--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:31:46 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ppiA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -765.70          -769.99
2       -765.74          -769.30
--------------------------------------
TOTAL     -765.72          -769.70
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.883036    0.090199    0.368067    1.486511    0.845293   1501.00   1501.00    1.000
r(A<->C){all}   0.150130    0.017608    0.000006    0.423978    0.112863    173.96    242.20    1.000
r(A<->G){all}   0.180099    0.023202    0.000088    0.481754    0.138199    130.82    200.50    1.012
r(A<->T){all}   0.150158    0.016189    0.000069    0.402082    0.117084    249.00    274.13    1.002
r(C<->G){all}   0.150459    0.017880    0.000016    0.417932    0.113251    224.49    235.60    1.000
r(C<->T){all}   0.207208    0.024505    0.000606    0.517668    0.173692    218.12    249.15    1.002
r(G<->T){all}   0.161946    0.019084    0.000214    0.450698    0.124604    270.70    301.15    1.000
pi(A){all}      0.224166    0.000315    0.192079    0.260853    0.223866   1355.70   1379.46    1.000
pi(C){all}      0.298174    0.000374    0.258319    0.334109    0.298114   1036.86   1066.35    1.000
pi(G){all}      0.264194    0.000336    0.227610    0.299611    0.263546   1184.50   1258.32    1.000
pi(T){all}      0.213467    0.000293    0.181259    0.247553    0.213126   1401.42   1438.21    1.000
alpha{1,2}      0.331018    0.160755    0.000219    1.094400    0.200225    680.09    997.18    1.000
alpha{3}        0.415117    0.238101    0.000130    1.361331    0.242220   1098.05   1227.22    1.000
pinvar{all}     0.993718    0.000026    0.983385    0.999838    0.995067   1192.02   1337.82    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-733.341772
Model 2: PositiveSelection	-732.967827
Model 0: one-ratio	-732.967682
Model 7: beta	-733.341773
Model 8: beta&w>1	-732.967818


Model 0 vs 1	0.7481800000000476

Model 2 vs 1	0.7478899999998703

Model 8 vs 7	0.7479100000000471
>C1
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C2
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C3
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C4
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C5
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C6
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182 

C1              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C2              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C3              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C4              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C5              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C6              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
                **************************************************

C1              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C2              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C3              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C4              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C5              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C6              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
                **************************************************

C1              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C2              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C3              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C4              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C5              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C6              FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
                *********.****************************************

C1              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C2              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C3              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C4              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C5              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C6              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
                ********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5460]--->[5460]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.722 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C2              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C3              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C4              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C5              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C6              MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
                **************************************************

C1              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C2              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C3              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C4              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C5              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C6              EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
                **************************************************

C1              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C2              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C3              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C4              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C5              FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C6              FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
                *********.****************************************

C1              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C2              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C3              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C4              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C5              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C6              DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
                ********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.45 C1	 C6	 99.45
TOP	    5    0	 99.45 C6	 C1	 99.45
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.45 C2	 C6	 99.45
TOP	    5    1	 99.45 C6	 C2	 99.45
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.45 C3	 C6	 99.45
TOP	    5    2	 99.45 C6	 C3	 99.45
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.45 C4	 C6	 99.45
TOP	    5    3	 99.45 C6	 C4	 99.45
BOT	    4    5	 99.45 C5	 C6	 99.45
TOP	    5    4	 99.45 C6	 C5	 99.45
AVG	 0	 C1	  *	 99.89
AVG	 1	 C2	  *	 99.89
AVG	 2	 C3	  *	 99.89
AVG	 3	 C4	  *	 99.89
AVG	 4	 C5	  *	 99.89
AVG	 5	 C6	  *	 99.45
TOT	 TOT	  *	 99.82
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C2              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C3              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C4              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C5              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C6              ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
                **************************************************

C1              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C2              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C3              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C4              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C5              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C6              CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
                **************************************************

C1              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C2              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C3              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C4              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C5              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C6              ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
                **************************************************

C1              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C2              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C3              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C4              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C5              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C6              GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
                **************************************************

C1              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C2              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C3              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C4              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C5              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C6              TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
                **************************************************

C1              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C2              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C3              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C4              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C5              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C6              ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
                **************************************************

C1              TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C2              TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C3              TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C4              TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C5              TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C6              TTCCACCCTGAGCTTCAGTTCGACAAATCCTACCTGCTAGCGATGGCCAA
                *************************** **********************

C1              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C2              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C3              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C4              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C5              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C6              TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
                **************************************************

C1              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C2              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C3              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C4              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C5              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C6              CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
                **************************************************

C1              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C2              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C3              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C4              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C5              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C6              GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
                **************************************************

C1              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C2              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C3              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C4              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C5              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C6              CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
                **********************************************



>C1
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C2
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C3
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C4
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C5
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C6
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAATCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C1
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C2
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C3
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C4
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C5
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C6
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 546 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579786221
      Setting output file names to "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1903857506
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9256654698
      Seed = 1894141969
      Swapseed = 1579786221
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1225.376970 -- -24.965149
         Chain 2 -- -1225.376788 -- -24.965149
         Chain 3 -- -1225.377040 -- -24.965149
         Chain 4 -- -1225.375491 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1225.376970 -- -24.965149
         Chain 2 -- -1225.376788 -- -24.965149
         Chain 3 -- -1225.377040 -- -24.965149
         Chain 4 -- -1225.377040 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1225.377] (-1225.377) (-1225.377) (-1225.375) * [-1225.377] (-1225.377) (-1225.377) (-1225.377) 
        500 -- (-771.474) (-773.997) (-780.622) [-769.150] * (-772.557) (-767.822) [-772.100] (-777.611) -- 0:00:00
       1000 -- [-767.604] (-772.355) (-778.772) (-770.808) * (-770.449) (-778.777) [-769.361] (-769.469) -- 0:00:00
       1500 -- [-770.819] (-774.499) (-777.607) (-774.887) * [-769.312] (-769.724) (-771.443) (-778.121) -- 0:00:00
       2000 -- (-773.847) (-773.492) [-769.975] (-777.380) * (-767.126) [-769.619] (-767.719) (-771.420) -- 0:00:00
       2500 -- (-775.603) (-776.047) [-768.749] (-778.079) * [-770.366] (-771.293) (-771.897) (-773.260) -- 0:00:00
       3000 -- (-774.341) (-771.591) (-772.255) [-774.239] * (-773.083) [-767.358] (-776.411) (-779.214) -- 0:00:00
       3500 -- (-773.499) (-769.226) [-764.066] (-773.281) * [-773.161] (-780.346) (-769.064) (-775.179) -- 0:00:00
       4000 -- (-772.817) (-774.609) [-766.357] (-769.392) * (-767.603) (-773.243) [-766.742] (-774.222) -- 0:00:00
       4500 -- (-769.146) (-777.829) [-769.808] (-768.430) * (-762.702) (-770.817) [-770.844] (-772.043) -- 0:03:41
       5000 -- [-769.257] (-771.456) (-780.690) (-771.371) * [-768.454] (-780.038) (-771.838) (-772.962) -- 0:03:19

      Average standard deviation of split frequencies: 0.099995

       5500 -- (-769.566) (-772.105) (-777.988) [-770.545] * (-768.048) (-772.143) [-769.957] (-777.434) -- 0:03:00
       6000 -- (-779.314) (-773.916) [-771.654] (-776.108) * (-782.150) (-768.530) [-776.687] (-775.124) -- 0:02:45
       6500 -- [-779.958] (-766.372) (-779.036) (-772.678) * (-775.641) [-770.133] (-780.338) (-770.487) -- 0:02:32
       7000 -- (-770.788) [-774.145] (-781.726) (-775.586) * [-766.470] (-766.709) (-770.764) (-766.499) -- 0:02:21
       7500 -- (-771.333) (-772.918) (-770.620) [-770.158] * (-777.292) [-771.331] (-769.715) (-776.209) -- 0:02:12
       8000 -- (-778.046) (-776.240) (-774.548) [-769.664] * (-767.522) (-774.447) [-768.454] (-769.120) -- 0:02:04
       8500 -- (-773.912) (-769.654) (-768.196) [-769.823] * [-770.073] (-780.363) (-766.885) (-776.781) -- 0:01:56
       9000 -- (-766.169) (-766.795) (-768.511) [-766.610] * (-771.347) (-773.314) (-769.491) [-773.466] -- 0:01:50
       9500 -- (-771.853) [-766.455] (-765.632) (-773.791) * (-771.767) (-770.658) (-777.743) [-770.927] -- 0:01:44
      10000 -- (-771.238) (-773.154) (-765.803) [-768.502] * (-768.756) (-772.015) [-767.850] (-766.945) -- 0:01:39

      Average standard deviation of split frequencies: 0.055243

      10500 -- (-775.454) (-771.892) (-768.456) [-769.652] * (-767.708) (-770.331) [-770.935] (-770.732) -- 0:01:34
      11000 -- [-774.771] (-774.555) (-768.319) (-770.536) * (-771.820) [-766.666] (-767.820) (-769.383) -- 0:01:29
      11500 -- [-776.738] (-774.436) (-766.295) (-771.540) * (-776.047) (-764.867) (-772.764) [-773.240] -- 0:01:25
      12000 -- [-769.056] (-777.979) (-766.327) (-771.719) * (-777.571) (-770.136) (-771.480) [-775.129] -- 0:01:22
      12500 -- (-779.284) (-770.769) [-766.883] (-766.860) * (-767.516) (-771.999) (-773.736) [-769.345] -- 0:01:19
      13000 -- [-769.631] (-772.485) (-768.132) (-782.652) * (-778.331) (-768.195) [-771.985] (-767.869) -- 0:01:15
      13500 -- (-770.011) (-765.453) (-767.513) [-774.026] * (-770.723) (-776.011) [-770.391] (-771.251) -- 0:01:13
      14000 -- [-769.929] (-771.894) (-768.721) (-769.210) * (-770.364) [-774.104] (-770.875) (-772.577) -- 0:01:10
      14500 -- (-771.254) (-764.631) [-767.113] (-773.941) * (-770.936) (-768.595) (-773.309) [-766.337] -- 0:01:07
      15000 -- [-774.402] (-774.006) (-765.695) (-779.908) * (-771.460) [-767.637] (-775.638) (-780.605) -- 0:01:05

      Average standard deviation of split frequencies: 0.051172

      15500 -- [-771.127] (-772.277) (-766.368) (-771.189) * [-765.939] (-772.924) (-775.834) (-774.075) -- 0:01:03
      16000 -- [-773.839] (-772.450) (-766.592) (-766.949) * (-776.417) (-769.690) [-768.706] (-778.183) -- 0:01:01
      16500 -- [-772.639] (-766.946) (-764.370) (-769.036) * (-777.281) (-774.434) [-769.638] (-775.625) -- 0:00:59
      17000 -- (-772.308) [-764.350] (-765.197) (-768.699) * (-776.931) (-776.112) [-772.369] (-772.753) -- 0:00:57
      17500 -- (-765.454) (-767.232) [-767.818] (-774.265) * [-771.096] (-768.761) (-776.678) (-773.879) -- 0:00:56
      18000 -- (-767.067) [-767.234] (-767.145) (-770.907) * [-765.408] (-773.268) (-775.453) (-774.201) -- 0:00:54
      18500 -- [-764.866] (-772.269) (-769.043) (-772.301) * [-766.871] (-781.935) (-779.253) (-768.237) -- 0:00:53
      19000 -- [-772.226] (-765.520) (-769.537) (-767.187) * (-772.027) (-771.822) (-780.712) [-774.293] -- 0:00:51
      19500 -- [-773.723] (-765.209) (-766.772) (-767.899) * (-780.248) [-767.259] (-768.989) (-767.754) -- 0:01:40
      20000 -- (-768.271) (-764.775) (-770.691) [-772.827] * [-768.247] (-774.503) (-766.875) (-765.531) -- 0:01:38

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-764.636] (-766.188) (-768.169) (-775.687) * (-771.729) [-770.960] (-764.083) (-766.846) -- 0:01:35
      21000 -- (-774.609) [-765.399] (-765.794) (-776.206) * (-773.191) [-764.570] (-764.978) (-765.582) -- 0:01:33
      21500 -- [-776.343] (-766.842) (-767.025) (-773.159) * (-768.814) (-779.581) [-765.953] (-765.074) -- 0:01:31
      22000 -- (-777.232) (-765.766) [-768.747] (-777.868) * (-767.595) (-774.275) (-767.646) [-766.676] -- 0:01:28
      22500 -- (-770.388) [-767.872] (-771.610) (-773.535) * (-770.767) (-771.555) (-766.742) [-765.481] -- 0:01:26
      23000 -- (-778.434) (-768.409) (-769.470) [-775.936] * [-773.934] (-768.058) (-768.132) (-763.623) -- 0:01:24
      23500 -- [-773.148] (-767.807) (-768.331) (-765.537) * (-771.330) [-772.026] (-771.793) (-767.008) -- 0:01:23
      24000 -- (-772.063) (-764.522) (-768.952) [-768.448] * (-768.608) (-770.210) (-767.308) [-765.353] -- 0:01:21
      24500 -- (-769.939) (-765.831) (-768.835) [-766.466] * (-766.229) [-773.486] (-767.182) (-764.823) -- 0:01:19
      25000 -- (-769.765) (-763.938) (-768.191) [-768.703] * (-767.339) [-770.491] (-774.548) (-765.593) -- 0:01:18

      Average standard deviation of split frequencies: 0.041207

      25500 -- (-774.702) [-768.225] (-767.700) (-769.338) * (-765.537) (-774.535) (-771.914) [-770.808] -- 0:01:16
      26000 -- (-777.635) (-766.226) (-766.828) [-763.909] * (-766.233) [-771.895] (-765.455) (-767.947) -- 0:01:14
      26500 -- [-770.767] (-765.573) (-765.878) (-772.819) * (-766.838) [-770.852] (-766.939) (-766.645) -- 0:01:13
      27000 -- [-768.275] (-767.073) (-767.728) (-778.434) * (-767.340) [-775.233] (-767.778) (-766.685) -- 0:01:12
      27500 -- (-771.680) [-768.632] (-766.070) (-770.463) * (-768.745) (-772.330) [-767.337] (-765.726) -- 0:01:10
      28000 -- (-772.043) (-767.965) (-765.300) [-769.338] * (-765.469) [-769.622] (-767.178) (-769.168) -- 0:01:09
      28500 -- (-769.875) (-766.012) [-766.476] (-780.836) * [-766.766] (-767.503) (-766.654) (-768.568) -- 0:01:08
      29000 -- (-769.193) [-767.521] (-769.007) (-778.246) * (-764.790) [-767.252] (-766.998) (-768.202) -- 0:01:06
      29500 -- (-769.127) (-764.484) [-765.681] (-770.391) * [-767.648] (-773.288) (-767.421) (-767.724) -- 0:01:05
      30000 -- (-779.767) (-768.389) [-768.198] (-770.902) * [-766.864] (-765.011) (-771.202) (-766.574) -- 0:01:04

      Average standard deviation of split frequencies: 0.040452

      30500 -- (-769.813) (-767.141) (-767.516) [-766.648] * (-770.011) [-770.316] (-767.904) (-766.999) -- 0:01:03
      31000 -- (-772.462) [-767.474] (-780.747) (-769.281) * (-767.804) [-764.032] (-767.243) (-771.247) -- 0:01:02
      31500 -- (-772.295) (-766.930) (-765.032) [-766.869] * (-765.999) [-765.588] (-765.483) (-769.928) -- 0:01:01
      32000 -- (-772.825) (-764.338) (-765.013) [-766.075] * (-767.462) [-767.645] (-763.585) (-765.911) -- 0:01:00
      32500 -- (-778.488) [-764.487] (-767.812) (-768.431) * (-769.805) [-770.366] (-767.837) (-766.042) -- 0:00:59
      33000 -- [-770.200] (-772.501) (-763.585) (-766.570) * (-766.252) (-774.677) [-766.708] (-766.757) -- 0:00:58
      33500 -- (-771.615) [-770.830] (-773.499) (-769.760) * [-767.044] (-775.065) (-765.913) (-765.352) -- 0:00:57
      34000 -- (-766.213) [-765.127] (-767.069) (-765.845) * (-764.989) [-766.101] (-769.805) (-767.379) -- 0:01:25
      34500 -- (-768.187) (-766.430) (-766.318) [-763.704] * (-766.428) [-770.929] (-767.761) (-768.275) -- 0:01:23
      35000 -- [-771.744] (-767.820) (-769.540) (-765.034) * (-766.302) (-772.516) (-768.841) [-765.954] -- 0:01:22

      Average standard deviation of split frequencies: 0.047795

      35500 -- (-771.746) (-769.456) [-764.396] (-768.020) * (-767.544) (-773.691) [-764.459] (-770.707) -- 0:01:21
      36000 -- (-773.113) (-767.386) (-765.205) [-765.604] * (-769.785) [-771.259] (-767.368) (-771.733) -- 0:01:20
      36500 -- (-774.609) [-766.237] (-766.568) (-770.156) * (-765.603) (-781.838) [-763.949] (-768.112) -- 0:01:19
      37000 -- [-770.733] (-767.112) (-771.806) (-767.971) * [-765.694] (-772.820) (-766.822) (-766.711) -- 0:01:18
      37500 -- (-779.730) (-771.055) (-770.617) [-765.591] * (-770.866) (-767.344) (-764.916) [-765.101] -- 0:01:17
      38000 -- [-775.616] (-766.128) (-769.701) (-771.233) * [-767.667] (-769.738) (-764.311) (-767.527) -- 0:01:15
      38500 -- [-769.153] (-765.858) (-767.112) (-767.027) * (-771.398) (-767.961) [-766.755] (-768.256) -- 0:01:14
      39000 -- [-768.023] (-766.178) (-768.157) (-764.361) * (-769.952) (-771.012) [-766.644] (-767.784) -- 0:01:13
      39500 -- (-768.819) [-767.599] (-773.666) (-769.127) * (-768.831) [-764.951] (-766.610) (-772.948) -- 0:01:12
      40000 -- [-766.627] (-764.365) (-764.695) (-766.262) * (-769.685) [-764.178] (-768.244) (-773.666) -- 0:01:12

