670.583] (-668.889) -- 0:00:01
978500 -- (-668.757) (-667.095) (-669.608) [-666.574] * [-667.510] (-666.328) (-668.773) (-669.660) -- 0:00:01
979000 -- (-665.925) (-667.805) (-668.553) [-665.495] * [-665.581] (-666.463) (-665.535) (-666.732) -- 0:00:01
979500 -- (-669.936) (-666.985) (-667.891) [-665.478] * (-665.753) (-665.468) [-668.056] (-672.182) -- 0:00:01
980000 -- [-667.901] (-672.953) (-666.534) (-666.330) * (-665.037) (-666.195) (-670.532) [-666.697] -- 0:00:01
Average standard deviation of split frequencies: 0.007962
980500 -- (-666.543) [-667.551] (-666.437) (-668.386) * (-669.157) (-669.126) (-670.365) [-670.295] -- 0:00:01
981000 -- [-668.635] (-667.556) (-668.346) (-668.266) * (-669.519) [-665.865] (-665.110) (-668.674) -- 0:00:01
981500 -- (-666.488) (-666.694) [-665.283] (-668.218) * (-668.898) [-666.017] (-666.944) (-669.095) -- 0:00:01
982000 -- [-668.970] (-671.993) (-665.782) (-666.450) * (-668.062) [-666.724] (-667.538) (-667.372) -- 0:00:01
982500 -- (-666.265) (-666.066) (-667.493) [-666.988] * (-666.511) [-665.849] (-667.086) (-665.868) -- 0:00:01
983000 -- (-667.017) [-666.921] (-666.497) (-668.699) * [-665.864] (-665.229) (-668.200) (-666.365) -- 0:00:01
983500 -- (-668.030) (-666.447) [-665.037] (-667.472) * [-665.681] (-666.443) (-669.154) (-668.904) -- 0:00:00
984000 -- (-667.848) (-669.097) (-669.694) [-667.698] * (-665.782) (-666.589) [-666.834] (-665.414) -- 0:00:00
984500 -- (-667.098) [-667.951] (-671.292) (-667.287) * [-669.486] (-667.113) (-667.487) (-665.317) -- 0:00:00
985000 -- (-668.593) [-665.540] (-667.838) (-667.505) * (-669.236) (-667.605) [-668.172] (-667.510) -- 0:00:00
Average standard deviation of split frequencies: 0.007889
985500 -- (-665.609) (-664.965) (-665.695) [-667.083] * [-667.241] (-665.355) (-666.286) (-666.020) -- 0:00:00
986000 -- [-665.577] (-664.838) (-670.101) (-666.203) * (-666.487) (-669.409) (-668.782) [-667.769] -- 0:00:00
986500 -- (-669.258) (-665.692) [-671.935] (-668.422) * (-668.128) [-666.780] (-667.843) (-668.733) -- 0:00:00
987000 -- (-667.552) [-665.713] (-673.102) (-666.762) * (-668.789) (-668.084) (-666.382) [-667.320] -- 0:00:00
987500 -- (-668.952) (-666.947) [-667.965] (-666.128) * (-669.716) (-667.194) [-668.205] (-668.795) -- 0:00:00
988000 -- (-666.499) [-667.706] (-669.472) (-668.067) * (-665.411) (-668.022) (-671.246) [-665.192] -- 0:00:00
988500 -- (-669.276) (-665.748) [-666.554] (-666.785) * [-665.181] (-665.984) (-667.820) (-670.258) -- 0:00:00
989000 -- (-668.981) (-666.214) (-667.695) [-666.238] * [-667.215] (-665.424) (-668.359) (-672.237) -- 0:00:00
989500 -- [-668.653] (-665.477) (-667.913) (-666.095) * (-669.085) [-667.392] (-671.104) (-666.061) -- 0:00:00
990000 -- [-668.111] (-666.422) (-672.007) (-667.672) * (-666.899) [-666.087] (-667.766) (-665.698) -- 0:00:00
Average standard deviation of split frequencies: 0.007970
990500 -- [-667.263] (-665.096) (-672.408) (-668.677) * (-666.216) (-669.798) [-666.572] (-664.957) -- 0:00:00
991000 -- (-668.625) (-666.181) [-667.571] (-668.315) * [-665.727] (-667.567) (-666.649) (-666.016) -- 0:00:00
991500 -- (-665.993) (-665.578) (-666.682) [-665.989] * (-666.364) (-665.328) (-668.342) [-665.206] -- 0:00:00
992000 -- (-666.263) [-667.784] (-667.272) (-673.330) * (-667.925) (-666.635) (-667.372) [-665.859] -- 0:00:00
992500 -- (-667.848) (-668.211) [-667.526] (-666.370) * (-669.996) (-665.463) [-665.628] (-665.210) -- 0:00:00
993000 -- (-666.272) (-668.041) [-665.627] (-666.500) * (-671.645) (-665.830) [-666.954] (-675.512) -- 0:00:00
993500 -- (-667.900) (-667.673) (-669.547) [-666.188] * (-666.346) [-665.432] (-666.446) (-666.713) -- 0:00:00
994000 -- [-665.627] (-668.510) (-668.439) (-666.611) * [-665.615] (-665.753) (-666.258) (-667.855) -- 0:00:00
994500 -- (-666.136) (-668.480) [-666.988] (-666.461) * [-666.349] (-666.158) (-667.090) (-668.221) -- 0:00:00