      Average standard deviation of split frequencies: 0.046947

      40500 -- [-786.338] (-765.760) (-764.619) (-771.380) * (-771.851) [-765.821] (-764.863) (-767.711) -- 0:01:11
      41000 -- [-772.693] (-766.488) (-765.898) (-766.930) * (-767.894) [-764.562] (-772.235) (-772.207) -- 0:01:10
      41500 -- [-775.146] (-768.843) (-764.872) (-765.992) * (-767.098) (-768.223) [-767.011] (-767.016) -- 0:01:09
      42000 -- [-767.518] (-773.520) (-765.390) (-763.510) * (-768.079) (-767.237) (-766.442) [-765.114] -- 0:01:08
      42500 -- (-769.696) (-773.915) [-767.221] (-768.675) * (-768.243) (-772.401) (-766.970) [-765.868] -- 0:01:07
      43000 -- (-767.850) (-767.425) [-767.880] (-766.130) * (-769.912) [-768.390] (-769.070) (-767.694) -- 0:01:06
      43500 -- (-767.464) (-765.881) (-765.450) [-763.922] * (-764.662) [-766.896] (-771.565) (-768.012) -- 0:01:05
      44000 -- (-768.877) (-769.348) (-766.730) [-767.023] * (-771.123) [-769.109] (-769.548) (-768.382) -- 0:01:05
      44500 -- (-769.285) (-769.996) [-767.375] (-768.122) * (-769.933) [-766.314] (-767.279) (-767.206) -- 0:01:04
      45000 -- (-768.786) (-766.167) (-768.257) [-767.025] * (-765.936) (-766.405) (-766.100) [-764.884] -- 0:01:03

      Average standard deviation of split frequencies: 0.040526

      45500 -- (-766.634) [-766.093] (-767.771) (-772.279) * (-766.388) (-767.724) [-766.667] (-765.172) -- 0:01:02
      46000 -- (-766.391) [-764.618] (-766.455) (-771.303) * (-766.740) [-769.628] (-768.031) (-765.041) -- 0:01:02
      46500 -- (-768.277) (-765.912) [-766.109] (-768.396) * [-766.591] (-765.735) (-770.875) (-768.026) -- 0:01:01
      47000 -- (-767.479) [-766.547] (-768.738) (-766.786) * (-764.254) (-767.149) (-767.786) [-765.333] -- 0:01:00
      47500 -- (-766.935) [-765.641] (-769.257) (-768.568) * (-767.149) (-768.335) [-767.230] (-765.530) -- 0:01:00
      48000 -- (-768.412) [-767.760] (-765.764) (-766.927) * (-770.390) (-768.817) [-767.181] (-768.917) -- 0:00:59
      48500 -- (-766.466) [-771.206] (-766.518) (-766.812) * (-766.674) (-766.502) (-767.203) [-769.179] -- 0:00:58
      49000 -- [-767.445] (-772.745) (-765.686) (-767.703) * [-766.561] (-766.548) (-766.043) (-768.871) -- 0:00:58
      49500 -- (-768.054) [-766.481] (-771.242) (-766.352) * (-766.434) (-767.924) (-766.441) [-766.671] -- 0:01:16
      50000 -- [-766.009] (-768.398) (-766.027) (-766.695) * (-767.001) (-766.148) (-767.667) [-769.717] -- 0:01:16

      Average standard deviation of split frequencies: 0.038908

      50500 -- [-765.647] (-767.403) (-767.056) (-766.441) * (-767.909) [-767.887] (-767.499) (-765.155) -- 0:01:15
      51000 -- (-766.134) (-766.453) [-767.410] (-763.642) * [-767.780] (-767.782) (-768.299) (-766.304) -- 0:01:14
      51500 -- (-766.403) (-765.933) (-770.625) [-765.104] * [-766.335] (-770.774) (-765.832) (-766.673) -- 0:01:13
      52000 -- (-768.916) [-766.583] (-766.938) (-765.740) * [-768.611] (-772.524) (-763.840) (-768.657) -- 0:01:12
      52500 -- [-765.327] (-766.948) (-766.477) (-768.022) * [-765.407] (-768.748) (-764.684) (-768.325) -- 0:01:12
      53000 -- [-765.744] (-766.912) (-767.618) (-766.445) * [-764.629] (-768.612) (-768.287) (-766.332) -- 0:01:11
      53500 -- [-770.163] (-766.184) (-768.324) (-766.860) * (-765.908) (-767.961) (-769.283) [-767.430] -- 0:01:10
      54000 -- [-772.944] (-766.608) (-771.897) (-765.483) * (-769.669) (-768.248) [-769.625] (-767.457) -- 0:01:10
      54500 -- (-769.999) [-766.937] (-766.760) (-765.299) * (-768.564) (-767.123) (-770.659) [-766.080] -- 0:01:09
      55000 -- (-771.154) (-767.285) [-765.024] (-769.215) * (-764.757) (-766.243) [-766.787] (-768.503) -- 0:01:08

      Average standard deviation of split frequencies: 0.037498

      55500 -- [-765.954] (-767.190) (-764.685) (-767.100) * [-766.329] (-768.028) (-772.455) (-768.659) -- 0:01:08
      56000 -- (-766.008) (-766.765) [-766.170] (-775.156) * [-769.234] (-767.210) (-770.927) (-765.543) -- 0:01:07
      56500 -- (-765.610) (-773.128) [-766.249] (-765.763) * (-768.462) [-767.608] (-766.694) (-765.395) -- 0:01:06
      57000 -- (-766.677) (-767.938) (-765.876) [-765.868] * [-767.296] (-767.934) (-767.323) (-764.073) -- 0:01:06
      57500 -- (-767.543) (-765.857) [-766.069] (-767.554) * (-770.860) (-767.918) (-765.396) [-763.015] -- 0:01:05
      58000 -- (-768.469) (-766.706) (-769.749) [-766.687] * (-765.063) (-767.965) (-766.774) [-766.197] -- 0:01:04
      58500 -- (-766.602) [-768.926] (-766.197) (-764.271) * [-767.752] (-768.617) (-767.348) (-766.690) -- 0:01:04
      59000 -- (-766.162) (-764.835) (-764.227) [-765.548] * (-772.299) (-768.544) (-767.884) [-768.941] -- 0:01:03
      59500 -- [-768.706] (-767.830) (-764.229) (-764.334) * (-768.145) [-766.218] (-769.918) (-768.943) -- 0:01:03
      60000 -- (-768.150) [-765.494] (-765.064) (-769.631) * [-765.775] (-766.416) (-768.411) (-768.673) -- 0:01:02

      Average standard deviation of split frequencies: 0.036909

      60500 -- (-765.307) (-766.141) (-768.176) [-767.981] * (-764.992) (-766.763) (-766.816) [-770.657] -- 0:01:02
      61000 -- [-766.655] (-765.550) (-764.771) (-765.162) * (-767.469) (-767.663) (-767.316) [-768.444] -- 0:01:01
      61500 -- [-766.144] (-766.704) (-766.518) (-768.333) * (-764.219) (-766.284) (-770.872) [-763.540] -- 0:01:01
      62000 -- (-766.313) [-768.283] (-767.096) (-764.987) * (-766.003) (-767.711) (-766.540) [-765.815] -- 0:01:00
      62500 -- (-766.505) (-769.004) (-769.668) [-765.251] * (-766.170) (-769.138) [-765.563] (-765.215) -- 0:01:00
      63000 -- (-773.389) [-768.886] (-767.752) (-767.619) * (-766.683) (-769.062) (-767.945) [-766.542] -- 0:00:59
      63500 -- (-767.890) (-765.803) [-766.878] (-771.225) * (-766.158) [-768.421] (-766.919) (-764.846) -- 0:00:58
      64000 -- [-768.086] (-767.021) (-765.698) (-768.103) * (-767.080) (-768.153) (-765.505) [-768.502] -- 0:00:58
      64500 -- (-766.570) (-765.890) [-766.442] (-768.021) * (-766.264) [-765.395] (-767.347) (-765.867) -- 0:01:12
      65000 -- (-765.966) [-766.864] (-768.317) (-770.883) * (-767.216) (-768.750) [-765.371] (-771.190) -- 0:01:11

      Average standard deviation of split frequencies: 0.034738

      65500 -- (-765.754) [-765.787] (-766.084) (-766.617) * (-768.014) [-765.935] (-764.147) (-769.306) -- 0:01:11
      66000 -- (-768.934) [-765.093] (-767.320) (-766.728) * [-765.926] (-765.833) (-766.866) (-766.239) -- 0:01:10
      66500 -- (-768.073) [-767.817] (-769.900) (-768.259) * (-765.460) (-766.407) (-765.016) [-774.984] -- 0:01:10
      67000 -- (-767.507) [-766.464] (-769.244) (-769.704) * (-768.026) [-763.557] (-767.009) (-770.283) -- 0:01:09
      67500 -- (-767.298) [-765.612] (-768.340) (-769.885) * (-765.749) (-765.654) (-766.558) [-766.864] -- 0:01:09
      68000 -- (-767.961) (-766.071) [-766.992] (-771.331) * (-764.322) [-765.787] (-766.627) (-767.573) -- 0:01:08
      68500 -- (-772.417) (-764.723) (-766.661) [-765.849] * (-766.220) (-772.375) (-767.288) [-765.985] -- 0:01:07
      69000 -- (-766.060) (-766.896) (-766.808) [-767.626] * [-768.348] (-765.923) (-767.700) (-767.605) -- 0:01:07
      69500 -- (-766.542) [-765.489] (-764.325) (-769.374) * (-771.109) [-765.898] (-766.590) (-765.971) -- 0:01:06
      70000 -- (-767.779) (-767.089) [-766.916] (-768.211) * [-766.788] (-768.250) (-768.316) (-769.285) -- 0:01:06

      Average standard deviation of split frequencies: 0.031353

      70500 -- (-767.941) (-769.342) (-765.982) [-768.373] * (-766.038) [-767.152] (-768.211) (-766.576) -- 0:01:05
      71000 -- [-766.623] (-766.582) (-774.637) (-765.912) * [-769.300] (-766.893) (-769.184) (-765.575) -- 0:01:05
      71500 -- [-767.917] (-765.681) (-767.599) (-766.958) * [-767.171] (-767.842) (-766.907) (-765.151) -- 0:01:04
      72000 -- [-765.012] (-764.311) (-766.868) (-766.288) * [-766.001] (-770.485) (-767.934) (-764.449) -- 0:01:04
      72500 -- (-768.246) [-765.530] (-765.016) (-765.669) * (-769.850) (-768.121) (-767.598) [-765.808] -- 0:01:03
      73000 -- (-767.092) (-764.238) (-771.745) [-764.671] * [-765.101] (-769.923) (-765.922) (-768.325) -- 0:01:03
      73500 -- (-764.646) (-764.983) [-766.755] (-764.170) * (-764.851) (-769.821) [-767.177] (-768.118) -- 0:01:03
      74000 -- (-765.511) (-765.812) [-766.244] (-768.385) * (-766.162) (-767.585) (-767.314) [-772.424] -- 0:01:02
      74500 -- (-766.659) (-765.433) (-766.345) [-773.882] * [-766.172] (-766.843) (-767.360) (-766.169) -- 0:01:02
      75000 -- [-766.092] (-764.169) (-768.035) (-769.173) * [-765.945] (-766.132) (-764.842) (-767.770) -- 0:01:01

      Average standard deviation of split frequencies: 0.029381

      75500 -- (-764.278) [-764.987] (-767.172) (-768.076) * (-764.785) (-763.786) (-766.233) [-765.554] -- 0:01:01
      76000 -- (-765.137) (-769.807) (-764.984) [-765.749] * (-765.875) (-764.998) [-766.164] (-765.573) -- 0:01:00
      76500 -- (-766.390) (-775.370) (-764.343) [-766.294] * (-765.284) (-767.565) [-765.674] (-767.202) -- 0:01:00
      77000 -- (-765.707) [-769.163] (-769.623) (-769.030) * (-767.797) (-768.821) (-765.245) [-765.521] -- 0:00:59
      77500 -- (-765.725) [-768.762] (-772.712) (-767.984) * [-766.269] (-766.352) (-764.609) (-766.249) -- 0:00:59
      78000 -- (-768.268) [-766.111] (-766.952) (-764.889) * (-767.688) (-766.535) [-768.209] (-767.237) -- 0:00:59
      78500 -- (-766.386) (-766.959) [-768.320] (-767.569) * (-767.184) [-767.012] (-767.037) (-766.928) -- 0:00:58
      79000 -- (-763.972) (-768.775) (-766.209) [-765.856] * (-766.508) (-767.162) (-767.412) [-767.780] -- 0:00:58
      79500 -- (-765.496) [-766.985] (-765.668) (-769.135) * [-765.687] (-771.012) (-767.153) (-769.765) -- 0:00:57
      80000 -- (-766.237) [-767.780] (-764.584) (-764.015) * (-765.797) (-765.521) [-770.275] (-771.610) -- 0:01:09

      Average standard deviation of split frequencies: 0.026759

      80500 -- (-765.616) [-767.160] (-768.882) (-767.659) * (-764.935) (-766.284) (-771.017) [-766.824] -- 0:01:08
      81000 -- (-766.018) (-767.479) [-764.968] (-767.008) * (-767.753) (-767.020) (-767.836) [-768.010] -- 0:01:08
      81500 -- (-768.611) (-767.394) [-764.429] (-767.249) * [-767.911] (-766.696) (-765.654) (-764.972) -- 0:01:07
      82000 -- (-766.580) [-767.766] (-771.029) (-768.550) * [-768.534] (-767.963) (-766.162) (-764.497) -- 0:01:07
      82500 -- (-775.758) (-768.945) (-764.873) [-765.988] * (-768.457) [-767.174] (-763.554) (-765.394) -- 0:01:06
      83000 -- (-767.859) (-768.087) (-765.578) [-765.002] * (-769.127) (-769.249) (-767.836) [-765.936] -- 0:01:06
      83500 -- [-771.271] (-767.458) (-766.072) (-766.411) * (-766.982) (-776.467) [-764.212] (-764.839) -- 0:01:05
      84000 -- (-767.491) [-768.117] (-766.041) (-768.709) * (-766.477) (-769.685) (-768.356) [-766.413] -- 0:01:05
      84500 -- (-766.331) (-768.518) [-765.812] (-765.504) * (-766.088) (-770.596) [-766.999] (-765.778) -- 0:01:05
      85000 -- (-766.552) (-768.528) [-766.268] (-767.654) * (-767.966) (-768.420) [-768.812] (-768.745) -- 0:01:04

      Average standard deviation of split frequencies: 0.029234

      85500 -- (-765.591) (-767.495) (-767.466) [-767.607] * (-765.606) (-769.620) (-766.143) [-768.585] -- 0:01:04
      86000 -- [-765.154] (-767.798) (-764.212) (-768.759) * (-765.317) (-768.546) [-767.448] (-767.997) -- 0:01:03
      86500 -- (-766.712) (-768.857) [-764.963] (-765.004) * (-767.499) (-769.838) [-765.239] (-768.576) -- 0:01:03
      87000 -- (-767.762) (-767.608) (-764.245) [-767.158] * (-765.492) (-772.145) [-766.721] (-768.068) -- 0:01:02
      87500 -- (-768.995) (-768.788) [-765.831] (-765.803) * (-765.017) (-765.247) (-767.080) [-768.944] -- 0:01:02
      88000 -- (-769.887) (-766.690) (-767.084) [-766.586] * (-766.622) (-767.412) [-767.222] (-768.757) -- 0:01:02
      88500 -- [-765.248] (-766.272) (-765.407) (-765.387) * (-766.593) (-767.818) [-766.735] (-772.703) -- 0:01:01
      89000 -- [-764.551] (-765.870) (-767.825) (-765.529) * (-765.231) [-770.084] (-765.945) (-769.446) -- 0:01:01
      89500 -- (-765.428) (-766.037) (-766.412) [-764.284] * (-765.399) (-777.855) [-765.341] (-768.349) -- 0:01:01
      90000 -- (-766.263) (-767.538) (-767.051) [-765.835] * (-766.789) [-770.767] (-767.756) (-767.048) -- 0:01:00

      Average standard deviation of split frequencies: 0.029280

      90500 -- (-765.632) (-767.448) [-764.833] (-764.739) * (-767.830) [-767.643] (-766.345) (-772.207) -- 0:01:00
      91000 -- (-764.779) (-762.989) (-767.277) [-764.195] * [-766.472] (-766.086) (-766.808) (-769.715) -- 0:00:59
      91500 -- (-764.548) (-774.780) [-764.899] (-767.745) * (-765.684) (-767.880) [-765.167] (-770.418) -- 0:00:59
      92000 -- [-765.052] (-765.991) (-768.469) (-766.293) * (-765.514) [-765.151] (-769.171) (-768.748) -- 0:00:59
      92500 -- (-764.631) (-767.426) [-765.088] (-766.357) * [-765.626] (-768.574) (-765.754) (-768.725) -- 0:00:58
      93000 -- [-767.700] (-768.335) (-771.375) (-770.575) * [-766.668] (-767.941) (-767.228) (-770.819) -- 0:00:58
      93500 -- (-765.276) [-763.662] (-768.455) (-765.072) * [-767.165] (-773.960) (-768.545) (-767.888) -- 0:00:58
      94000 -- (-766.202) [-763.770] (-767.220) (-767.319) * (-768.562) [-768.217] (-767.186) (-771.305) -- 0:00:57
      94500 -- (-764.104) (-766.422) [-765.280] (-766.258) * (-767.907) [-763.675] (-766.020) (-768.116) -- 0:00:57
      95000 -- (-764.082) [-767.414] (-767.585) (-766.529) * (-766.827) [-764.494] (-766.520) (-765.003) -- 0:00:57

      Average standard deviation of split frequencies: 0.027826

      95500 -- [-765.797] (-764.805) (-765.462) (-765.973) * (-766.328) [-767.090] (-765.786) (-767.867) -- 0:01:06
      96000 -- (-765.865) (-766.293) [-764.365] (-768.925) * (-767.046) (-770.890) [-769.245] (-769.737) -- 0:01:05
      96500 -- (-766.883) [-766.156] (-767.897) (-765.044) * [-766.481] (-767.950) (-766.184) (-766.694) -- 0:01:05
      97000 -- (-766.798) [-764.708] (-766.428) (-765.938) * [-765.312] (-766.518) (-764.730) (-766.797) -- 0:01:05
      97500 -- (-765.204) [-765.421] (-768.354) (-765.931) * [-765.547] (-765.999) (-765.906) (-770.771) -- 0:01:04
      98000 -- (-768.384) (-768.113) [-765.417] (-771.084) * (-768.024) (-769.493) [-767.793] (-770.596) -- 0:01:04
      98500 -- (-766.750) (-768.595) [-766.430] (-768.824) * (-769.942) (-766.241) [-765.918] (-771.196) -- 0:01:04
      99000 -- (-765.187) [-768.215] (-765.889) (-768.062) * (-768.724) [-767.530] (-769.359) (-767.674) -- 0:01:03
      99500 -- (-766.539) (-767.443) [-767.579] (-767.375) * (-764.679) [-767.198] (-772.156) (-766.798) -- 0:01:03
      100000 -- [-765.374] (-763.777) (-769.333) (-767.119) * (-766.154) [-770.291] (-766.492) (-766.730) -- 0:01:02

      Average standard deviation of split frequencies: 0.026796

      100500 -- [-766.761] (-765.880) (-767.984) (-767.745) * (-765.534) (-770.691) (-765.434) [-768.905] -- 0:01:02
      101000 -- (-767.732) (-765.145) [-764.416] (-767.195) * (-766.352) (-767.679) (-765.750) [-770.693] -- 0:01:02
      101500 -- [-769.250] (-767.096) (-766.917) (-769.482) * (-767.752) (-767.884) [-766.131] (-776.201) -- 0:01:01
      102000 -- [-769.632] (-765.633) (-768.538) (-767.897) * [-769.079] (-769.731) (-765.561) (-770.095) -- 0:01:01
      102500 -- (-769.133) (-770.189) (-766.984) [-765.245] * [-766.848] (-767.369) (-767.140) (-767.474) -- 0:01:01
      103000 -- (-774.675) [-767.332] (-767.632) (-771.813) * (-766.500) (-772.214) (-766.833) [-765.067] -- 0:01:00
      103500 -- (-769.136) (-771.023) (-770.070) [-768.111] * [-768.273] (-767.833) (-765.526) (-765.307) -- 0:01:00
      104000 -- (-767.312) (-769.073) [-764.804] (-767.281) * [-768.023] (-767.073) (-765.848) (-765.665) -- 0:01:00
      104500 -- (-769.037) [-775.989] (-765.529) (-766.259) * [-765.546] (-770.249) (-770.794) (-765.146) -- 0:00:59
      105000 -- (-763.436) (-765.231) (-767.052) [-766.828] * (-763.634) (-770.432) [-768.909] (-764.892) -- 0:00:59

      Average standard deviation of split frequencies: 0.025045

      105500 -- (-765.000) [-767.024] (-765.767) (-768.478) * (-767.560) (-766.058) (-769.513) [-763.396] -- 0:00:59
      106000 -- [-766.314] (-765.893) (-765.359) (-766.995) * (-774.235) [-767.662] (-765.456) (-767.467) -- 0:00:59
      106500 -- [-764.739] (-770.026) (-768.830) (-768.447) * [-766.028] (-767.087) (-764.672) (-765.843) -- 0:00:58
      107000 -- (-764.595) (-768.541) [-766.158] (-768.653) * (-766.132) (-767.229) (-764.597) [-765.324] -- 0:00:58
      107500 -- (-763.343) (-774.461) [-766.547] (-765.877) * [-766.303] (-765.980) (-766.553) (-766.119) -- 0:00:58
      108000 -- (-764.733) [-766.317] (-765.960) (-768.169) * (-766.050) (-766.995) (-767.040) [-767.009] -- 0:00:57
      108500 -- (-766.108) (-766.089) [-764.598] (-766.752) * (-767.298) [-768.693] (-765.513) (-765.465) -- 0:00:57
      109000 -- [-763.992] (-766.490) (-767.399) (-767.753) * (-766.696) (-767.796) [-766.245] (-766.527) -- 0:00:57
      109500 -- [-764.312] (-767.177) (-769.480) (-771.686) * (-772.545) (-770.831) [-766.091] (-766.626) -- 0:00:56
      110000 -- (-768.572) (-766.526) [-767.044] (-768.051) * (-767.037) (-770.914) [-766.712] (-767.875) -- 0:00:56

      Average standard deviation of split frequencies: 0.023989

      110500 -- (-765.252) (-768.169) (-767.137) [-767.211] * (-768.090) (-768.106) (-765.093) [-767.284] -- 0:00:56
      111000 -- (-764.383) (-766.190) [-765.611] (-767.810) * (-766.070) [-770.213] (-764.454) (-764.839) -- 0:01:04
      111500 -- (-767.401) (-768.504) [-768.178] (-768.047) * (-766.627) [-766.027] (-765.188) (-768.352) -- 0:01:03
      112000 -- (-765.725) (-766.956) (-768.117) [-769.028] * (-767.285) (-766.313) [-764.194] (-766.660) -- 0:01:03
      112500 -- (-767.681) [-767.335] (-768.334) (-768.990) * (-766.622) (-766.444) (-764.113) [-766.731] -- 0:01:03
      113000 -- (-764.758) (-769.451) (-769.227) [-769.932] * (-770.423) (-767.203) (-767.598) [-765.556] -- 0:01:02
      113500 -- (-765.075) [-765.379] (-767.853) (-768.651) * [-767.503] (-768.190) (-767.073) (-766.746) -- 0:01:02
      114000 -- (-769.152) (-769.558) [-768.475] (-768.227) * (-768.686) (-767.219) [-764.938] (-768.812) -- 0:01:02
      114500 -- (-768.165) (-768.220) [-766.800] (-766.516) * (-769.077) (-769.046) (-764.852) [-766.437] -- 0:01:01
      115000 -- [-767.529] (-769.279) (-768.109) (-767.912) * (-767.043) (-768.312) (-767.623) [-768.546] -- 0:01:01

      Average standard deviation of split frequencies: 0.023741

      115500 -- (-765.452) [-768.596] (-767.976) (-767.868) * [-768.661] (-767.766) (-767.550) (-770.923) -- 0:01:01
      116000 -- (-765.266) [-765.818] (-766.884) (-768.198) * (-765.157) (-767.936) [-766.556] (-766.021) -- 0:01:00
      116500 -- [-767.985] (-764.212) (-765.217) (-766.550) * (-767.572) (-768.658) (-767.676) [-768.025] -- 0:01:00
      117000 -- [-766.357] (-766.596) (-766.560) (-766.858) * (-765.069) (-766.129) [-765.381] (-767.637) -- 0:01:00
      117500 -- (-765.094) (-771.971) (-766.946) [-767.500] * (-766.737) [-765.967] (-766.895) (-767.223) -- 0:01:00
      118000 -- [-764.403] (-769.385) (-768.781) (-767.447) * (-766.525) (-770.479) [-771.294] (-764.531) -- 0:00:59
      118500 -- (-767.486) (-767.686) [-767.201] (-766.417) * (-769.567) (-766.645) (-770.743) [-766.477] -- 0:00:59
      119000 -- (-767.082) (-765.142) (-769.472) [-767.251] * (-769.619) (-766.604) [-765.230] (-765.332) -- 0:00:59
      119500 -- [-766.026] (-767.600) (-766.973) (-766.948) * (-769.865) (-768.844) (-771.683) [-770.322] -- 0:00:58
      120000 -- (-766.480) (-770.978) (-772.293) [-765.867] * [-767.317] (-766.963) (-770.036) (-766.130) -- 0:00:58

      Average standard deviation of split frequencies: 0.027542

      120500 -- (-767.293) (-769.882) [-767.152] (-770.567) * [-766.303] (-767.702) (-770.011) (-765.044) -- 0:00:58
      121000 -- (-765.311) [-765.668] (-769.397) (-768.855) * (-765.863) (-767.351) [-771.704] (-769.784) -- 0:00:58
      121500 -- [-765.006] (-766.681) (-767.077) (-770.994) * (-768.938) [-766.602] (-775.043) (-765.565) -- 0:00:57
      122000 -- [-767.418] (-767.451) (-766.232) (-766.643) * [-765.770] (-766.413) (-764.112) (-766.563) -- 0:00:57
      122500 -- (-767.598) (-766.714) (-765.456) [-770.649] * (-769.452) (-767.256) [-766.447] (-765.972) -- 0:00:57
      123000 -- (-765.242) (-769.811) (-767.991) [-769.214] * [-770.550] (-769.539) (-767.950) (-766.147) -- 0:00:57
      123500 -- (-765.845) (-766.839) (-766.853) [-767.640] * (-768.854) (-769.376) (-768.766) [-764.837] -- 0:00:56
      124000 -- (-763.492) (-769.923) [-766.830] (-767.862) * (-769.866) (-773.422) (-773.091) [-765.561] -- 0:00:56
      124500 -- [-764.576] (-767.053) (-766.116) (-766.378) * (-765.337) (-769.803) [-765.287] (-767.649) -- 0:00:56
      125000 -- (-764.042) (-767.416) [-765.769] (-768.909) * [-767.920] (-769.625) (-766.863) (-769.802) -- 0:00:56

      Average standard deviation of split frequencies: 0.023695

      125500 -- [-763.248] (-765.365) (-767.879) (-768.861) * (-771.342) [-768.235] (-766.198) (-769.304) -- 0:01:02
      126000 -- [-765.139] (-764.569) (-766.156) (-767.801) * (-766.359) (-768.327) (-767.382) [-769.770] -- 0:01:02
      126500 -- (-765.965) [-766.967] (-765.923) (-769.315) * [-764.279] (-771.759) (-765.688) (-767.207) -- 0:01:02
      127000 -- (-765.279) (-767.697) (-767.765) [-766.294] * (-765.706) (-767.961) [-766.597] (-768.479) -- 0:01:01
      127500 -- [-765.965] (-765.891) (-766.015) (-766.211) * [-765.962] (-768.847) (-768.237) (-765.049) -- 0:01:01
      128000 -- (-766.122) [-766.584] (-767.850) (-768.693) * [-765.890] (-768.223) (-768.580) (-764.322) -- 0:01:01
      128500 -- (-766.599) (-764.717) [-767.948] (-767.831) * [-765.057] (-772.240) (-765.383) (-768.036) -- 0:01:01
      129000 -- (-768.403) [-767.222] (-766.440) (-765.592) * (-767.527) [-765.843] (-765.645) (-768.099) -- 0:01:00
      129500 -- (-767.602) (-766.640) (-766.969) [-767.088] * (-766.121) (-766.848) (-766.035) [-764.357] -- 0:01:00
      130000 -- [-767.584] (-766.628) (-765.215) (-765.852) * (-766.070) (-766.926) [-768.743] (-764.824) -- 0:01:00

      Average standard deviation of split frequencies: 0.024853

      130500 -- (-771.145) (-764.971) [-768.103] (-766.622) * (-768.157) (-768.753) [-771.203] (-765.292) -- 0:00:59
      131000 -- (-769.211) [-765.617] (-764.784) (-767.450) * (-770.234) (-766.059) [-772.635] (-767.115) -- 0:00:59
      131500 -- [-769.055] (-764.638) (-765.981) (-766.575) * (-773.882) (-768.224) (-771.981) [-768.307] -- 0:00:59
      132000 -- (-768.930) (-764.613) [-768.841] (-765.584) * (-766.756) (-767.710) [-766.266] (-765.523) -- 0:00:59
      132500 -- (-765.101) (-770.190) (-765.687) [-767.586] * (-766.612) (-769.967) [-767.854] (-763.390) -- 0:00:58
      133000 -- (-763.649) (-771.315) (-764.217) [-766.006] * (-769.353) (-767.663) [-771.704] (-765.112) -- 0:00:58
      133500 -- (-763.760) (-765.092) (-768.467) [-767.894] * (-768.059) [-767.611] (-767.802) (-764.897) -- 0:00:58
      134000 -- (-766.008) [-769.759] (-768.789) (-765.281) * (-770.868) (-767.725) (-766.170) [-765.258] -- 0:00:58
      134500 -- [-765.925] (-766.376) (-768.068) (-767.038) * (-765.933) [-767.891] (-767.010) (-763.792) -- 0:00:57
      135000 -- [-766.566] (-765.962) (-765.508) (-765.567) * (-764.916) [-767.004] (-767.853) (-765.406) -- 0:00:57

      Average standard deviation of split frequencies: 0.025723

      135500 -- (-764.415) (-768.951) [-765.752] (-767.318) * (-766.125) (-766.847) (-767.256) [-765.637] -- 0:00:57
      136000 -- (-764.796) (-766.032) (-767.243) [-766.795] * (-764.662) [-764.754] (-768.683) (-768.787) -- 0:00:57
      136500 -- (-766.391) (-770.783) [-765.824] (-766.789) * [-765.120] (-766.808) (-768.864) (-765.891) -- 0:00:56
      137000 -- [-764.449] (-769.472) (-768.057) (-767.420) * [-767.135] (-767.082) (-768.244) (-772.255) -- 0:00:56
      137500 -- [-766.252] (-766.587) (-765.773) (-768.038) * (-768.596) (-767.242) [-769.387] (-770.649) -- 0:00:56
      138000 -- (-771.451) (-769.328) [-763.036] (-770.275) * (-765.765) (-765.035) [-766.293] (-765.605) -- 0:00:56
      138500 -- [-768.547] (-769.148) (-766.940) (-768.812) * (-766.268) (-767.689) (-769.890) [-764.480] -- 0:00:55
      139000 -- (-765.812) [-767.683] (-768.318) (-765.649) * (-765.886) (-767.561) [-766.106] (-771.233) -- 0:00:55
      139500 -- [-768.750] (-767.707) (-766.574) (-765.726) * (-768.838) (-767.339) [-767.336] (-767.871) -- 0:00:55
      140000 -- [-765.843] (-766.164) (-770.335) (-767.207) * (-764.998) (-766.287) (-772.566) [-765.607] -- 0:01:01

      Average standard deviation of split frequencies: 0.028485

      140500 -- (-769.779) [-766.570] (-769.555) (-765.188) * (-766.863) (-767.983) (-766.680) [-765.452] -- 0:01:01
      141000 -- [-772.352] (-768.584) (-766.401) (-768.833) * (-766.301) (-770.670) (-767.851) [-765.152] -- 0:01:00
      141500 -- (-766.395) (-769.841) [-767.073] (-766.942) * (-765.501) (-766.678) [-767.845] (-769.510) -- 0:01:00
      142000 -- (-767.899) (-770.282) [-767.773] (-765.091) * (-766.998) (-771.299) [-764.483] (-772.851) -- 0:01:00
      142500 -- (-766.590) (-768.202) (-766.898) [-763.911] * (-776.394) (-771.502) [-766.086] (-766.759) -- 0:01:00
      143000 -- (-765.989) (-766.222) (-767.101) [-767.146] * (-769.665) (-769.255) (-766.222) [-768.909] -- 0:00:59
      143500 -- (-768.121) (-766.256) (-769.889) [-765.371] * (-768.250) [-765.130] (-768.091) (-768.888) -- 0:00:59
      144000 -- (-766.757) (-767.742) (-767.502) [-769.281] * (-766.752) [-764.741] (-768.244) (-766.380) -- 0:00:59
      144500 -- [-765.776] (-772.175) (-768.951) (-768.942) * [-765.408] (-767.959) (-767.093) (-766.407) -- 0:00:59
      145000 -- (-765.425) (-769.860) (-768.332) [-769.715] * (-768.301) (-769.200) (-768.889) [-768.836] -- 0:00:58

      Average standard deviation of split frequencies: 0.023451

      145500 -- (-765.878) (-766.837) (-769.228) [-769.928] * [-765.732] (-768.322) (-769.566) (-765.073) -- 0:00:58
      146000 -- (-767.936) [-766.160] (-769.481) (-767.996) * (-765.894) (-767.388) (-770.770) [-771.164] -- 0:00:58
      146500 -- [-765.232] (-767.661) (-768.694) (-767.300) * (-764.279) [-764.439] (-770.200) (-765.914) -- 0:00:58
      147000 -- [-769.086] (-765.279) (-770.031) (-768.753) * (-766.259) [-766.558] (-766.301) (-772.158) -- 0:00:58
      147500 -- [-764.814] (-765.910) (-770.265) (-768.303) * (-766.645) (-767.982) [-767.332] (-767.945) -- 0:00:57
      148000 -- (-772.519) [-767.861] (-769.880) (-769.438) * (-771.331) (-765.501) [-767.193] (-766.675) -- 0:00:57
      148500 -- (-764.179) (-768.434) [-768.252] (-768.744) * (-769.366) (-771.503) [-764.268] (-768.280) -- 0:00:57
      149000 -- [-767.458] (-766.016) (-769.479) (-767.859) * [-767.210] (-767.502) (-767.160) (-770.397) -- 0:00:57
      149500 -- (-771.129) (-766.780) [-768.989] (-768.236) * (-769.496) [-767.482] (-767.896) (-767.735) -- 0:00:56
      150000 -- [-767.821] (-769.996) (-769.859) (-767.695) * (-768.872) [-769.610] (-769.097) (-766.831) -- 0:00:56