995000 -- (-667.568) (-671.084) (-666.204) [-670.028] * [-667.863] (-666.009) (-666.580) (-667.369) -- 0:00:00
Average standard deviation of split frequencies: 0.008076
995500 -- [-664.983] (-671.019) (-665.595) (-665.774) * [-667.382] (-666.114) (-668.610) (-666.627) -- 0:00:00
996000 -- [-667.159] (-666.307) (-667.684) (-667.733) * (-665.854) [-666.146] (-667.838) (-668.946) -- 0:00:00
996500 -- (-668.212) (-667.072) [-666.817] (-667.482) * (-666.141) [-667.472] (-667.782) (-669.798) -- 0:00:00
997000 -- (-666.978) (-667.004) [-667.698] (-667.353) * [-666.059] (-666.148) (-666.204) (-667.013) -- 0:00:00
997500 -- [-669.464] (-666.610) (-668.186) (-666.575) * (-665.943) [-666.460] (-666.678) (-666.877) -- 0:00:00
998000 -- (-666.540) (-667.966) (-669.304) [-668.646] * [-667.595] (-666.002) (-668.907) (-667.270) -- 0:00:00
998500 -- (-669.887) (-666.455) (-666.790) [-665.595] * (-667.763) (-667.157) [-665.493] (-665.294) -- 0:00:00
999000 -- (-667.551) (-666.868) (-671.830) [-665.309] * (-665.636) [-670.400] (-668.462) (-667.466) -- 0:00:00
999500 -- [-668.004] (-667.028) (-669.144) (-667.161) * (-666.001) [-666.257] (-669.652) (-667.037) -- 0:00:00
1000000 -- (-669.855) (-666.895) [-668.938] (-668.950) * (-668.513) (-667.408) (-668.665) [-667.513] -- 0:00:00
Average standard deviation of split frequencies: 0.008038
Analysis completed in 60 seconds
Analysis used 58.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -664.76
Likelihood of best state for "cold" chain of run 2 was -664.76
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.2 % ( 28 %) Dirichlet(Pi{all})
32.9 % ( 22 %) Slider(Pi{all})
79.2 % ( 57 %) Multiplier(Alpha{1,2})
77.6 % ( 45 %) Multiplier(Alpha{3})
23.4 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 36 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.1 % ( 31 %) Dirichlet(Pi{all})
33.9 % ( 32 %) Slider(Pi{all})
78.2 % ( 61 %) Multiplier(Alpha{1,2})
77.3 % ( 55 %) Multiplier(Alpha{3})
23.3 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 93 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166290 0.82 0.67
3 | 166349 166734 0.84
4 | 167219 166736 166672
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166924 0.82 0.66
3 | 166019 166664 0.83
4 | 166246 166617 167530
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -666.50
| 1 1 2 2|
| 1 22 1 1 |
| 2 1 1 |
| 1 * 21 2 2 1 111 2 1 1 |
|1 22 2 2 2 21 1 2 11 1 2 2 |
| 2 112 1 12 2 2 1* 22 22 12 1 1*1 11|
|21 1 *2 1 12 211122* 2 2 * 1 1 |
| 21 2 * 22 2 * |
| 2 1 2 1 2 221 |
| 2 1 1 1 2 |
| 2 2 |
| 1 1 2 |
| 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -668.43
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -666.48 -670.78
2 -666.48 -669.43
--------------------------------------
TOTAL -666.48 -670.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893076 0.090201 0.360688 1.484300 0.857595 1390.00 1445.50 1.000
r(A<->C){all} 0.172310 0.021252 0.000030 0.450354 0.133667 178.07 192.72 1.000
r(A<->G){all} 0.164851 0.020004 0.000001 0.446193 0.128212 222.25 245.99 1.002
r(A<->T){all} 0.164458 0.019678 0.000025 0.454331 0.128378 164.13 229.63 1.002
r(C<->G){all} 0.153685 0.018378 0.000039 0.426975 0.112998 175.14 206.47 1.001
r(C<->T){all} 0.180581 0.022216 0.000277 0.477929 0.142316 148.39 184.00 1.000
r(G<->T){all} 0.164115 0.019287 0.000087 0.447880 0.130005 246.55 275.17 1.001
pi(A){all} 0.237863 0.000375 0.203084 0.277861 0.237006 1127.71 1202.95 1.000
pi(C){all} 0.277893 0.000410 0.239660 0.318723 0.277397 1307.72 1345.15 1.000
pi(G){all} 0.304589 0.000417 0.263593 0.343243 0.304098 1135.53 1204.52 1.000
pi(T){all} 0.179655 0.000290 0.147103 0.213032 0.179272 1290.70 1291.50 1.002
alpha{1,2} 0.421126 0.232270 0.000225 1.365362 0.245181 1002.15 1130.45 1.001
alpha{3} 0.460984 0.252527 0.000136 1.474337 0.291706 990.37 1166.63 1.004
pinvar{all} 0.996763 0.000016 0.989143 0.999998 0.998057 1220.56 1360.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ...*.*
9 -- ..**..
10 -- .**...
11 -- .*..*.
12 -- .****.
13 -- ....**
14 -- .*.***
15 -- .*.*..
16 -- ..****
17 -- ..*..*
18 -- ..*.*.
19 -- .*...*
20 -- ...**.
21 -- .**.**
22 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 487 0.162225 0.004240 0.159227 0.165223 2
8 470 0.156562 0.007537 0.151233 0.161892 2
9 450 0.149900 0.015075 0.139241 0.160560 2
10 446 0.148568 0.010364 0.141239 0.155896 2
11 440 0.146569 0.008480 0.140573 0.152565 2
12 432 0.143904 0.000942 0.143238 0.144570 2
13 430 0.143238 0.014133 0.133245 0.153231 2
14 429 0.142905 0.004240 0.139907 0.145903 2
15 428 0.142572 0.003769 0.139907 0.145237 2
16 422 0.140573 0.005653 0.136576 0.144570 2
17 415 0.138241 0.005182 0.134577 0.141905 2
18 409 0.136243 0.013662 0.126582 0.145903 2
19 408 0.135909 0.001884 0.134577 0.137242 2
20 402 0.133911 0.005653 0.129913 0.137908 2
21 389 0.129580 0.011777 0.121252 0.137908 2
22 272 0.090606 0.016017 0.079280 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100200 0.009804 0.000006 0.304026 0.071098 1.000 2
length{all}[2] 0.099716 0.009667 0.000016 0.305577 0.070549 1.000 2
length{all}[3] 0.098385 0.009636 0.000003 0.291602 0.067823 1.000 2
length{all}[4] 0.099647 0.009813 0.000019 0.294291 0.067695 1.000 2
length{all}[5] 0.097671 0.009752 0.000005 0.284828 0.067650 1.000 2
length{all}[6] 0.100949 0.010220 0.000013 0.303788 0.070303 1.000 2
length{all}[7] 0.097628 0.008703 0.000538 0.267951 0.071062 0.999 2
length{all}[8] 0.100523 0.010732 0.000170 0.301772 0.070418 0.998 2
length{all}[9] 0.095874 0.009771 0.000132 0.275279 0.064918 1.007 2
length{all}[10] 0.106732 0.010857 0.000097 0.302727 0.074209 1.008 2
length{all}[11] 0.098933 0.009471 0.000246 0.298849 0.066459 1.000 2
length{all}[12] 0.109606 0.010531 0.000085 0.312435 0.073594 0.999 2
length{all}[13] 0.095136 0.008101 0.000196 0.274438 0.066848 1.001 2
length{all}[14] 0.091204 0.007604 0.000079 0.267008 0.062963 1.002 2
length{all}[15] 0.099444 0.010478 0.000538 0.314128 0.067229 0.998 2
length{all}[16] 0.107512 0.014317 0.000359 0.359074 0.068155 0.998 2
length{all}[17] 0.092425 0.008873 0.000018 0.278863 0.060684 0.998 2
length{all}[18] 0.097492 0.009390 0.000120 0.287762 0.069072 0.998 2
length{all}[19] 0.091609 0.008203 0.000759 0.263106 0.063961 0.998 2
length{all}[20] 0.100994 0.009349 0.000248 0.305237 0.070311 0.998 2
length{all}[21] 0.103531 0.012189 0.000325 0.317993 0.062969 1.004 2
length{all}[22] 0.090632 0.008386 0.000042 0.301674 0.055272 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008038
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 486
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 162 / 162 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 162 / 162 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040688 0.099180 0.058983 0.046001 0.054418 0.048008 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -679.662422
Iterating by ming2
Initial: fx= 679.662422
x= 0.04069 0.09918 0.05898 0.04600 0.05442 0.04801 0.30000 1.30000
1 h-m-p 0.0000 0.0003 387.3433 +++ 641.036895 m 0.0003 14 | 1/8
2 h-m-p 0.0004 0.0020 74.2042 ++ 637.679704 m 0.0020 25 | 2/8
3 h-m-p 0.0000 0.0000 519.0549 ++ 637.259978 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0002 338.2011 ++ 634.778397 m 0.0002 47 | 4/8
5 h-m-p 0.0000 0.0002 293.5251 ++ 633.871843 m 0.0002 58 | 5/8
6 h-m-p 0.0002 0.0154 218.3318 ++++ 624.451924 m 0.0154 71 | 6/8
7 h-m-p 1.6000 8.0000 0.0002 ---------Y 624.451924 0 0.0000 91
Out..