      Average standard deviation of split frequencies: 0.022075

      150500 -- (-768.251) [-768.374] (-771.487) (-768.127) * (-769.029) (-766.889) [-766.346] (-770.520) -- 0:00:56
      151000 -- (-767.726) (-769.013) [-765.563] (-768.147) * (-764.834) [-767.605] (-770.791) (-768.173) -- 0:00:56
      151500 -- (-769.068) (-765.991) (-768.272) [-767.182] * (-766.009) [-767.578] (-768.415) (-766.370) -- 0:00:56
      152000 -- (-769.497) [-766.255] (-767.495) (-768.913) * (-765.008) [-766.150] (-768.527) (-773.114) -- 0:00:55
      152500 -- (-768.117) [-769.238] (-766.942) (-765.957) * (-767.249) (-769.421) (-767.079) [-767.503] -- 0:00:55
      153000 -- (-767.274) [-766.923] (-768.181) (-767.060) * (-765.909) [-766.686] (-769.512) (-766.591) -- 0:00:55
      153500 -- (-769.249) (-763.607) (-767.687) [-767.410] * (-772.436) (-765.827) [-767.029] (-766.355) -- 0:00:55
      154000 -- (-769.121) (-764.810) [-767.383] (-765.724) * [-769.097] (-766.123) (-768.329) (-764.492) -- 0:00:54
      154500 -- (-768.424) [-767.170] (-766.081) (-766.278) * (-771.140) (-769.179) [-766.055] (-763.990) -- 0:00:54
      155000 -- [-766.047] (-765.817) (-764.106) (-770.031) * (-768.064) (-768.137) [-766.280] (-765.855) -- 0:00:54

      Average standard deviation of split frequencies: 0.023286

      155500 -- [-768.886] (-766.934) (-766.975) (-766.551) * [-764.973] (-768.468) (-769.241) (-764.959) -- 0:00:59
      156000 -- [-766.587] (-767.084) (-766.250) (-765.663) * (-764.975) (-769.473) [-765.713] (-766.857) -- 0:00:59
      156500 -- (-769.604) [-766.306] (-767.689) (-766.663) * (-764.171) [-768.969] (-769.726) (-769.999) -- 0:00:59
      157000 -- (-769.987) (-767.416) (-766.535) [-766.562] * (-766.706) (-768.173) (-768.489) [-771.008] -- 0:00:59
      157500 -- (-768.001) [-766.492] (-766.171) (-766.201) * (-770.287) (-767.065) [-766.067] (-765.958) -- 0:00:58
      158000 -- [-768.339] (-767.091) (-766.911) (-765.889) * (-767.812) (-766.608) [-766.514] (-766.380) -- 0:00:58
      158500 -- [-766.824] (-769.899) (-765.803) (-767.215) * (-767.480) (-769.472) (-766.132) [-766.634] -- 0:00:58
      159000 -- (-766.396) (-765.832) [-764.107] (-770.839) * (-766.064) (-768.493) (-767.176) [-764.955] -- 0:00:58
      159500 -- (-767.666) [-767.465] (-765.627) (-766.296) * [-765.973] (-768.375) (-767.008) (-769.516) -- 0:00:57
      160000 -- (-769.526) (-767.247) [-764.398] (-768.039) * (-767.773) (-770.384) [-766.690] (-765.224) -- 0:00:57

      Average standard deviation of split frequencies: 0.024335

      160500 -- (-767.258) (-767.077) [-766.483] (-767.320) * (-765.920) (-768.417) (-769.530) [-764.329] -- 0:00:57
      161000 -- [-768.359] (-765.734) (-765.386) (-770.643) * (-766.307) [-766.175] (-766.216) (-765.780) -- 0:00:57
      161500 -- (-769.704) (-766.308) [-767.270] (-769.155) * (-767.015) (-767.370) (-768.248) [-766.163] -- 0:00:57
      162000 -- (-767.371) (-767.481) (-765.606) [-766.668] * (-768.252) [-766.803] (-765.784) (-767.515) -- 0:00:56
      162500 -- [-770.964] (-765.102) (-767.765) (-766.914) * (-767.678) (-767.421) (-768.515) [-766.903] -- 0:00:56
      163000 -- [-767.622] (-765.218) (-765.232) (-765.515) * [-767.377] (-768.363) (-770.557) (-767.076) -- 0:00:56
      163500 -- [-766.356] (-766.638) (-766.049) (-767.411) * (-768.193) (-768.316) (-766.688) [-768.357] -- 0:00:56
      164000 -- (-766.264) (-769.516) [-765.356] (-767.268) * (-765.493) [-766.605] (-765.509) (-766.890) -- 0:00:56
      164500 -- (-764.658) [-763.928] (-770.449) (-767.676) * [-764.757] (-766.347) (-769.051) (-766.290) -- 0:00:55
      165000 -- [-764.286] (-768.369) (-765.288) (-765.175) * (-766.621) (-767.260) (-767.050) [-766.570] -- 0:00:55

      Average standard deviation of split frequencies: 0.022245

      165500 -- [-766.425] (-766.542) (-768.709) (-768.036) * (-767.047) [-769.456] (-767.998) (-766.221) -- 0:00:55
      166000 -- (-767.352) (-766.899) (-769.294) [-766.260] * (-765.312) [-765.417] (-765.680) (-768.081) -- 0:00:55
      166500 -- (-769.135) [-766.619] (-769.407) (-766.318) * (-766.499) (-766.163) [-768.049] (-767.478) -- 0:00:55
      167000 -- (-766.746) (-765.697) [-770.142] (-768.505) * (-769.489) (-767.221) (-770.699) [-765.986] -- 0:00:54
      167500 -- (-766.685) [-772.287] (-765.485) (-769.504) * [-770.559] (-770.178) (-765.881) (-768.550) -- 0:00:54
      168000 -- [-766.350] (-768.505) (-768.517) (-767.082) * (-765.442) (-769.799) (-771.598) [-764.067] -- 0:00:54
      168500 -- (-765.735) [-765.826] (-766.683) (-771.140) * [-767.153] (-769.763) (-769.531) (-766.719) -- 0:00:54
      169000 -- (-765.097) (-766.714) [-767.569] (-766.401) * [-767.127] (-766.230) (-770.567) (-763.364) -- 0:00:54
      169500 -- (-764.464) (-767.200) [-767.000] (-765.216) * [-769.234] (-767.637) (-767.364) (-765.089) -- 0:00:53
      170000 -- (-768.251) (-767.088) [-768.842] (-766.936) * (-767.786) (-765.911) [-766.085] (-765.028) -- 0:00:53

      Average standard deviation of split frequencies: 0.020716

      170500 -- (-769.194) (-767.090) [-766.848] (-765.586) * (-767.768) (-768.731) (-766.114) [-765.164] -- 0:00:53
      171000 -- (-766.142) (-766.687) [-766.677] (-764.419) * [-767.584] (-768.006) (-766.649) (-765.036) -- 0:00:58
      171500 -- (-764.608) (-767.237) [-766.981] (-765.796) * (-769.666) [-769.472] (-764.876) (-765.712) -- 0:00:57
      172000 -- [-765.349] (-768.511) (-769.154) (-765.850) * [-768.590] (-770.260) (-767.511) (-764.445) -- 0:00:57
      172500 -- [-765.339] (-766.427) (-769.659) (-767.844) * (-768.164) (-767.934) (-766.417) [-765.718] -- 0:00:57
      173000 -- [-766.159] (-764.583) (-766.040) (-767.899) * (-768.497) [-766.982] (-768.101) (-763.566) -- 0:00:57
      173500 -- (-767.687) (-764.877) [-764.557] (-765.108) * [-766.347] (-768.116) (-767.641) (-766.051) -- 0:00:57
      174000 -- (-767.390) (-766.706) (-769.199) [-766.645] * [-767.560] (-770.862) (-767.211) (-770.067) -- 0:00:56
      174500 -- (-766.561) (-766.266) [-763.496] (-769.320) * [-767.057] (-767.863) (-770.809) (-766.883) -- 0:00:56
      175000 -- (-770.775) (-768.111) [-764.911] (-767.388) * [-767.223] (-765.970) (-767.899) (-769.205) -- 0:00:56

      Average standard deviation of split frequencies: 0.020981

      175500 -- (-772.597) [-764.461] (-769.349) (-767.034) * (-767.253) (-767.510) [-767.095] (-768.102) -- 0:00:56
      176000 -- [-767.354] (-764.469) (-768.511) (-769.474) * [-767.168] (-766.566) (-767.831) (-766.276) -- 0:00:56
      176500 -- (-767.162) [-765.060] (-764.376) (-772.206) * [-767.042] (-767.105) (-766.287) (-765.965) -- 0:00:55
      177000 -- (-766.153) (-766.678) [-765.517] (-766.008) * (-768.849) [-767.274] (-763.514) (-765.320) -- 0:00:55
      177500 -- (-769.092) (-766.080) (-764.755) [-769.539] * (-767.729) (-766.739) [-765.751] (-766.731) -- 0:00:55
      178000 -- (-766.336) [-769.169] (-765.827) (-767.805) * (-775.438) (-767.483) (-765.334) [-764.840] -- 0:00:55
      178500 -- (-764.598) (-766.224) (-764.577) [-768.530] * (-766.495) (-768.103) (-770.740) [-763.386] -- 0:00:55
      179000 -- [-769.062] (-764.854) (-763.919) (-768.516) * (-769.286) (-768.834) (-767.002) [-764.888] -- 0:00:55
      179500 -- (-767.066) [-764.666] (-765.179) (-768.999) * [-765.927] (-766.713) (-766.552) (-764.114) -- 0:00:54
      180000 -- (-766.814) (-768.842) [-765.059] (-770.185) * (-765.385) (-767.437) (-767.404) [-766.759] -- 0:00:54

      Average standard deviation of split frequencies: 0.021599

      180500 -- [-767.440] (-766.716) (-765.540) (-768.549) * (-765.355) [-766.923] (-766.843) (-764.798) -- 0:00:54
      181000 -- (-767.290) (-768.726) (-769.161) [-769.109] * (-773.523) [-766.446] (-766.382) (-766.184) -- 0:00:54
      181500 -- (-767.472) (-765.214) [-766.255] (-770.824) * (-769.138) (-767.019) (-767.964) [-767.939] -- 0:00:54
      182000 -- (-768.347) [-765.402] (-767.370) (-766.733) * [-767.815] (-767.569) (-767.716) (-768.104) -- 0:00:53
      182500 -- (-767.974) [-764.771] (-768.218) (-768.154) * [-768.302] (-766.892) (-769.078) (-766.759) -- 0:00:53
      183000 -- [-767.119] (-765.057) (-764.924) (-770.236) * (-765.429) (-771.387) (-767.850) [-771.803] -- 0:00:53
      183500 -- (-766.942) (-766.984) (-769.253) [-767.694] * [-765.272] (-773.344) (-767.733) (-773.467) -- 0:00:53
      184000 -- [-765.944] (-765.743) (-764.310) (-766.709) * (-764.910) [-769.659] (-767.313) (-767.943) -- 0:00:53
      184500 -- (-766.613) (-765.981) [-764.473] (-771.477) * [-764.416] (-767.198) (-767.047) (-764.657) -- 0:00:53
      185000 -- [-766.828] (-766.390) (-765.807) (-768.885) * [-767.328] (-769.606) (-769.250) (-766.697) -- 0:00:52

      Average standard deviation of split frequencies: 0.020542

      185500 -- (-770.821) (-775.371) (-767.114) [-765.747] * (-771.395) (-766.330) (-769.356) [-768.176] -- 0:00:52
      186000 -- (-767.912) (-765.563) (-767.153) [-764.721] * (-765.947) [-767.490] (-770.059) (-767.790) -- 0:00:52
      186500 -- (-766.785) (-768.090) [-766.532] (-767.278) * (-767.081) [-769.436] (-767.332) (-766.084) -- 0:00:56
      187000 -- (-769.158) (-764.640) [-765.296] (-766.460) * (-766.816) (-770.288) [-767.830] (-766.009) -- 0:00:56
      187500 -- [-766.796] (-768.641) (-772.859) (-769.066) * (-766.943) (-768.780) (-766.369) [-764.468] -- 0:00:56
      188000 -- (-765.756) (-768.026) (-765.496) [-767.283] * [-765.478] (-768.205) (-767.532) (-766.629) -- 0:00:56
      188500 -- (-766.212) [-767.553] (-765.430) (-767.367) * [-766.994] (-766.585) (-766.728) (-766.383) -- 0:00:55
      189000 -- (-767.965) (-765.830) (-770.405) [-766.165] * (-764.727) (-769.393) (-769.300) [-766.936] -- 0:00:55
      189500 -- (-767.810) [-765.274] (-771.305) (-766.444) * (-766.537) (-764.634) [-768.395] (-768.706) -- 0:00:55
      190000 -- (-766.803) (-765.239) (-766.768) [-766.941] * (-765.661) [-764.847] (-766.336) (-766.095) -- 0:00:55

      Average standard deviation of split frequencies: 0.020820

      190500 -- [-767.568] (-765.917) (-767.479) (-768.545) * (-767.515) (-767.333) [-767.285] (-765.957) -- 0:00:55
      191000 -- [-768.327] (-770.371) (-763.673) (-773.395) * (-766.668) (-767.394) (-768.475) [-765.563] -- 0:00:55
      191500 -- (-767.440) [-764.755] (-766.651) (-766.831) * [-765.603] (-766.678) (-770.102) (-765.511) -- 0:00:54
      192000 -- (-770.477) (-763.279) [-764.913] (-766.894) * (-766.105) (-766.607) (-768.083) [-763.958] -- 0:00:54
      192500 -- (-769.773) (-766.112) [-765.941] (-766.764) * (-767.445) [-766.171] (-767.157) (-763.898) -- 0:00:54
      193000 -- (-767.931) (-764.808) (-768.475) [-768.181] * (-771.035) (-769.206) (-767.592) [-764.196] -- 0:00:54
      193500 -- [-765.665] (-771.041) (-766.492) (-769.812) * (-773.906) (-768.340) (-768.503) [-764.947] -- 0:00:54
      194000 -- (-769.642) [-767.415] (-767.413) (-767.154) * (-766.960) (-767.719) (-768.052) [-764.828] -- 0:00:54
      194500 -- [-766.913] (-770.212) (-774.102) (-767.143) * [-766.838] (-767.449) (-766.996) (-766.287) -- 0:00:53
      195000 -- (-766.489) [-770.021] (-769.962) (-767.329) * [-765.033] (-768.911) (-767.629) (-765.279) -- 0:00:53

      Average standard deviation of split frequencies: 0.021899

      195500 -- [-766.312] (-768.600) (-766.806) (-769.379) * (-766.661) (-765.707) [-764.936] (-767.060) -- 0:00:53
      196000 -- [-764.442] (-767.737) (-766.766) (-768.407) * (-765.634) (-768.233) [-767.078] (-764.364) -- 0:00:53
      196500 -- (-766.499) (-767.777) (-767.185) [-764.447] * (-766.436) (-765.428) [-767.109] (-765.080) -- 0:00:53
      197000 -- (-769.667) (-765.595) (-768.553) [-765.707] * (-764.379) (-771.992) (-767.175) [-766.530] -- 0:00:52
      197500 -- [-767.048] (-768.897) (-764.212) (-769.417) * [-765.846] (-766.350) (-770.741) (-765.293) -- 0:00:52
      198000 -- (-773.811) (-766.326) [-765.893] (-771.309) * [-765.571] (-771.013) (-765.043) (-766.533) -- 0:00:52
      198500 -- (-768.142) (-766.354) (-764.759) [-767.448] * [-766.216] (-769.533) (-765.304) (-765.746) -- 0:00:52
      199000 -- [-766.578] (-768.024) (-767.733) (-770.229) * (-766.668) [-764.321] (-765.047) (-772.713) -- 0:00:52
      199500 -- (-766.819) (-767.873) (-767.682) [-764.900] * (-767.312) (-764.896) (-765.903) [-766.763] -- 0:00:52
      200000 -- (-764.512) [-766.620] (-767.251) (-766.423) * (-764.395) (-766.746) [-768.000] (-764.888) -- 0:00:51

      Average standard deviation of split frequencies: 0.021273

      200500 -- [-764.379] (-766.702) (-771.415) (-769.822) * [-766.925] (-766.361) (-767.129) (-768.172) -- 0:00:51
      201000 -- (-767.143) (-766.497) (-765.931) [-766.962] * (-771.696) [-766.152] (-763.503) (-763.700) -- 0:00:51
      201500 -- (-766.858) (-768.259) (-766.778) [-765.349] * (-767.834) [-766.515] (-765.173) (-765.477) -- 0:00:51
      202000 -- [-764.252] (-766.642) (-766.048) (-765.136) * (-767.560) (-767.912) (-775.090) [-766.173] -- 0:00:55
      202500 -- [-767.653] (-764.927) (-764.088) (-765.886) * (-770.104) (-764.659) (-765.791) [-765.557] -- 0:00:55
      203000 -- [-768.028] (-765.329) (-767.173) (-769.477) * (-767.786) (-768.646) (-764.421) [-765.661] -- 0:00:54
      203500 -- (-763.830) [-767.925] (-765.306) (-769.308) * (-766.064) (-766.540) [-766.349] (-765.976) -- 0:00:54
      204000 -- [-766.313] (-767.999) (-768.828) (-768.013) * [-768.043] (-765.460) (-768.302) (-766.479) -- 0:00:54
      204500 -- (-770.583) (-767.798) (-767.521) [-766.456] * (-766.680) [-766.349] (-764.936) (-767.635) -- 0:00:54
      205000 -- [-768.366] (-763.596) (-764.986) (-764.160) * (-766.872) (-767.843) [-764.737] (-767.735) -- 0:00:54