lnL = -624.451924
92 lfun, 92 eigenQcodon, 552 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016189 0.086162 0.055479 0.076970 0.087498 0.108068 3.248947 0.723737 0.230365
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.349139
np = 9
lnL0 = -690.030172
Iterating by ming2
Initial: fx= 690.030172
x= 0.01619 0.08616 0.05548 0.07697 0.08750 0.10807 3.24895 0.72374 0.23037
1 h-m-p 0.0000 0.0001 355.0002 ++ 676.039412 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 335.4516 ++ 645.920281 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 3555.5572 ++ 632.815878 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0005 116.5684 ++ 628.900879 m 0.0005 50 | 4/9
5 h-m-p 0.0014 0.0071 12.0178 -----------.. | 4/9
6 h-m-p 0.0000 0.0000 272.8186 ++ 627.950641 m 0.0000 83 | 5/9
7 h-m-p 0.0003 0.0286 10.0247 ----------.. | 5/9
8 h-m-p 0.0000 0.0000 223.3789 ++ 627.552326 m 0.0000 115 | 6/9
9 h-m-p 0.0001 0.0322 8.9041 ----------.. | 6/9
10 h-m-p 0.0000 0.0001 157.5432 ++ 624.451874 m 0.0001 147 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 624.451874 m 8.0000 159 | 7/9
12 h-m-p 0.0160 8.0000 0.0030 +++++ 624.451874 m 8.0000 176 | 7/9
13 h-m-p 0.0223 3.0971 1.0881 ---------C 624.451874 0 0.0000 199 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451874 m 8.0000 214 | 7/9
15 h-m-p 0.0160 8.0000 0.0029 +++++ 624.451874 m 8.0000 231 | 7/9
16 h-m-p 0.0194 3.0488 1.2088 -----------Y 624.451874 0 0.0000 256 | 7/9
17 h-m-p 0.0491 8.0000 0.0000 ++++ 624.451874 m 8.0000 270 | 7/9
18 h-m-p 0.0178 8.0000 0.0001 +++++ 624.451874 m 8.0000 287 | 7/9
19 h-m-p 0.0145 7.2564 2.0546 ------------Y 624.451874 0 0.0000 313 | 7/9
20 h-m-p 0.0160 8.0000 0.0000 ----N 624.451874 0 0.0000 329 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451874 m 8.0000 346 | 7/9
22 h-m-p 0.0160 8.0000 0.0435 --------N 624.451874 0 0.0000 368 | 7/9
23 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451874 m 8.0000 410 | 7/9
25 h-m-p 0.0044 2.2087 0.3256 ----------Y 624.451874 0 0.0000 434 | 7/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451874 m 8.0000 451 | 7/9
27 h-m-p 0.0048 2.3983 0.4016 ------------.. | 7/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451874 m 8.0000 492 | 7/9
29 h-m-p 0.0044 2.2060 0.3267 ------------.. | 7/9
30 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451874 m 8.0000 533 | 7/9
31 h-m-p 0.0045 2.2327 0.3231 ------------.. | 7/9
32 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451874 m 8.0000 574 | 7/9
33 h-m-p 0.0044 2.2120 0.3265 ----------N 624.451874 0 0.0000 598 | 7/9
34 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451873 m 8.0000 615 | 7/9
35 h-m-p 0.0047 2.3317 0.3495 --------C 624.451873 0 0.0000 637 | 7/9
36 h-m-p 0.0160 8.0000 0.0005 +++++ 624.451873 m 8.0000 654 | 7/9
37 h-m-p 0.0115 2.3113 0.3367 -------------.. | 7/9
38 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451873 m 8.0000 696 | 7/9
39 h-m-p 0.0045 2.2722 0.3201 ------------.. | 7/9
40 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451873 m 8.0000 737 | 7/9
41 h-m-p 0.0045 2.2467 0.3241 -----------Y 624.451873 0 0.0000 762 | 7/9
42 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451873 m 8.0000 779 | 7/9
43 h-m-p 0.0061 3.0537 0.6638 --------Y 624.451873 0 0.0000 801 | 7/9
44 h-m-p 0.0002 0.1036 7.5665 +++++ 624.451837 m 0.1036 818 | 8/9
45 h-m-p 0.1306 0.7007 5.6126 ++ 624.451549 m 0.7007 830 | 9/9
46 h-m-p 0.0160 8.0000 0.0000 Y 624.451549 0 0.0160 842
Out..
lnL = -624.451549
843 lfun, 2529 eigenQcodon, 10116 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048217 0.054279 0.087485 0.096231 0.013834 0.089589 0.000100 1.221158 0.582925 0.239640 2.578117
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.768225
np = 11
lnL0 = -677.682938
Iterating by ming2
Initial: fx= 677.682938
x= 0.04822 0.05428 0.08748 0.09623 0.01383 0.08959 0.00011 1.22116 0.58293 0.23964 2.57812
1 h-m-p 0.0000 0.0000 294.1764 ++ 677.547901 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 165.1215 +++ 665.382965 m 0.0006 31 | 2/11
3 h-m-p 0.0002 0.0008 101.0509 ++ 645.448326 m 0.0008 45 | 3/11
4 h-m-p 0.0004 0.0022 35.8879 ++ 641.320780 m 0.0022 59 | 4/11
5 h-m-p 0.0000 0.0000 16897.8536 ++ 636.102173 m 0.0000 73 | 5/11
6 h-m-p 0.0031 0.0156 15.6006 ++ 635.722919 m 0.0156 87 | 6/11
7 h-m-p 0.0003 0.0016 80.5845 ++ 634.497112 m 0.0016 101 | 7/11
8 h-m-p 0.0009 0.0210 135.4628 +++ 630.251228 m 0.0210 116 | 8/11
9 h-m-p 0.4004 8.0000 5.5664 ---------------.. | 8/11
10 h-m-p 0.0000 0.0002 156.5116 +++ 624.451823 m 0.0002 158 | 9/11
11 h-m-p 1.6000 8.0000 0.0000 +N 624.451823 0 6.4000 173 | 9/11
12 h-m-p 1.6000 8.0000 0.0000 N 624.451823 0 0.4000 189 | 9/11
13 h-m-p 0.0160 8.0000 0.0000 N 624.451823 0 0.0040 205 | 9/11
14 h-m-p 0.0160 8.0000 0.0000 N 624.451823 0 0.0160 221 | 9/11
15 h-m-p 0.0160 8.0000 0.0948 ++++Y 624.451823 0 3.1395 241 | 9/11
16 h-m-p 1.6000 8.0000 0.0016 Y 624.451823 0 3.9113 257 | 9/11
17 h-m-p 0.1859 8.0000 0.0345 -N 624.451823 0 0.0058 274 | 9/11
18 h-m-p 1.6000 8.0000 0.0001 ---N 624.451823 0 0.0063 293 | 9/11
19 h-m-p 0.9929 8.0000 0.0000 --------N 624.451823 0 0.0000 317
Out..
lnL = -624.451823
318 lfun, 1272 eigenQcodon, 5724 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -624.457564 S = -624.448851 -0.003333
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:05
did 20 / 46 patterns 0:05
did 30 / 46 patterns 0:05
did 40 / 46 patterns 0:05
did 46 / 46 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076172 0.027502 0.042128 0.044898 0.060031 0.087698 0.000100 0.711458 1.877433
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.201685
np = 9
lnL0 = -673.956401
Iterating by ming2
Initial: fx= 673.956401
x= 0.07617 0.02750 0.04213 0.04490 0.06003 0.08770 0.00011 0.71146 1.87743
1 h-m-p 0.0000 0.0000 338.7179 ++ 673.785720 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0159 44.5960 +++++ 649.730768 m 0.0159 29 | 2/9
3 h-m-p 0.0001 0.0005 157.1325 ++ 641.010988 m 0.0005 41 | 3/9
4 h-m-p 0.0002 0.0010 18.7117 ++ 635.249497 m 0.0010 53 | 4/9
5 h-m-p 0.0002 0.0011 11.7014 ----------.. | 4/9
6 h-m-p 0.0000 0.0001 288.3364 ++ 630.087555 m 0.0001 85 | 5/9
7 h-m-p 0.0160 8.0000 1.4617 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 251.3991 ++ 626.244297 m 0.0001 120 | 6/9
9 h-m-p 0.0160 8.0000 1.2013 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 206.9087 ++ 625.768372 m 0.0000 155 | 7/9
11 h-m-p 0.0160 8.0000 0.8464 -------------.. | 7/9
12 h-m-p 0.0000 0.0001 145.8106 ++ 624.451549 m 0.0001 192 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 624.451549 0 1.6000 204 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 C 624.451549 0 0.0160 217
Out..