      Average standard deviation of split frequencies: 0.021994

      205500 -- (-766.215) (-765.182) (-767.962) [-764.229] * (-765.691) (-765.184) [-769.332] (-765.967) -- 0:00:54
      206000 -- (-766.699) (-767.282) [-766.904] (-767.538) * (-766.184) (-766.470) (-766.469) [-767.195] -- 0:00:53
      206500 -- (-768.012) [-767.365] (-765.244) (-767.346) * (-766.078) (-763.778) (-768.946) [-765.593] -- 0:00:53
      207000 -- (-766.471) (-771.642) (-764.342) [-767.605] * [-769.510] (-763.408) (-766.422) (-766.758) -- 0:00:53
      207500 -- [-766.378] (-769.537) (-763.370) (-770.732) * (-766.783) (-764.855) [-769.067] (-766.552) -- 0:00:53
      208000 -- (-765.999) (-767.100) [-766.251] (-765.665) * (-767.197) [-764.702] (-765.777) (-765.793) -- 0:00:53
      208500 -- (-765.480) (-766.985) (-764.037) [-765.914] * (-765.862) (-765.609) [-768.773] (-766.076) -- 0:00:53
      209000 -- (-764.748) (-767.167) (-764.734) [-764.758] * (-768.838) (-766.740) (-766.700) [-763.102] -- 0:00:52
      209500 -- (-768.524) [-765.214] (-768.765) (-764.425) * [-768.025] (-767.460) (-766.050) (-770.238) -- 0:00:52
      210000 -- (-767.260) (-764.868) (-768.773) [-768.005] * (-768.115) (-766.157) (-766.430) [-768.765] -- 0:00:52

      Average standard deviation of split frequencies: 0.022004

      210500 -- (-768.026) (-769.511) [-767.351] (-766.695) * (-772.046) (-767.212) [-765.372] (-764.717) -- 0:00:52
      211000 -- [-767.025] (-769.288) (-774.102) (-766.252) * (-767.373) (-766.618) (-765.875) [-763.745] -- 0:00:52
      211500 -- [-767.422] (-765.731) (-770.099) (-767.723) * [-768.657] (-771.059) (-766.378) (-769.985) -- 0:00:52
      212000 -- (-766.123) (-765.507) (-766.278) [-764.869] * (-764.879) [-766.964] (-768.245) (-764.163) -- 0:00:52
      212500 -- (-768.863) (-768.318) (-766.161) [-767.353] * (-765.965) (-768.158) [-766.387] (-765.331) -- 0:00:51
      213000 -- (-766.086) (-773.606) (-767.908) [-768.761] * (-764.827) (-767.790) (-769.447) [-766.433] -- 0:00:51
      213500 -- (-767.932) (-767.234) [-767.732] (-767.223) * (-763.505) (-768.790) (-768.714) [-765.198] -- 0:00:51
      214000 -- (-766.226) (-766.217) [-767.377] (-767.043) * [-763.550] (-768.155) (-767.661) (-766.848) -- 0:00:51
      214500 -- (-771.495) (-765.481) (-769.494) [-765.260] * (-771.487) (-765.220) (-767.724) [-764.869] -- 0:00:51
      215000 -- (-767.398) (-764.435) (-765.269) [-767.630] * (-769.608) [-765.995] (-766.442) (-766.444) -- 0:00:51

      Average standard deviation of split frequencies: 0.023622

      215500 -- [-766.859] (-767.935) (-766.591) (-765.869) * (-766.687) (-764.837) (-765.392) [-766.195] -- 0:00:50
      216000 -- [-767.766] (-766.279) (-768.898) (-765.371) * (-766.530) (-767.148) (-764.500) [-767.210] -- 0:00:50
      216500 -- [-767.086] (-765.532) (-766.342) (-765.478) * (-766.727) [-766.346] (-764.669) (-764.569) -- 0:00:50
      217000 -- (-768.490) (-764.419) [-767.905] (-766.509) * (-768.305) (-767.332) (-767.768) [-769.325] -- 0:00:50
      217500 -- (-769.639) (-766.364) [-767.584] (-769.509) * (-768.332) [-763.420] (-766.959) (-766.079) -- 0:00:53
      218000 -- (-768.261) [-766.845] (-768.985) (-766.899) * (-765.835) (-765.933) [-766.358] (-768.213) -- 0:00:53
      218500 -- (-767.126) [-765.915] (-766.997) (-767.241) * [-766.720] (-768.921) (-768.156) (-766.431) -- 0:00:53
      219000 -- (-767.122) (-767.512) (-772.555) [-764.122] * (-768.060) [-767.586] (-767.920) (-766.683) -- 0:00:53
      219500 -- (-767.743) (-768.516) (-765.788) [-767.999] * (-765.707) (-764.307) (-763.781) [-764.781] -- 0:00:53
      220000 -- (-766.298) (-764.412) [-766.706] (-767.709) * (-770.946) (-765.913) [-763.851] (-769.955) -- 0:00:53

      Average standard deviation of split frequencies: 0.022906

      220500 -- [-766.062] (-766.490) (-765.473) (-768.960) * (-765.591) (-765.913) [-764.452] (-766.520) -- 0:00:53
      221000 -- (-768.212) (-767.523) (-768.263) [-766.234] * (-766.694) [-765.071] (-765.581) (-767.809) -- 0:00:52
      221500 -- (-771.655) (-766.324) [-770.299] (-764.903) * [-770.199] (-764.968) (-768.095) (-766.592) -- 0:00:52
      222000 -- (-766.444) [-766.480] (-769.235) (-766.806) * (-768.004) (-766.168) [-769.143] (-769.194) -- 0:00:52
      222500 -- (-767.789) (-764.642) [-765.125] (-769.560) * (-770.174) (-766.443) [-767.344] (-767.160) -- 0:00:52
      223000 -- (-767.006) [-766.216] (-766.726) (-769.452) * (-767.597) (-766.317) (-765.045) [-767.402] -- 0:00:52
      223500 -- (-767.665) (-765.665) (-766.410) [-767.323] * (-765.913) (-768.623) (-769.999) [-769.147] -- 0:00:52
      224000 -- (-766.676) (-766.566) [-766.297] (-768.748) * (-765.230) [-767.440] (-766.041) (-768.356) -- 0:00:51
      224500 -- (-766.878) [-764.513] (-766.902) (-766.006) * (-764.533) (-769.838) [-768.761] (-768.143) -- 0:00:51
      225000 -- (-766.933) (-767.292) [-765.823] (-766.567) * (-765.544) (-766.820) [-765.792] (-765.813) -- 0:00:51

      Average standard deviation of split frequencies: 0.021067

      225500 -- (-767.303) [-767.063] (-767.404) (-767.015) * (-765.271) (-765.956) [-764.769] (-769.142) -- 0:00:51
      226000 -- (-766.534) (-766.337) [-764.428] (-767.008) * (-766.945) (-767.679) (-765.749) [-765.986] -- 0:00:51
      226500 -- (-765.619) (-767.994) [-766.220] (-767.400) * [-767.376] (-767.248) (-768.838) (-767.748) -- 0:00:51
      227000 -- (-771.086) [-768.708] (-767.999) (-772.135) * (-766.777) (-766.143) (-768.680) [-768.731] -- 0:00:51
      227500 -- (-767.467) (-770.010) (-767.518) [-766.226] * [-765.740] (-766.250) (-767.186) (-765.539) -- 0:00:50
      228000 -- (-766.408) [-768.900] (-770.185) (-768.767) * [-765.798] (-770.046) (-764.866) (-764.338) -- 0:00:50
      228500 -- (-766.118) (-770.435) (-766.650) [-769.372] * [-770.156] (-767.204) (-766.094) (-766.674) -- 0:00:50
      229000 -- (-768.499) [-767.123] (-766.579) (-769.057) * (-766.020) [-765.552] (-767.487) (-770.661) -- 0:00:50
      229500 -- (-768.294) (-769.131) (-765.382) [-766.752] * (-768.499) (-765.913) (-768.184) [-771.187] -- 0:00:50
      230000 -- (-767.318) (-770.219) (-773.122) [-767.883] * [-774.097] (-765.767) (-765.484) (-766.200) -- 0:00:50

      Average standard deviation of split frequencies: 0.020544

      230500 -- (-770.517) [-766.995] (-767.842) (-767.426) * (-766.473) (-766.538) (-766.289) [-764.860] -- 0:00:50
      231000 -- (-766.562) (-768.871) [-765.971] (-769.828) * (-767.198) (-765.186) (-768.765) [-765.143] -- 0:00:49
      231500 -- (-768.096) (-767.913) (-768.442) [-768.676] * [-764.654] (-769.943) (-769.315) (-767.505) -- 0:00:49
      232000 -- [-766.629] (-770.902) (-766.939) (-767.573) * (-770.496) (-767.921) (-765.247) [-768.490] -- 0:00:49
      232500 -- (-772.382) (-768.458) [-768.127] (-764.242) * (-769.510) (-766.088) [-766.059] (-767.139) -- 0:00:49
      233000 -- (-766.440) (-765.436) (-767.634) [-767.120] * (-767.270) (-767.535) [-765.061] (-766.560) -- 0:00:52
      233500 -- (-765.519) (-766.081) (-766.689) [-766.561] * (-766.374) (-770.122) (-769.957) [-766.895] -- 0:00:52
      234000 -- (-764.588) [-765.130] (-766.248) (-767.276) * (-769.969) (-768.682) [-771.457] (-766.150) -- 0:00:52
      234500 -- (-767.810) (-766.997) [-765.656] (-766.324) * (-769.679) (-767.949) [-765.323] (-773.812) -- 0:00:52
      235000 -- [-764.994] (-768.619) (-764.052) (-765.740) * [-766.591] (-768.165) (-764.725) (-769.236) -- 0:00:52

      Average standard deviation of split frequencies: 0.020562

      235500 -- (-767.885) [-768.314] (-765.367) (-768.149) * [-767.160] (-766.569) (-769.579) (-766.756) -- 0:00:51
      236000 -- (-769.233) [-766.942] (-767.822) (-766.540) * (-767.596) (-764.921) (-770.081) [-768.702] -- 0:00:51
      236500 -- (-765.370) [-768.239] (-765.003) (-766.190) * (-765.966) (-765.274) [-766.914] (-765.423) -- 0:00:51
      237000 -- [-766.759] (-768.123) (-765.565) (-768.929) * (-766.749) (-765.113) (-769.586) [-767.093] -- 0:00:51
      237500 -- (-768.482) [-767.451] (-765.406) (-767.486) * (-768.620) [-767.070] (-769.228) (-769.083) -- 0:00:51
      238000 -- (-770.403) (-774.689) (-771.488) [-768.686] * (-767.481) (-767.565) (-770.072) [-764.999] -- 0:00:51
      238500 -- (-769.393) (-767.648) (-773.309) [-771.161] * [-769.364] (-769.267) (-768.993) (-765.117) -- 0:00:51
      239000 -- (-768.315) (-767.081) (-764.974) [-767.408] * [-768.897] (-770.791) (-767.630) (-766.821) -- 0:00:50
      239500 -- [-768.481] (-768.641) (-768.540) (-767.621) * [-767.459] (-767.990) (-765.265) (-766.620) -- 0:00:50
      240000 -- (-766.566) (-768.157) [-765.966] (-766.575) * [-769.536] (-765.884) (-767.929) (-769.290) -- 0:00:50

      Average standard deviation of split frequencies: 0.020855

      240500 -- (-766.196) [-767.969] (-766.550) (-767.018) * [-765.620] (-766.468) (-768.223) (-768.647) -- 0:00:50
      241000 -- [-764.771] (-772.569) (-768.062) (-766.586) * [-769.144] (-766.584) (-768.145) (-770.291) -- 0:00:50
      241500 -- (-767.323) (-765.597) [-766.245] (-767.669) * (-767.232) (-767.209) (-767.148) [-765.997] -- 0:00:50
      242000 -- (-764.113) (-766.606) (-769.569) [-766.753] * [-766.121] (-765.856) (-767.460) (-766.679) -- 0:00:50
      242500 -- [-765.234] (-764.767) (-768.401) (-767.250) * [-765.272] (-766.157) (-767.428) (-766.975) -- 0:00:49
      243000 -- (-767.045) [-766.905] (-767.200) (-766.922) * (-764.745) (-770.536) (-766.156) [-769.169] -- 0:00:49
      243500 -- (-766.553) [-764.642] (-766.763) (-767.424) * (-764.110) (-765.983) [-766.519] (-771.098) -- 0:00:49
      244000 -- (-765.625) (-766.295) (-767.587) [-766.413] * (-768.225) [-764.595] (-764.687) (-769.261) -- 0:00:49
      244500 -- (-770.670) [-766.642] (-768.118) (-767.876) * (-769.331) (-765.700) (-767.461) [-766.114] -- 0:00:49
      245000 -- [-765.900] (-769.217) (-766.976) (-767.467) * [-769.582] (-766.992) (-769.096) (-766.092) -- 0:00:49

      Average standard deviation of split frequencies: 0.019163

      245500 -- (-767.993) [-768.598] (-765.642) (-769.155) * (-768.220) (-765.253) (-769.572) [-766.457] -- 0:00:49
      246000 -- (-764.993) [-765.329] (-766.713) (-767.426) * (-764.989) [-767.069] (-768.622) (-767.653) -- 0:00:49
      246500 -- (-766.409) (-768.736) (-768.091) [-773.099] * (-768.309) [-765.105] (-768.204) (-769.367) -- 0:00:48
      247000 -- (-764.564) (-770.763) (-767.407) [-768.832] * [-764.966] (-765.017) (-768.786) (-767.889) -- 0:00:48
      247500 -- (-766.423) [-767.486] (-767.540) (-768.840) * (-767.506) [-764.866] (-769.054) (-765.852) -- 0:00:48
      248000 -- (-768.010) [-766.420] (-767.718) (-768.925) * (-765.727) [-764.412] (-767.557) (-764.869) -- 0:00:48
      248500 -- (-768.347) [-767.353] (-770.146) (-770.731) * (-765.159) (-770.694) [-767.440] (-773.969) -- 0:00:48
      249000 -- [-767.060] (-766.978) (-767.807) (-766.279) * (-764.542) [-767.635] (-767.613) (-765.097) -- 0:00:51
      249500 -- (-767.187) [-767.752] (-768.111) (-767.970) * (-768.360) (-766.980) (-766.893) [-767.481] -- 0:00:51
      250000 -- (-767.651) [-766.925] (-764.316) (-768.566) * (-769.080) (-763.573) (-766.915) [-767.771] -- 0:00:51

      Average standard deviation of split frequencies: 0.019691

      250500 -- [-768.644] (-766.579) (-774.239) (-766.155) * (-769.264) [-770.281] (-767.151) (-768.702) -- 0:00:50
      251000 -- (-765.847) [-767.813] (-770.531) (-770.967) * (-767.984) (-765.225) (-765.108) [-768.549] -- 0:00:50
      251500 -- (-766.385) [-766.589] (-766.466) (-768.064) * (-766.615) (-765.867) [-765.625] (-767.404) -- 0:00:50
      252000 -- (-766.986) [-766.206] (-767.306) (-765.797) * (-768.320) [-766.307] (-766.290) (-767.649) -- 0:00:50
      252500 -- (-768.528) (-766.035) [-766.773] (-767.397) * (-766.975) (-764.605) (-766.015) [-767.467] -- 0:00:50
      253000 -- (-768.148) (-766.141) [-769.236] (-765.964) * (-767.163) [-764.815] (-769.233) (-764.353) -- 0:00:50
      253500 -- (-767.972) (-766.054) [-771.205] (-765.613) * (-766.239) [-764.462] (-766.832) (-766.359) -- 0:00:50
      254000 -- (-768.326) (-766.026) (-768.192) [-766.470] * (-765.651) (-766.343) (-766.945) [-766.617] -- 0:00:49
      254500 -- (-773.251) [-766.525] (-769.385) (-766.656) * (-768.206) (-766.839) (-766.184) [-765.700] -- 0:00:49
      255000 -- (-767.127) [-770.170] (-767.999) (-767.462) * [-767.577] (-765.360) (-765.688) (-766.318) -- 0:00:49

      Average standard deviation of split frequencies: 0.018619

      255500 -- (-766.922) [-767.160] (-765.780) (-767.020) * (-768.302) [-764.133] (-766.666) (-766.275) -- 0:00:49
      256000 -- (-767.277) [-766.948] (-765.445) (-767.543) * (-766.743) (-765.414) (-767.785) [-765.195] -- 0:00:49
      256500 -- (-766.478) (-766.650) [-766.452] (-766.266) * [-766.659] (-767.807) (-768.921) (-768.647) -- 0:00:49
      257000 -- [-766.667] (-768.771) (-766.450) (-766.804) * (-766.271) (-765.863) (-767.138) [-768.057] -- 0:00:49
      257500 -- (-768.310) (-770.860) [-766.614] (-768.358) * (-767.640) (-764.663) (-764.949) [-766.494] -- 0:00:49
      258000 -- (-767.356) (-770.631) [-765.733] (-770.792) * (-765.805) (-766.998) (-769.157) [-765.818] -- 0:00:48
      258500 -- (-766.617) [-766.424] (-765.783) (-768.805) * (-768.265) (-765.710) (-765.285) [-766.180] -- 0:00:48
      259000 -- (-766.828) (-767.523) [-768.776] (-766.809) * [-768.427] (-767.589) (-767.701) (-766.100) -- 0:00:48
      259500 -- [-767.091] (-763.922) (-770.556) (-771.147) * (-768.764) (-767.411) (-765.848) [-766.248] -- 0:00:48
      260000 -- [-768.273] (-768.957) (-775.825) (-768.275) * (-769.562) [-770.657] (-767.242) (-769.702) -- 0:00:48

      Average standard deviation of split frequencies: 0.017281

      260500 -- (-768.053) (-767.834) [-764.767] (-767.530) * (-767.589) [-771.653] (-769.077) (-772.330) -- 0:00:48
      261000 -- (-768.490) (-767.067) [-766.777] (-767.773) * (-765.452) (-768.568) (-768.427) [-768.659] -- 0:00:48
      261500 -- (-770.521) [-767.407] (-767.437) (-767.132) * (-768.941) (-766.324) [-767.330] (-769.962) -- 0:00:48
      262000 -- (-769.800) [-767.841] (-766.679) (-768.295) * [-764.919] (-767.013) (-769.364) (-767.803) -- 0:00:47
      262500 -- [-766.435] (-764.883) (-768.488) (-768.038) * (-765.277) (-767.487) [-765.239] (-767.233) -- 0:00:47
      263000 -- (-765.036) [-763.600] (-772.852) (-766.708) * (-764.977) [-764.996] (-768.838) (-769.338) -- 0:00:47
      263500 -- (-772.227) (-765.850) [-770.363] (-766.561) * (-765.830) [-765.153] (-768.503) (-768.497) -- 0:00:47
      264000 -- (-769.563) [-766.639] (-765.986) (-769.122) * (-766.545) (-767.535) (-765.889) [-768.461] -- 0:00:47
      264500 -- (-764.283) (-767.835) (-767.199) [-767.627] * (-767.253) (-769.267) [-764.905] (-770.351) -- 0:00:50
      265000 -- [-765.894] (-765.002) (-769.264) (-768.551) * [-766.147] (-770.914) (-768.773) (-772.327) -- 0:00:49

      Average standard deviation of split frequencies: 0.017131

      265500 -- [-765.702] (-767.835) (-767.290) (-767.172) * [-764.897] (-766.103) (-769.778) (-766.675) -- 0:00:49
      266000 -- (-770.117) (-765.646) [-767.784] (-767.282) * (-767.365) (-765.922) (-771.381) [-766.632] -- 0:00:49
      266500 -- (-767.724) (-765.328) [-765.267] (-766.579) * (-766.573) (-764.986) (-766.960) [-765.144] -- 0:00:49
      267000 -- [-767.237] (-765.099) (-769.551) (-768.359) * (-766.625) (-766.706) (-769.207) [-764.437] -- 0:00:49
      267500 -- (-769.847) (-770.563) [-768.690] (-769.017) * (-767.028) (-766.276) (-766.102) [-769.231] -- 0:00:49
      268000 -- (-766.923) [-765.871] (-766.823) (-768.174) * (-767.248) [-765.255] (-768.429) (-769.049) -- 0:00:49
      268500 -- (-767.379) [-765.474] (-767.205) (-765.610) * (-766.733) (-767.266) (-769.565) [-768.490] -- 0:00:49
      269000 -- (-768.486) (-764.654) [-766.518] (-767.315) * (-766.990) [-767.781] (-770.975) (-767.522) -- 0:00:48
      269500 -- (-769.519) [-765.078] (-770.724) (-770.389) * [-767.292] (-772.149) (-766.106) (-768.223) -- 0:00:48
      270000 -- (-767.127) (-763.845) [-766.596] (-765.402) * [-767.824] (-768.351) (-765.149) (-770.670) -- 0:00:48

      Average standard deviation of split frequencies: 0.017852

      270500 -- (-767.107) (-764.633) [-766.590] (-769.679) * (-766.238) [-767.121] (-767.480) (-768.234) -- 0:00:48
      271000 -- (-765.862) [-765.787] (-768.351) (-768.961) * (-767.835) [-768.988] (-766.046) (-767.929) -- 0:00:48
      271500 -- (-769.737) (-766.713) (-767.721) [-772.095] * [-767.955] (-765.869) (-767.528) (-765.344) -- 0:00:48
      272000 -- (-771.749) (-767.508) (-767.392) [-766.426] * (-770.956) [-766.386] (-765.622) (-765.851) -- 0:00:48
      272500 -- [-767.192] (-767.031) (-766.987) (-766.198) * (-770.111) (-766.569) (-767.747) [-766.564] -- 0:00:48
      273000 -- (-766.020) (-765.698) [-767.533] (-768.295) * (-769.428) (-766.660) (-769.420) [-767.558] -- 0:00:47
      273500 -- (-766.831) [-764.275] (-766.087) (-766.820) * (-768.287) [-765.780] (-768.722) (-767.944) -- 0:00:47
      274000 -- (-766.852) [-766.647] (-768.683) (-765.955) * (-769.505) (-765.860) [-768.365] (-766.825) -- 0:00:47
      274500 -- [-766.445] (-765.551) (-767.296) (-768.250) * (-767.969) (-766.494) (-767.190) [-765.675] -- 0:00:47
      275000 -- (-766.201) (-774.267) (-767.017) [-769.617] * (-769.754) [-768.256] (-765.453) (-768.402) -- 0:00:47

      Average standard deviation of split frequencies: 0.018147

      275500 -- (-767.250) [-768.154] (-765.104) (-767.388) * [-767.529] (-766.957) (-767.902) (-767.236) -- 0:00:47
      276000 -- (-767.930) (-765.274) (-767.291) [-766.829] * (-767.669) (-767.329) [-765.142] (-766.732) -- 0:00:47
      276500 -- (-769.870) [-764.917] (-768.902) (-767.733) * (-769.554) (-764.734) [-765.390] (-766.883) -- 0:00:47
      277000 -- (-765.862) (-766.201) (-769.081) [-768.398] * (-768.612) (-768.933) [-765.992] (-767.198) -- 0:00:46
      277500 -- (-766.072) (-765.466) [-766.389] (-767.268) * (-767.006) (-768.446) (-767.282) [-770.336] -- 0:00:46
      278000 -- [-764.615] (-765.579) (-765.563) (-768.808) * (-765.955) (-767.575) (-767.476) [-768.930] -- 0:00:46
      278500 -- [-769.109] (-766.082) (-765.698) (-773.839) * (-766.077) [-769.209] (-765.419) (-768.527) -- 0:00:46
      279000 -- [-765.397] (-765.681) (-765.497) (-767.753) * (-768.777) (-767.750) (-766.675) [-766.641] -- 0:00:46
      279500 -- [-766.064] (-767.496) (-765.110) (-771.999) * (-766.515) (-768.089) [-766.699] (-768.532) -- 0:00:46
      280000 -- (-769.544) [-765.712] (-764.502) (-768.151) * (-772.665) [-768.083] (-769.633) (-769.661) -- 0:00:48

      Average standard deviation of split frequencies: 0.017586

      280500 -- (-769.840) [-764.594] (-765.476) (-766.782) * (-772.988) (-767.272) (-767.504) [-769.555] -- 0:00:48
      281000 -- (-773.021) (-768.366) (-770.405) [-766.492] * (-767.652) (-765.951) [-767.591] (-764.352) -- 0:00:48
      281500 -- (-769.835) [-767.138] (-770.024) (-770.365) * (-768.238) (-766.043) (-768.044) [-766.364] -- 0:00:48
      282000 -- (-769.116) (-767.985) [-765.249] (-767.375) * [-764.325] (-766.098) (-766.888) (-766.666) -- 0:00:48
      282500 -- (-767.129) (-768.671) [-766.847] (-770.348) * (-767.221) (-766.661) [-770.387] (-773.773) -- 0:00:48
      283000 -- (-767.159) (-773.203) [-764.429] (-766.233) * [-768.521] (-769.888) (-767.497) (-768.025) -- 0:00:48
      283500 -- [-766.567] (-765.655) (-763.647) (-766.499) * (-769.340) [-772.566] (-766.683) (-768.493) -- 0:00:48
      284000 -- [-767.117] (-773.338) (-765.922) (-771.052) * [-767.941] (-765.361) (-766.642) (-768.962) -- 0:00:47
      284500 -- (-764.532) (-769.933) (-765.078) [-764.457] * (-767.691) (-766.722) [-769.659] (-766.359) -- 0:00:47
      285000 -- (-767.898) (-767.955) [-765.935] (-766.015) * [-767.667] (-766.333) (-769.534) (-767.749) -- 0:00:47

      Average standard deviation of split frequencies: 0.017937

      285500 -- (-767.848) (-765.724) (-768.446) [-766.392] * (-767.558) [-767.122] (-768.688) (-766.197) -- 0:00:47
      286000 -- (-768.520) [-765.096] (-768.560) (-765.479) * [-766.779] (-768.021) (-769.538) (-764.339) -- 0:00:47
      286500 -- (-768.010) (-765.955) [-766.959] (-764.583) * [-766.741] (-770.737) (-770.988) (-765.281) -- 0:00:47
      287000 -- (-771.084) [-768.723] (-765.887) (-766.386) * (-766.226) (-767.780) [-766.505] (-767.430) -- 0:00:47
      287500 -- [-768.769] (-766.307) (-772.864) (-766.698) * (-769.233) (-768.442) [-765.622] (-767.850) -- 0:00:47
      288000 -- (-765.523) [-767.585] (-767.726) (-770.417) * (-764.089) (-765.155) (-765.581) [-764.869] -- 0:00:46
      288500 -- (-766.472) [-766.495] (-766.275) (-766.982) * (-766.026) (-767.502) [-768.043] (-766.360) -- 0:00:46
      289000 -- [-764.840] (-767.098) (-768.481) (-768.279) * (-765.555) (-765.537) (-765.885) [-766.478] -- 0:00:46
      289500 -- [-765.250] (-767.557) (-766.991) (-764.412) * [-767.717] (-766.606) (-766.661) (-766.316) -- 0:00:46
      290000 -- (-768.110) (-770.665) [-765.159] (-767.691) * (-765.907) [-768.248] (-766.552) (-765.845) -- 0:00:46

      Average standard deviation of split frequencies: 0.017458

      290500 -- (-771.317) (-769.496) [-768.387] (-767.806) * [-769.095] (-768.453) (-767.381) (-768.036) -- 0:00:46
      291000 -- [-764.839] (-767.657) (-765.069) (-767.267) * [-767.767] (-765.735) (-767.164) (-766.077) -- 0:00:46
      291500 -- [-765.078] (-767.140) (-766.481) (-767.797) * (-768.016) (-767.825) (-767.096) [-766.414] -- 0:00:46
      292000 -- (-767.642) (-773.599) (-767.053) [-772.732] * (-765.479) (-766.125) [-766.331] (-765.290) -- 0:00:46
      292500 -- (-767.470) (-768.101) (-763.914) [-767.029] * (-768.844) [-764.963] (-764.396) (-767.587) -- 0:00:45
      293000 -- (-768.479) (-766.546) [-767.707] (-769.715) * (-769.875) (-769.090) [-767.738] (-769.039) -- 0:00:45
      293500 -- (-766.679) [-763.620] (-767.464) (-769.231) * (-767.432) (-768.235) (-769.892) [-767.115] -- 0:00:45
      294000 -- [-766.896] (-765.710) (-768.795) (-776.272) * (-766.003) (-774.527) (-764.833) [-767.113] -- 0:00:45
      294500 -- (-766.879) (-766.436) [-764.761] (-766.980) * (-766.687) [-768.939] (-765.837) (-771.876) -- 0:00:45
      295000 -- [-766.103] (-768.129) (-764.837) (-766.922) * (-766.682) (-766.522) [-765.657] (-769.754) -- 0:00:45

      Average standard deviation of split frequencies: 0.016368

      295500 -- [-767.719] (-766.798) (-767.390) (-767.742) * (-766.126) (-765.035) (-767.350) [-767.441] -- 0:00:47
      296000 -- (-764.969) [-766.607] (-767.601) (-767.859) * (-763.551) (-770.734) [-771.385] (-772.606) -- 0:00:47
      296500 -- (-767.271) (-768.092) [-766.559] (-766.761) * [-764.362] (-766.972) (-768.775) (-765.547) -- 0:00:47
      297000 -- [-766.774] (-766.825) (-766.021) (-766.578) * (-766.251) (-768.285) (-768.220) [-765.247] -- 0:00:47
      297500 -- (-765.718) [-764.620] (-766.240) (-767.430) * [-763.704] (-763.838) (-765.525) (-765.655) -- 0:00:47
      298000 -- [-767.669] (-764.224) (-764.673) (-767.233) * (-768.294) (-765.462) [-765.943] (-768.572) -- 0:00:47
      298500 -- (-765.064) [-765.868] (-765.851) (-769.581) * (-765.729) [-767.601] (-767.272) (-769.296) -- 0:00:47
      299000 -- (-768.480) (-764.959) (-763.862) [-765.845] * (-768.014) (-764.146) [-767.690] (-766.346) -- 0:00:46
      299500 -- [-768.114] (-765.187) (-766.310) (-767.206) * (-766.337) (-765.228) [-766.216] (-769.821) -- 0:00:46
      300000 -- (-768.206) [-765.765] (-769.934) (-766.293) * (-765.053) [-767.793] (-767.017) (-766.503) -- 0:00:46

      Average standard deviation of split frequencies: 0.015125

      300500 -- (-768.826) [-766.590] (-766.401) (-770.658) * (-765.477) (-768.929) (-767.416) [-769.385] -- 0:00:46
      301000 -- [-767.326] (-768.361) (-765.423) (-767.074) * (-765.746) (-767.062) (-765.145) [-769.957] -- 0:00:46
      301500 -- (-768.423) (-767.553) [-765.953] (-767.166) * (-768.577) (-767.748) (-768.110) [-765.544] -- 0:00:46
      302000 -- [-768.029] (-767.991) (-767.113) (-768.987) * [-764.317] (-766.436) (-765.093) (-766.169) -- 0:00:46
      302500 -- (-766.102) (-766.239) [-765.883] (-764.560) * (-764.741) [-768.347] (-763.773) (-767.307) -- 0:00:46
      303000 -- [-767.371] (-766.755) (-765.677) (-766.935) * (-767.027) (-765.074) [-767.567] (-766.812) -- 0:00:46
      303500 -- [-766.825] (-766.331) (-765.444) (-767.454) * (-765.496) [-766.601] (-766.518) (-768.314) -- 0:00:45
      304000 -- (-766.811) (-765.023) (-766.443) [-768.052] * (-765.532) [-766.011] (-764.434) (-770.303) -- 0:00:45
      304500 -- (-772.759) [-763.576] (-766.967) (-767.058) * (-766.614) [-766.534] (-765.595) (-770.405) -- 0:00:45
      305000 -- (-766.494) (-763.606) [-766.034] (-766.340) * (-768.253) (-768.243) [-765.720] (-765.120) -- 0:00:45

      Average standard deviation of split frequencies: 0.014550

      305500 -- (-772.298) [-764.968] (-763.649) (-767.846) * (-771.234) (-769.604) [-765.892] (-766.891) -- 0:00:45
      306000 -- (-767.463) (-769.236) (-764.677) [-766.602] * (-763.993) (-769.662) [-767.185] (-767.728) -- 0:00:45
      306500 -- [-764.990] (-767.952) (-766.123) (-767.085) * [-766.013] (-770.106) (-766.247) (-766.610) -- 0:00:45
      307000 -- (-766.408) (-765.530) [-765.369] (-766.702) * (-768.792) [-766.349] (-764.632) (-768.877) -- 0:00:45
      307500 -- [-764.889] (-767.209) (-765.489) (-767.762) * (-765.584) [-766.145] (-766.214) (-768.643) -- 0:00:45
      308000 -- (-765.584) (-767.640) (-767.216) [-765.796] * (-766.998) (-771.203) (-766.787) [-767.492] -- 0:00:44
      308500 -- (-766.969) [-769.222] (-767.791) (-765.250) * (-768.153) (-768.246) (-770.344) [-763.545] -- 0:00:44
      309000 -- [-766.883] (-766.950) (-767.063) (-769.086) * (-765.478) (-764.843) [-765.652] (-772.879) -- 0:00:44
      309500 -- (-768.006) (-765.411) [-767.019] (-768.996) * (-770.288) (-766.270) (-764.062) [-765.634] -- 0:00:44
      310000 -- (-769.080) [-765.283] (-767.380) (-768.032) * [-764.458] (-768.977) (-766.181) (-765.812) -- 0:00:44

      Average standard deviation of split frequencies: 0.014752

      310500 -- (-769.126) (-765.797) (-766.532) [-764.849] * (-770.840) (-765.741) (-767.992) [-764.198] -- 0:00:44
      311000 -- (-768.286) (-763.116) (-766.208) [-767.114] * (-767.049) [-770.693] (-776.496) (-765.424) -- 0:00:46
      311500 -- [-768.451] (-767.034) (-766.520) (-768.878) * (-771.429) [-768.579] (-766.739) (-763.941) -- 0:00:46
      312000 -- (-766.276) (-765.994) (-766.277) [-767.733] * (-765.688) [-768.378] (-767.426) (-768.170) -- 0:00:46
      312500 -- (-766.560) [-771.161] (-768.873) (-765.610) * (-765.454) (-776.086) [-765.046] (-768.576) -- 0:00:46
      313000 -- (-767.159) (-765.788) [-767.751] (-769.814) * [-762.490] (-766.317) (-765.362) (-765.650) -- 0:00:46
      313500 -- (-768.612) (-769.958) (-766.215) [-768.777] * (-765.939) [-766.299] (-766.842) (-766.283) -- 0:00:45
      314000 -- [-766.781] (-771.817) (-768.890) (-767.282) * (-764.905) (-768.335) (-765.624) [-770.515] -- 0:00:45
      314500 -- [-768.851] (-766.599) (-767.313) (-765.212) * [-766.333] (-768.188) (-764.878) (-766.898) -- 0:00:45
      315000 -- (-765.700) (-767.670) (-766.773) [-766.048] * [-766.111] (-767.377) (-768.572) (-767.393) -- 0:00:45