lnL = -624.451549
218 lfun, 2398 eigenQcodon, 13080 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050575 0.088923 0.051976 0.020606 0.058640 0.056633 0.000100 0.900000 1.125540 1.140800 2.544041
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.095476
np = 11
lnL0 = -671.117307
Iterating by ming2
Initial: fx= 671.117307
x= 0.05058 0.08892 0.05198 0.02061 0.05864 0.05663 0.00011 0.90000 1.12554 1.14080 2.54404
1 h-m-p 0.0000 0.0000 320.0681 ++ 670.904945 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 260.0914 +++ 653.678981 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0003 357.7103 ++ 632.626061 m 0.0003 45 | 3/11
4 h-m-p 0.0039 0.0195 18.2216 ++ 629.640535 m 0.0195 59 | 4/11
5 h-m-p 0.0000 0.0002 90.7816 ++ 626.692119 m 0.0002 73 | 5/11
6 h-m-p 0.0001 0.0005 185.0451 ++ 626.276818 m 0.0005 87 | 6/11
7 h-m-p 0.0003 0.0056 371.2606 +++ 624.451836 m 0.0056 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 624.451836 m 8.0000 116 | 7/11
9 h-m-p 0.0101 5.0295 0.6665 --------Y 624.451836 0 0.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 0.0001 ---C 624.451836 0 0.0001 163 | 7/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451836 m 8.0000 184 | 7/11
12 h-m-p 0.0004 0.1761 2.2659 -------Y 624.451836 0 0.0000 209 | 7/11
13 h-m-p 0.0160 8.0000 0.0006 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451836 m 8.0000 255 | 7/11
15 h-m-p 0.0012 0.6167 1.2075 -----------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451836 m 8.0000 299 | 7/11
17 h-m-p 0.0160 8.0000 0.0359 -------C 624.451836 0 0.0000 324 | 7/11
18 h-m-p 0.0160 8.0000 0.0001 ----Y 624.451836 0 0.0000 346 | 7/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451836 m 8.0000 367 | 7/11
20 h-m-p 0.0022 1.1019 0.6442 ------------.. | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451836 m 8.0000 416 | 7/11
22 h-m-p 0.0011 0.5735 1.2999 --------Y 624.451836 0 0.0000 442 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451836 m 8.0000 459 | 7/11
24 h-m-p 0.0036 1.8225 0.2799 +++++ 624.451819 m 1.8225 480 | 8/11
25 h-m-p 0.7438 3.7191 0.2843 ------------C 624.451819 0 0.0000 510 | 8/11
26 h-m-p 0.0160 8.0000 0.0003 +++++ 624.451819 m 8.0000 530 | 8/11
27 h-m-p 0.0016 0.8124 1.6745 -----------.. | 8/11
28 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451819 m 8.0000 573 | 8/11
29 h-m-p 0.0160 8.0000 0.0388 ---------N 624.451819 0 0.0000 599 | 8/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451819 m 8.0000 619 | 8/11
31 h-m-p 0.0015 0.7475 2.7556 +++++ 624.451757 m 0.7475 639 | 8/11
32 h-m-p 0.1603 0.8014 3.2928 ---------------.. | 8/11
33 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451757 m 8.0000 683 | 9/11
34 h-m-p 0.0160 8.0000 0.3514 ----------N 624.451757 0 0.0000 710 | 9/11
35 h-m-p 0.0160 8.0000 0.0038 +++++ 624.451755 m 8.0000 729 | 9/11
36 h-m-p 0.0440 8.0000 0.7004 ------------Y 624.451755 0 0.0000 757 | 9/11
37 h-m-p 0.0160 8.0000 0.0000 -----Y 624.451755 0 0.0000 778 | 9/11
38 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451755 m 8.0000 797 | 9/11
39 h-m-p 0.0160 8.0000 0.4136 -----------N 624.451755 0 0.0000 824 | 9/11
40 h-m-p 0.0160 8.0000 0.0000 -------N 624.451755 0 0.0000 847 | 9/11
41 h-m-p 0.0160 8.0000 0.0000 +++++ 624.451755 m 8.0000 866 | 9/11
42 h-m-p 0.0160 8.0000 2.3822 ------------C 624.451755 0 0.0000 894 | 9/11
43 h-m-p 0.0160 8.0000 0.0000 -----------N 624.451755 0 0.0000 919 | 9/11
44 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451755 m 8.0000 938 | 9/11
45 h-m-p 0.0131 6.5311 0.6824 -------------.. | 9/11
46 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451755 m 8.0000 984 | 9/11
47 h-m-p 0.0123 6.1277 0.7279 ----------Y 624.451755 0 0.0000 1010 | 9/11
48 h-m-p 0.0160 8.0000 0.0001 -------N 624.451755 0 0.0000 1033 | 9/11
49 h-m-p 0.0160 8.0000 0.0001 +++++ 624.451755 m 8.0000 1052 | 9/11
50 h-m-p 0.0160 8.0000 3.3671 +++++ 624.451692 m 8.0000 1071 | 9/11
51 h-m-p 1.6000 8.0000 0.4189 ++ 624.451691 m 8.0000 1085 | 9/11
52 h-m-p 0.3073 6.2334 10.9036 +++ 624.451686 m 6.2334 1102 | 10/11
53 h-m-p 1.6000 8.0000 5.5419 --------------C 624.451686 0 0.0000 1130 | 10/11
54 h-m-p 0.0160 8.0000 0.0000 N 624.451686 0 0.0040 1144
Out..