      Average standard deviation of split frequencies: 0.014742

      315500 -- (-769.997) [-768.844] (-765.122) (-768.091) * [-765.718] (-764.554) (-767.283) (-767.785) -- 0:00:45
      316000 -- [-768.383] (-770.003) (-763.722) (-764.640) * (-766.271) (-767.061) (-773.486) [-765.529] -- 0:00:45
      316500 -- (-765.959) (-764.978) (-765.861) [-765.788] * (-765.905) (-767.289) (-769.535) [-764.505] -- 0:00:45
      317000 -- (-768.294) (-769.232) [-766.740] (-763.891) * [-775.422] (-767.372) (-768.252) (-764.423) -- 0:00:45
      317500 -- (-769.220) (-767.085) (-770.282) [-763.893] * (-770.990) [-766.785] (-768.554) (-771.310) -- 0:00:45
      318000 -- (-768.303) (-766.526) [-767.457] (-765.843) * (-769.726) (-767.402) (-769.548) [-772.205] -- 0:00:45
      318500 -- [-771.245] (-766.389) (-770.603) (-766.093) * (-772.900) (-767.710) (-766.238) [-767.356] -- 0:00:44
      319000 -- (-767.019) (-769.755) (-767.140) [-766.717] * [-769.520] (-767.859) (-765.427) (-766.561) -- 0:00:44
      319500 -- (-765.194) (-766.121) (-769.767) [-765.826] * (-766.518) [-764.781] (-769.038) (-765.066) -- 0:00:44
      320000 -- (-766.949) [-767.475] (-768.349) (-765.964) * (-765.882) [-764.447] (-766.950) (-764.978) -- 0:00:44

      Average standard deviation of split frequencies: 0.014095

      320500 -- (-765.907) (-766.144) (-766.593) [-768.206] * (-767.605) [-765.635] (-771.318) (-767.144) -- 0:00:44
      321000 -- (-766.297) [-765.851] (-766.489) (-768.701) * (-765.941) (-767.773) [-767.369] (-766.362) -- 0:00:44
      321500 -- (-765.524) (-771.688) [-767.282] (-768.993) * (-766.444) [-766.191] (-766.984) (-766.486) -- 0:00:44
      322000 -- (-767.135) [-763.978] (-767.124) (-766.490) * (-765.710) [-767.141] (-769.777) (-766.597) -- 0:00:44
      322500 -- (-769.350) [-766.044] (-766.629) (-766.756) * (-766.730) [-763.810] (-767.109) (-766.908) -- 0:00:44
      323000 -- (-765.542) [-766.559] (-766.781) (-768.456) * (-765.743) [-764.827] (-767.993) (-766.350) -- 0:00:44
      323500 -- (-766.066) [-765.131] (-767.466) (-767.317) * (-769.722) (-767.176) (-771.592) [-766.334] -- 0:00:43
      324000 -- (-771.839) [-767.150] (-767.966) (-770.312) * (-768.146) (-769.275) (-771.439) [-767.340] -- 0:00:43
      324500 -- (-770.108) (-767.595) (-767.070) [-768.415] * (-767.985) [-770.756] (-766.564) (-768.236) -- 0:00:43
      325000 -- (-766.415) [-767.672] (-765.830) (-769.385) * (-764.479) [-768.501] (-766.454) (-766.902) -- 0:00:43

      Average standard deviation of split frequencies: 0.013354

      325500 -- (-764.795) (-764.760) [-765.948] (-766.114) * (-766.179) (-767.486) [-768.736] (-769.862) -- 0:00:43
      326000 -- (-768.619) (-766.597) [-764.731] (-765.239) * [-768.955] (-764.753) (-766.868) (-772.166) -- 0:00:43
      326500 -- (-765.204) (-767.140) [-766.731] (-768.769) * (-764.810) [-764.497] (-766.365) (-771.191) -- 0:00:45
      327000 -- [-765.773] (-769.772) (-764.940) (-770.157) * (-764.138) (-763.849) [-767.921] (-768.340) -- 0:00:45
      327500 -- [-767.274] (-767.876) (-770.465) (-768.653) * (-766.327) [-765.168] (-765.415) (-767.951) -- 0:00:45
      328000 -- (-767.118) (-766.956) [-770.949] (-766.202) * (-765.817) (-766.777) (-768.007) [-766.214] -- 0:00:45
      328500 -- [-766.045] (-768.062) (-767.060) (-765.293) * (-765.458) [-767.000] (-764.725) (-766.746) -- 0:00:44
      329000 -- (-770.311) (-768.512) (-767.791) [-766.674] * (-765.991) (-764.076) [-764.601] (-767.899) -- 0:00:44
      329500 -- (-767.180) [-766.341] (-767.441) (-764.900) * (-766.285) [-766.575] (-766.977) (-766.464) -- 0:00:44
      330000 -- (-768.174) (-770.416) [-765.281] (-769.016) * (-767.590) [-765.389] (-766.321) (-771.814) -- 0:00:44

      Average standard deviation of split frequencies: 0.013418

      330500 -- (-772.119) [-768.225] (-772.174) (-767.228) * (-768.356) (-766.149) (-764.749) [-769.410] -- 0:00:44
      331000 -- (-768.886) (-766.433) (-766.365) [-767.039] * (-765.850) (-769.123) (-768.262) [-768.600] -- 0:00:44
      331500 -- [-765.240] (-767.106) (-765.700) (-768.846) * (-764.768) (-768.607) (-767.486) [-767.743] -- 0:00:44
      332000 -- (-768.269) [-768.593] (-767.377) (-768.277) * (-769.657) [-766.745] (-766.599) (-766.261) -- 0:00:44
      332500 -- [-766.899] (-766.013) (-766.716) (-766.296) * (-767.748) (-770.760) (-765.989) [-766.872] -- 0:00:44
      333000 -- (-766.891) (-771.329) [-766.181] (-767.474) * (-766.978) [-768.034] (-766.241) (-766.499) -- 0:00:44
      333500 -- (-766.464) (-766.100) [-767.671] (-767.722) * (-766.766) [-765.338] (-768.165) (-767.135) -- 0:00:43
      334000 -- (-766.676) (-767.814) (-767.430) [-765.896] * (-768.362) (-769.189) [-767.306] (-765.466) -- 0:00:43
      334500 -- [-766.911] (-766.735) (-766.700) (-766.700) * (-766.988) [-767.451] (-769.122) (-765.946) -- 0:00:43
      335000 -- [-765.063] (-767.689) (-766.925) (-766.210) * (-767.642) [-766.122] (-766.914) (-767.480) -- 0:00:43

      Average standard deviation of split frequencies: 0.013452

      335500 -- (-764.368) (-766.202) (-766.875) [-765.771] * (-769.673) (-765.957) (-766.690) [-766.383] -- 0:00:43
      336000 -- (-766.946) [-770.039] (-770.840) (-766.799) * (-767.375) (-768.280) [-766.369] (-766.022) -- 0:00:43
      336500 -- (-764.884) (-766.869) (-768.143) [-766.830] * [-765.738] (-766.679) (-768.305) (-766.471) -- 0:00:43
      337000 -- [-763.971] (-768.828) (-765.296) (-767.160) * [-765.857] (-764.957) (-767.368) (-767.247) -- 0:00:43
      337500 -- (-765.328) [-765.815] (-767.946) (-766.319) * (-765.875) (-765.556) (-768.037) [-767.030] -- 0:00:43
      338000 -- (-767.202) (-763.763) (-768.029) [-766.383] * [-767.014] (-766.877) (-766.554) (-765.598) -- 0:00:43
      338500 -- [-767.385] (-766.549) (-768.373) (-767.120) * [-764.296] (-766.256) (-764.488) (-767.484) -- 0:00:42
      339000 -- (-766.319) [-768.947] (-774.215) (-766.838) * (-774.208) [-765.884] (-769.140) (-766.306) -- 0:00:42
      339500 -- [-765.074] (-768.372) (-766.778) (-767.435) * [-765.995] (-765.907) (-767.840) (-771.272) -- 0:00:42
      340000 -- (-766.458) (-767.268) [-767.640] (-767.512) * [-767.842] (-763.822) (-763.954) (-768.257) -- 0:00:42

      Average standard deviation of split frequencies: 0.012047

      340500 -- (-767.640) [-766.754] (-772.119) (-766.760) * (-766.712) [-767.464] (-766.056) (-765.129) -- 0:00:42
      341000 -- (-767.755) (-769.953) (-767.990) [-766.653] * (-764.635) (-768.268) (-767.064) [-764.040] -- 0:00:42
      341500 -- (-767.398) [-767.582] (-768.210) (-769.558) * (-766.065) [-766.292] (-765.427) (-764.353) -- 0:00:42
      342000 -- (-767.013) (-764.915) [-767.975] (-765.352) * (-763.178) (-765.522) [-765.893] (-765.532) -- 0:00:44
      342500 -- (-770.037) [-766.663] (-771.176) (-768.805) * (-765.252) [-766.929] (-766.698) (-763.392) -- 0:00:44
      343000 -- (-769.802) [-766.512] (-766.656) (-767.813) * (-769.754) (-771.934) (-763.613) [-764.422] -- 0:00:44
      343500 -- (-768.818) (-766.043) (-766.989) [-770.358] * (-764.112) (-767.861) (-766.282) [-769.455] -- 0:00:43
      344000 -- [-766.789] (-766.202) (-768.033) (-767.588) * (-767.096) (-768.408) [-765.540] (-769.337) -- 0:00:43
      344500 -- [-766.214] (-766.650) (-770.708) (-767.137) * (-766.763) (-768.257) (-764.330) [-767.276] -- 0:00:43
      345000 -- [-765.376] (-766.196) (-770.238) (-768.609) * (-764.852) (-768.228) [-764.649] (-767.817) -- 0:00:43

      Average standard deviation of split frequencies: 0.011461

      345500 -- (-766.021) (-764.675) (-765.733) [-767.503] * (-766.633) (-766.330) (-764.295) [-767.747] -- 0:00:43
      346000 -- (-766.119) (-765.037) [-768.463] (-770.904) * [-766.016] (-767.093) (-767.756) (-764.996) -- 0:00:43
      346500 -- (-766.534) [-765.714] (-768.889) (-770.738) * (-769.767) [-767.873] (-765.273) (-767.419) -- 0:00:43
      347000 -- [-764.563] (-764.278) (-769.092) (-769.120) * [-763.404] (-767.446) (-766.114) (-767.513) -- 0:00:43
      347500 -- (-765.309) (-767.169) [-765.371] (-769.760) * (-769.076) [-765.040] (-769.272) (-771.327) -- 0:00:43
      348000 -- (-765.823) [-764.940] (-770.026) (-766.803) * [-766.903] (-765.806) (-765.595) (-765.279) -- 0:00:43
      348500 -- (-764.349) (-769.546) (-771.602) [-766.319] * (-765.902) (-765.916) (-766.357) [-767.598] -- 0:00:42
      349000 -- [-766.099] (-772.840) (-766.721) (-770.120) * (-765.224) (-767.054) (-766.685) [-767.034] -- 0:00:42
      349500 -- (-771.484) (-767.236) [-768.940] (-768.454) * (-770.940) (-767.195) (-766.709) [-766.538] -- 0:00:42
      350000 -- [-767.534] (-767.616) (-768.658) (-767.494) * (-766.077) [-767.363] (-766.222) (-765.347) -- 0:00:42

      Average standard deviation of split frequencies: 0.011007

      350500 -- (-770.206) (-767.514) [-766.652] (-769.507) * (-768.100) [-764.414] (-767.737) (-765.152) -- 0:00:42
      351000 -- (-767.931) [-763.454] (-765.787) (-765.677) * (-766.937) [-766.864] (-765.009) (-767.016) -- 0:00:42
      351500 -- (-766.371) (-763.710) (-769.574) [-766.536] * (-767.752) [-765.568] (-766.684) (-768.026) -- 0:00:42
      352000 -- [-766.869] (-765.206) (-771.874) (-767.506) * (-766.229) [-766.235] (-768.119) (-765.535) -- 0:00:42
      352500 -- (-766.941) (-767.791) (-768.349) [-767.495] * (-765.871) [-766.059] (-769.479) (-765.381) -- 0:00:42
      353000 -- [-765.673] (-768.472) (-768.046) (-767.947) * (-767.150) (-770.171) (-765.587) [-768.486] -- 0:00:42
      353500 -- [-766.239] (-765.139) (-766.576) (-769.224) * (-769.033) (-764.831) [-765.022] (-764.397) -- 0:00:42
      354000 -- (-765.570) (-766.511) (-766.500) [-769.070] * (-764.448) (-769.769) [-766.977] (-765.763) -- 0:00:41
      354500 -- [-766.002] (-767.724) (-766.641) (-770.764) * (-765.913) (-770.031) [-765.676] (-765.339) -- 0:00:41
      355000 -- (-765.636) [-767.207] (-767.218) (-770.688) * [-764.314] (-766.357) (-767.819) (-766.395) -- 0:00:41

      Average standard deviation of split frequencies: 0.010905

      355500 -- [-768.508] (-767.419) (-767.940) (-769.627) * (-768.446) (-770.714) (-767.144) [-767.714] -- 0:00:41
      356000 -- (-764.488) (-766.651) [-766.550] (-768.195) * (-767.136) (-770.323) (-767.506) [-768.369] -- 0:00:41
      356500 -- (-767.468) (-764.288) [-766.360] (-767.307) * (-767.558) (-765.834) [-766.524] (-767.371) -- 0:00:41
      357000 -- (-766.779) (-765.861) [-766.277] (-765.058) * (-766.380) (-773.180) [-766.892] (-766.564) -- 0:00:41
      357500 -- [-766.208] (-765.141) (-766.243) (-767.136) * (-765.005) [-767.173] (-765.954) (-766.516) -- 0:00:43
      358000 -- [-765.543] (-774.418) (-766.987) (-766.690) * (-767.775) (-766.339) (-768.706) [-766.620] -- 0:00:43
      358500 -- [-766.124] (-767.472) (-765.520) (-765.531) * (-764.936) (-766.079) [-766.333] (-766.108) -- 0:00:42
      359000 -- (-767.332) (-767.439) (-767.336) [-767.601] * [-763.418] (-765.377) (-766.343) (-764.767) -- 0:00:42
      359500 -- [-766.032] (-765.795) (-766.787) (-774.998) * (-765.861) [-766.009] (-769.891) (-766.216) -- 0:00:42
      360000 -- [-764.125] (-766.177) (-765.698) (-768.316) * (-766.905) (-767.600) (-767.490) [-766.262] -- 0:00:42

      Average standard deviation of split frequencies: 0.010918

      360500 -- (-767.620) [-764.374] (-771.894) (-771.263) * (-766.996) [-772.406] (-765.488) (-768.382) -- 0:00:42
      361000 -- (-768.477) (-764.584) (-769.282) [-768.720] * (-767.608) (-767.885) [-766.105] (-764.164) -- 0:00:42
      361500 -- (-765.851) (-767.843) [-766.486] (-765.571) * (-767.660) [-771.687] (-770.057) (-763.926) -- 0:00:42
      362000 -- (-768.035) (-766.650) [-768.461] (-766.964) * (-767.343) (-774.083) (-771.171) [-764.165] -- 0:00:42
      362500 -- (-766.936) (-764.781) (-767.401) [-769.061] * (-767.268) (-772.521) (-768.014) [-765.605] -- 0:00:42
      363000 -- (-764.860) (-765.001) (-767.077) [-765.391] * (-764.329) (-771.790) (-769.546) [-764.029] -- 0:00:42
      363500 -- [-767.868] (-765.294) (-766.388) (-768.064) * (-766.610) (-766.650) [-765.628] (-764.519) -- 0:00:42
      364000 -- (-765.402) (-765.158) (-765.762) [-765.392] * (-768.372) (-767.295) [-765.004] (-765.197) -- 0:00:41
      364500 -- (-769.006) (-765.690) (-766.064) [-773.702] * [-768.906] (-769.377) (-771.472) (-766.974) -- 0:00:41
      365000 -- (-770.755) [-764.640] (-766.911) (-766.026) * [-766.920] (-767.604) (-767.104) (-768.217) -- 0:00:41

      Average standard deviation of split frequencies: 0.011019

      365500 -- (-768.703) (-768.422) (-767.208) [-767.763] * [-765.833] (-767.663) (-766.400) (-767.737) -- 0:00:41
      366000 -- (-767.395) (-765.436) (-767.598) [-767.210] * (-771.999) (-767.754) (-766.325) [-767.229] -- 0:00:41
      366500 -- (-766.006) (-764.672) [-765.630] (-769.004) * (-766.774) (-766.560) (-765.536) [-767.317] -- 0:00:41
      367000 -- (-767.072) (-763.863) (-765.698) [-768.451] * (-770.545) (-765.464) [-766.035] (-768.430) -- 0:00:41
      367500 -- [-764.971] (-767.392) (-766.619) (-766.436) * (-764.272) (-768.521) (-772.499) [-767.412] -- 0:00:41
      368000 -- (-769.194) (-767.619) [-766.134] (-767.590) * [-765.426] (-766.629) (-770.799) (-768.229) -- 0:00:41
      368500 -- [-766.230] (-766.812) (-767.140) (-766.638) * (-769.680) (-767.085) [-767.447] (-771.791) -- 0:00:41
      369000 -- [-764.288] (-765.938) (-767.674) (-768.317) * (-769.156) [-766.732] (-768.103) (-773.766) -- 0:00:41
      369500 -- (-764.178) [-763.928] (-767.390) (-766.303) * [-769.294] (-766.348) (-768.191) (-766.830) -- 0:00:40
      370000 -- (-765.910) (-767.043) [-767.428] (-768.666) * [-768.161] (-766.968) (-766.707) (-767.089) -- 0:00:40