lnL = -624.451686
1145 lfun, 13740 eigenQcodon, 75570 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -624.486659 S = -624.450681 -0.015889
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:28
did 20 / 46 patterns 0:28
did 30 / 46 patterns 0:28
did 40 / 46 patterns 0:29
did 46 / 46 patterns 0:29
Time used: 0:29
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=162
NC_011896_1_WP_010907600_1_214_MLBR_RS01060 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
NC_002677_1_NP_301276_1_148_ppa VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG
**************************************************
NC_011896_1_WP_010907600_1_214_MLBR_RS01060 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
NC_002677_1_NP_301276_1_148_ppa EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH
**************************************************
NC_011896_1_WP_010907600_1_214_MLBR_RS01060 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
NC_002677_1_NP_301276_1_148_ppa RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV
**************************************************
NC_011896_1_WP_010907600_1_214_MLBR_RS01060 QRSVERFKAGGH
NC_002677_1_NP_301276_1_148_ppa QRSVERFKAGGH
NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 QRSVERFKAGGH
NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 QRSVERFKAGGH
NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 QRSVERFKAGGH
NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 QRSVERFKAGGH
************
>NC_011896_1_WP_010907600_1_214_MLBR_RS01060 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC >NC_002677_1_NP_301276_1_148_ppa GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC >NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC >NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC >NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC >NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 GTGCAATTCGACGTGACCATCGAAATTCCGAAAGGCCAGCGGAACAAGTA CGAGGTCGACCACAAAACGGGGCGGGTGCGTCTAGACCGCTACCTTTACA CCCCGATGGCCTATCCGACAGACTACGGCTTCATTGAAGACACCCTCGGC GAAGACGGCGACCCGCTGGATGCACTGGTGCTGCTACCGGAGCCGCTGTT CCCTGGCGTACTAGTGGAGGCACGTCCAGTAGGTATGTTCCGGATGGTCG ACGAGCACGGCGGCGACGACAAGGTGTTGTGCGTTCCAGTCAACGACCAC CGATGGGATCACATCCACGGCATCATCGATGTTCCGACCTTCGAGCTGGA CGCGATCAAGCATTTCTTCGTACACTACAAGGATCTAGAGCCAGGCAAGT TCGTGAAAGCCGCAGACTGGGTAGGCCGAGACGAAGCTGAAGCAGAAGTG CAGCGTTCAGTGGAACGGTTCAAGGCTGGCGGGCAC
>NC_011896_1_WP_010907600_1_214_MLBR_RS01060 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH >NC_002677_1_NP_301276_1_148_ppa VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH >NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH >NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH >NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH >NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155 VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLG EDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDH RWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEV QRSVERFKAGGH
#NEXUS
[ID: 9810399245]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907600_1_214_MLBR_RS01060
NC_002677_1_NP_301276_1_148_ppa
NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870
NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775
NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115
NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907600_1_214_MLBR_RS01060,
2 NC_002677_1_NP_301276_1_148_ppa,
3 NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870,
4 NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775,
5 NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115,
6 NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07109773,2:0.07054881,3:0.06782347,4:0.06769459,5:0.06765037,6:0.07030333);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07109773,2:0.07054881,3:0.06782347,4:0.06769459,5:0.06765037,6:0.07030333);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -666.48 -670.78
2 -666.48 -669.43
--------------------------------------
TOTAL -666.48 -670.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppa/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893076 0.090201 0.360688 1.484300 0.857595 1390.00 1445.50 1.000
r(A<->C){all} 0.172310 0.021252 0.000030 0.450354 0.133667 178.07 192.72 1.000
r(A<->G){all} 0.164851 0.020004 0.000001 0.446193 0.128212 222.25 245.99 1.002
r(A<->T){all} 0.164458 0.019678 0.000025 0.454331 0.128378 164.13 229.63 1.002
r(C<->G){all} 0.153685 0.018378 0.000039 0.426975 0.112998 175.14 206.47 1.001
r(C<->T){all} 0.180581 0.022216 0.000277 0.477929 0.142316 148.39 184.00 1.000
r(G<->T){all} 0.164115 0.019287 0.000087 0.447880 0.130005 246.55 275.17 1.001
pi(A){all} 0.237863 0.000375 0.203084 0.277861 0.237006 1127.71 1202.95 1.000
pi(C){all} 0.277893 0.000410 0.239660 0.318723 0.277397 1307.72 1345.15 1.000
pi(G){all} 0.304589 0.000417 0.263593 0.343243 0.304098 1135.53 1204.52 1.000
pi(T){all} 0.179655 0.000290 0.147103 0.213032 0.179272 1290.70 1291.50 1.002
alpha{1,2} 0.421126 0.232270 0.000225 1.365362 0.245181 1002.15 1130.45 1.001
alpha{3} 0.460984 0.252527 0.000136 1.474337 0.291706 990.37 1166.63 1.004
pinvar{all} 0.996763 0.000016 0.989143 0.999998 0.998057 1220.56 1360.78 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ppa/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 162
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 9 9 9 9 9 9 | TCC 0 0 0 0 0 0 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 7 7 7 7 7 7 | CGC 1 1 1 1 1 1
CTA 4 4 4 4 4 4 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 7 7 7 7 7 7 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 4 4 4 4 4 4 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 6 6 6 6 6 6 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 14 14 14 14 14 14 | GGC 11 11 11 11 11 11
GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 7 7 7 7 7 7 | GGA 0 0 0 0 0 0
GTG 9 9 9 9 9 9 | GCG 1 1 1 1 1 1 | GAG 6 6 6 6 6 6 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907600_1_214_MLBR_RS01060
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
#2: NC_002677_1_NP_301276_1_148_ppa
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
#3: NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
#4: NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
#5: NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
#6: NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 54 | TCC 0 | TAC 30 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 0 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 18
CTC 6 | CCC 0 | CAC 42 | CGC 6
CTA 24 | CCA 18 | Gln Q CAA 6 | CGA 12
CTG 30 | CCG 42 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 30 | ACC 24 | AAC 12 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 36 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 6
GTC 18 | GCC 12 | GAC 84 | GGC 66
GTA 24 | GCA 24 | Glu E GAA 42 | GGA 0
GTG 54 | GCG 6 | GAG 36 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12346 C:0.26543 A:0.16667 G:0.44444
position 2: T:0.30247 C:0.16667 A:0.36420 G:0.16667
position 3: T:0.11111 C:0.40123 A:0.18519 G:0.30247
Average T:0.17901 C:0.27778 A:0.23868 G:0.30453
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -624.451924 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.248947 2.544041
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907600_1_214_MLBR_RS01060: 0.000004, NC_002677_1_NP_301276_1_148_ppa: 0.000004, NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870: 0.000004, NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775: 0.000004, NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115: 0.000004, NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.24895
omega (dN/dS) = 2.54404
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
7..2 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
7..3 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
7..4 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
7..5 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
7..6 0.000 359.5 126.5 2.5440 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -624.451549 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907600_1_214_MLBR_RS01060: 0.000004, NC_002677_1_NP_301276_1_148_ppa: 0.000004, NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870: 0.000004, NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775: 0.000004, NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115: 0.000004, NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -624.451823 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.116111 0.789945 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907600_1_214_MLBR_RS01060: 0.000004, NC_002677_1_NP_301276_1_148_ppa: 0.000004, NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870: 0.000004, NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775: 0.000004, NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115: 0.000004, NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.11611 0.78994 0.09394
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
7..2 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
7..3 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
7..4 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
7..5 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
7..6 0.000 404.1 81.9 0.8839 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907600_1_214_MLBR_RS01060)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -624.451549 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.876263
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907600_1_214_MLBR_RS01060: 0.000004, NC_002677_1_NP_301276_1_148_ppa: 0.000004, NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870: 0.000004, NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775: 0.000004, NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115: 0.000004, NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.87626
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 404.1 81.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -624.451686 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 15.952564 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907600_1_214_MLBR_RS01060: 0.000004, NC_002677_1_NP_301276_1_148_ppa: 0.000004, NZ_LVXE01000009_1_WP_010907600_1_2891_A3216_RS04870: 0.000004, NZ_LYPH01000016_1_WP_010907600_1_590_A8144_RS02775: 0.000004, NZ_CP029543_1_WP_010907600_1_215_DIJ64_RS01115: 0.000004, NZ_AP014567_1_WP_010907600_1_223_JK2ML_RS01155: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 15.95256 q = 99.00000
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.08976 0.10574 0.11602 0.12464 0.13268 0.14074 0.14935 0.15926 0.17215 0.19496 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
7..2 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
7..3 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
7..4 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
7..5 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
7..6 0.000 404.1 81.9 0.1385 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907600_1_214_MLBR_RS01060)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Time used: 0:29
Model 1: NearlyNeutral -624.451549 Model 2: PositiveSelection -624.451823 Model 0: one-ratio -624.451924 Model 7: beta -624.451549 Model 8: beta&w>1 -624.451686 Model 0 vs 1 7.499999999254214E-4 Model 2 vs 1 5.479999999806751E-4 Model 8 vs 7 2.7399999999033753E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