      Average standard deviation of split frequencies: 0.010739

      370500 -- (-768.600) (-767.358) (-766.950) [-766.948] * (-770.505) [-767.715] (-766.317) (-767.133) -- 0:00:40
      371000 -- [-768.626] (-766.750) (-766.567) (-779.775) * [-769.869] (-768.912) (-766.483) (-767.423) -- 0:00:40
      371500 -- (-769.268) (-768.518) [-766.813] (-768.062) * (-765.105) (-769.251) (-769.037) [-767.499] -- 0:00:40
      372000 -- (-765.534) (-768.983) (-765.157) [-767.272] * (-769.560) (-770.924) (-766.429) [-764.742] -- 0:00:40
      372500 -- (-769.253) (-770.042) [-765.110] (-768.002) * (-766.986) (-765.481) (-768.907) [-766.585] -- 0:00:40
      373000 -- (-766.348) (-763.951) [-764.678] (-769.427) * (-766.102) [-770.360] (-767.084) (-767.579) -- 0:00:42
      373500 -- (-768.930) (-766.886) [-764.814] (-766.822) * (-767.764) [-768.504] (-770.778) (-770.225) -- 0:00:41
      374000 -- (-765.177) (-766.597) (-766.548) [-773.049] * (-771.218) [-770.921] (-770.817) (-767.313) -- 0:00:41
      374500 -- (-768.015) (-767.420) (-767.994) [-768.665] * (-766.028) [-767.664] (-770.719) (-768.579) -- 0:00:41
      375000 -- (-766.848) (-770.183) [-766.399] (-768.186) * [-764.099] (-769.386) (-770.755) (-767.066) -- 0:00:41

      Average standard deviation of split frequencies: 0.011800

      375500 -- [-764.141] (-767.064) (-765.633) (-767.467) * [-766.608] (-768.515) (-768.335) (-772.759) -- 0:00:41
      376000 -- (-767.343) (-768.151) (-766.617) [-768.008] * [-766.906] (-770.182) (-768.619) (-771.080) -- 0:00:41
      376500 -- [-769.105] (-766.505) (-765.951) (-773.309) * (-766.394) (-768.798) (-766.704) [-767.097] -- 0:00:41
      377000 -- (-768.312) (-763.360) (-766.148) [-767.914] * (-765.568) [-767.399] (-766.156) (-768.248) -- 0:00:41
      377500 -- (-770.724) [-764.175] (-769.667) (-766.441) * (-767.897) (-767.465) (-767.853) [-764.967] -- 0:00:41
      378000 -- (-767.608) (-768.714) (-766.200) [-766.887] * (-771.894) (-772.521) (-768.340) [-765.965] -- 0:00:41
      378500 -- (-767.517) (-766.997) (-765.081) [-771.432] * [-765.992] (-772.891) (-769.912) (-765.951) -- 0:00:41
      379000 -- (-767.980) [-765.269] (-768.107) (-766.039) * (-768.024) (-768.315) (-766.957) [-768.098] -- 0:00:40
      379500 -- (-767.922) (-763.573) [-766.367] (-766.938) * [-768.910] (-771.503) (-767.663) (-767.746) -- 0:00:40
      380000 -- (-770.395) (-765.198) [-770.229] (-766.223) * [-766.985] (-766.786) (-766.971) (-767.314) -- 0:00:40

      Average standard deviation of split frequencies: 0.011801

      380500 -- (-767.033) (-769.540) [-767.285] (-768.246) * (-765.681) (-768.548) [-766.407] (-765.112) -- 0:00:40
      381000 -- (-765.849) (-773.320) (-765.551) [-766.467] * (-771.386) (-768.636) [-768.478] (-764.480) -- 0:00:40
      381500 -- [-767.960] (-768.014) (-769.000) (-768.504) * (-766.734) (-771.044) [-767.410] (-768.304) -- 0:00:40
      382000 -- (-770.211) (-766.451) [-767.506] (-767.685) * (-767.333) (-771.146) [-770.744] (-764.733) -- 0:00:40
      382500 -- (-769.707) (-764.040) (-766.876) [-766.926] * (-768.641) (-769.658) (-767.778) [-764.890] -- 0:00:40
      383000 -- [-769.107] (-764.722) (-766.130) (-767.118) * [-766.726] (-767.636) (-767.426) (-768.770) -- 0:00:40
      383500 -- (-771.885) (-766.266) [-766.059] (-768.541) * (-768.149) (-764.914) (-767.027) [-765.824] -- 0:00:40
      384000 -- (-772.038) (-765.722) [-766.851] (-766.945) * (-767.918) (-769.269) (-766.396) [-763.311] -- 0:00:40
      384500 -- (-767.366) (-767.993) [-770.258] (-766.727) * (-767.822) (-767.783) (-767.771) [-764.763] -- 0:00:40
      385000 -- [-765.191] (-764.918) (-767.114) (-767.238) * (-767.776) (-767.618) (-767.569) [-763.827] -- 0:00:39

      Average standard deviation of split frequencies: 0.011638

      385500 -- [-766.337] (-767.185) (-770.847) (-766.797) * (-770.080) (-766.431) [-767.817] (-766.152) -- 0:00:39
      386000 -- [-765.684] (-769.825) (-767.964) (-766.939) * (-770.219) (-767.607) [-766.166] (-763.885) -- 0:00:39
      386500 -- (-767.908) (-766.528) [-772.713] (-774.106) * (-767.025) (-770.116) [-765.892] (-767.500) -- 0:00:39
      387000 -- (-764.248) (-763.727) (-769.502) [-766.301] * [-764.572] (-771.161) (-772.917) (-767.534) -- 0:00:39
      387500 -- [-766.425] (-773.301) (-771.075) (-768.334) * [-765.963] (-766.844) (-769.606) (-769.413) -- 0:00:39
      388000 -- (-774.561) (-766.096) (-769.336) [-771.175] * [-770.588] (-769.331) (-772.005) (-766.221) -- 0:00:39
      388500 -- [-768.267] (-765.560) (-769.335) (-769.402) * (-770.181) (-768.549) (-769.096) [-764.944] -- 0:00:39
      389000 -- (-768.896) [-764.112] (-768.094) (-771.339) * (-766.443) (-765.780) (-768.301) [-764.375] -- 0:00:40
      389500 -- (-766.983) (-769.210) (-766.722) [-767.518] * (-766.675) [-764.513] (-766.733) (-767.672) -- 0:00:40
      390000 -- [-766.240] (-768.820) (-768.748) (-768.543) * (-766.673) (-767.058) (-768.289) [-765.731] -- 0:00:40

      Average standard deviation of split frequencies: 0.011783

      390500 -- [-767.206] (-766.177) (-766.522) (-768.417) * [-769.511] (-770.275) (-766.794) (-765.930) -- 0:00:40
      391000 -- (-767.549) (-769.140) [-766.384] (-770.199) * (-768.280) [-770.013] (-766.710) (-767.617) -- 0:00:40
      391500 -- (-768.038) (-765.778) (-766.577) [-767.449] * (-767.123) (-770.659) (-768.871) [-765.161] -- 0:00:40
      392000 -- (-767.809) (-767.501) [-765.876] (-768.743) * (-774.028) [-769.600] (-768.515) (-771.558) -- 0:00:40
      392500 -- (-764.297) (-766.642) (-766.423) [-767.239] * [-771.050] (-768.212) (-768.008) (-768.980) -- 0:00:40
      393000 -- (-766.355) (-768.977) (-768.597) [-769.626] * [-766.693] (-766.604) (-768.684) (-768.275) -- 0:00:40
      393500 -- (-768.611) (-769.138) (-767.141) [-767.159] * (-769.812) (-768.721) (-770.170) [-764.718] -- 0:00:40
      394000 -- [-768.467] (-764.454) (-768.338) (-767.663) * (-768.286) (-770.794) (-771.875) [-765.999] -- 0:00:39
      394500 -- (-765.197) (-767.781) [-765.667] (-767.501) * (-769.915) (-768.667) (-765.720) [-764.705] -- 0:00:39
      395000 -- (-765.024) [-768.823] (-769.419) (-767.194) * (-768.027) (-766.734) [-767.178] (-766.981) -- 0:00:39

      Average standard deviation of split frequencies: 0.012499

      395500 -- (-764.112) (-766.849) (-771.201) [-766.428] * [-766.647] (-765.946) (-766.142) (-767.439) -- 0:00:39
      396000 -- (-764.648) [-766.992] (-767.363) (-765.811) * (-767.243) (-769.121) [-766.945] (-765.809) -- 0:00:39
      396500 -- (-765.154) [-765.735] (-767.708) (-765.686) * (-768.074) (-769.770) (-768.322) [-767.756] -- 0:00:39
      397000 -- (-767.313) (-767.808) (-765.526) [-766.958] * (-766.300) (-765.685) (-766.086) [-766.453] -- 0:00:39
      397500 -- (-766.122) [-767.407] (-767.939) (-766.589) * [-770.497] (-767.588) (-769.022) (-769.418) -- 0:00:39
      398000 -- (-772.937) [-766.531] (-767.404) (-767.220) * (-769.646) (-763.983) (-770.089) [-767.967] -- 0:00:39
      398500 -- (-765.906) [-768.226] (-767.656) (-766.764) * (-765.371) [-771.781] (-770.717) (-764.379) -- 0:00:39
      399000 -- (-766.739) (-766.714) [-767.065] (-767.757) * (-764.976) (-768.737) (-766.955) [-765.683] -- 0:00:39
      399500 -- (-765.177) [-768.103] (-764.821) (-768.560) * [-765.565] (-770.250) (-769.673) (-764.295) -- 0:00:39
      400000 -- (-766.154) (-771.618) (-765.793) [-767.387] * [-765.260] (-768.037) (-770.904) (-766.156) -- 0:00:39

      Average standard deviation of split frequencies: 0.012388

      400500 -- [-766.417] (-768.014) (-766.249) (-768.553) * (-771.148) (-766.884) [-767.897] (-764.462) -- 0:00:38
      401000 -- (-765.461) [-764.718] (-768.394) (-767.197) * (-768.088) (-766.849) (-769.626) [-768.309] -- 0:00:38
      401500 -- (-767.881) [-767.961] (-767.351) (-767.280) * (-767.921) (-768.619) (-767.629) [-767.005] -- 0:00:38
      402000 -- (-765.102) (-765.504) [-767.492] (-767.099) * (-766.891) [-764.390] (-765.786) (-765.254) -- 0:00:38
      402500 -- [-764.820] (-770.745) (-770.783) (-768.319) * (-768.110) [-767.142] (-770.077) (-765.861) -- 0:00:38
      403000 -- (-764.872) (-773.475) (-771.707) [-768.760] * (-766.625) (-769.813) (-767.539) [-766.370] -- 0:00:38
      403500 -- (-765.622) (-767.019) (-770.986) [-771.221] * (-766.752) [-766.718] (-767.174) (-771.248) -- 0:00:38
      404000 -- (-764.613) (-766.931) [-766.581] (-767.245) * (-772.671) (-765.735) (-766.683) [-767.731] -- 0:00:38
      404500 -- (-766.644) [-766.623] (-765.820) (-771.111) * (-767.599) [-764.295] (-767.541) (-766.447) -- 0:00:39
      405000 -- (-764.470) [-766.334] (-766.403) (-767.201) * (-769.437) (-766.228) [-764.813] (-769.008) -- 0:00:39

      Average standard deviation of split frequencies: 0.012362

      405500 -- (-766.291) [-766.825] (-767.382) (-766.813) * (-766.263) (-764.077) [-766.142] (-762.861) -- 0:00:39
      406000 -- [-766.542] (-766.078) (-766.347) (-768.982) * (-767.451) (-765.303) (-768.376) [-767.950] -- 0:00:39
      406500 -- (-764.214) (-766.483) [-764.856] (-768.643) * (-766.271) (-765.780) [-767.265] (-768.997) -- 0:00:39
      407000 -- (-767.500) (-774.505) (-768.504) [-765.341] * (-765.990) [-763.839] (-769.432) (-764.470) -- 0:00:39
      407500 -- [-771.935] (-767.614) (-767.558) (-767.204) * (-766.929) [-763.925] (-767.360) (-768.703) -- 0:00:39
      408000 -- [-766.798] (-765.896) (-769.748) (-766.828) * (-766.448) [-768.279] (-765.147) (-767.994) -- 0:00:39
      408500 -- (-766.849) (-765.306) [-764.067] (-767.825) * (-766.258) (-766.416) [-766.163] (-768.838) -- 0:00:39
      409000 -- (-767.838) [-766.758] (-765.691) (-769.773) * (-768.823) [-765.569] (-767.194) (-765.637) -- 0:00:39
      409500 -- (-771.521) (-766.011) [-765.963] (-766.116) * (-766.701) (-764.234) [-765.439] (-769.784) -- 0:00:38
      410000 -- (-768.184) [-765.292] (-767.188) (-766.932) * [-765.904] (-770.565) (-766.505) (-764.863) -- 0:00:38

      Average standard deviation of split frequencies: 0.012154

      410500 -- (-764.554) (-767.824) [-765.676] (-768.553) * (-767.090) (-767.875) [-769.259] (-765.086) -- 0:00:38
      411000 -- (-764.045) (-765.501) (-769.543) [-765.294] * (-763.610) (-765.227) [-767.356] (-764.143) -- 0:00:38
      411500 -- (-765.181) [-765.538] (-765.794) (-770.885) * (-765.390) [-766.417] (-768.735) (-766.386) -- 0:00:38
      412000 -- (-764.544) [-764.597] (-764.379) (-767.071) * (-764.548) [-766.349] (-767.909) (-765.143) -- 0:00:38
      412500 -- (-770.034) (-764.468) (-767.946) [-768.280] * (-770.024) [-766.202] (-765.064) (-766.597) -- 0:00:38
      413000 -- (-768.763) (-767.216) (-767.087) [-767.389] * (-774.165) (-768.051) (-766.194) [-765.180] -- 0:00:38
      413500 -- (-767.404) [-766.088] (-770.363) (-768.709) * (-767.990) (-765.217) (-768.724) [-767.041] -- 0:00:38
      414000 -- (-767.331) (-767.534) (-766.668) [-768.812] * (-768.739) [-764.872] (-770.316) (-768.669) -- 0:00:38
      414500 -- (-765.166) (-765.766) (-766.300) [-766.792] * (-768.878) [-764.050] (-765.995) (-768.872) -- 0:00:38
      415000 -- (-766.784) (-768.377) [-767.443] (-768.150) * (-766.001) (-765.132) (-765.827) [-765.631] -- 0:00:38

      Average standard deviation of split frequencies: 0.012332

      415500 -- (-767.936) [-766.554] (-767.968) (-768.199) * (-766.185) [-765.734] (-766.517) (-765.851) -- 0:00:37
      416000 -- [-768.254] (-766.564) (-766.042) (-772.233) * (-769.470) (-768.840) [-769.392] (-766.119) -- 0:00:37
      416500 -- (-766.455) (-768.473) [-768.546] (-772.236) * (-772.372) (-775.510) [-765.924] (-765.990) -- 0:00:37
      417000 -- [-775.672] (-769.726) (-765.533) (-766.651) * (-773.551) (-767.522) [-766.526] (-769.353) -- 0:00:37
      417500 -- (-770.917) (-769.854) (-766.237) [-765.470] * [-768.065] (-766.810) (-767.310) (-769.036) -- 0:00:37
      418000 -- (-765.860) (-772.360) [-767.725] (-766.736) * (-769.981) (-766.526) (-767.809) [-765.241] -- 0:00:37
      418500 -- (-770.443) (-766.904) [-766.159] (-766.389) * (-769.329) (-766.220) (-765.843) [-766.835] -- 0:00:37
      419000 -- [-766.089] (-771.177) (-765.642) (-768.495) * (-771.107) (-767.253) [-766.698] (-766.445) -- 0:00:37
      419500 -- (-773.287) [-767.495] (-767.267) (-767.793) * (-768.448) (-767.731) (-771.217) [-764.876] -- 0:00:37
      420000 -- [-766.406] (-771.849) (-768.019) (-768.069) * (-766.872) (-768.798) (-769.985) [-769.605] -- 0:00:38

      Average standard deviation of split frequencies: 0.011338

      420500 -- (-766.897) (-766.615) [-766.743] (-764.747) * (-767.654) (-769.392) (-770.475) [-764.720] -- 0:00:38
      421000 -- (-769.259) (-767.458) (-767.636) [-770.911] * (-769.782) (-764.811) (-766.671) [-766.351] -- 0:00:38
      421500 -- (-766.299) (-767.289) (-768.682) [-765.436] * (-766.224) (-766.846) (-766.876) [-765.980] -- 0:00:38
      422000 -- [-766.037] (-767.044) (-764.664) (-766.670) * (-766.770) (-766.350) (-767.105) [-765.875] -- 0:00:38
      422500 -- [-767.542] (-766.601) (-770.786) (-766.586) * [-766.900] (-765.487) (-766.943) (-764.767) -- 0:00:38
      423000 -- (-765.889) (-768.231) [-766.740] (-767.660) * (-770.832) (-766.020) [-767.081] (-765.064) -- 0:00:38
      423500 -- (-766.869) (-769.799) [-768.039] (-770.722) * (-770.842) (-767.640) (-772.142) [-767.620] -- 0:00:38
      424000 -- (-767.041) (-766.709) [-765.879] (-766.068) * (-773.007) [-766.449] (-769.065) (-769.452) -- 0:00:38
      424500 -- (-769.107) (-767.137) (-766.911) [-765.309] * (-769.622) (-766.952) [-764.571] (-772.078) -- 0:00:37
      425000 -- (-770.115) (-767.854) (-768.258) [-765.109] * (-767.106) (-767.129) [-765.534] (-769.799) -- 0:00:37

      Average standard deviation of split frequencies: 0.010871

      425500 -- (-765.483) [-765.715] (-771.599) (-766.379) * (-768.753) (-768.530) [-769.334] (-767.206) -- 0:00:37
      426000 -- (-768.005) [-766.970] (-770.005) (-767.819) * [-770.864] (-765.942) (-767.031) (-766.986) -- 0:00:37
      426500 -- [-765.745] (-769.281) (-764.071) (-766.772) * (-772.512) (-765.819) [-766.623] (-769.123) -- 0:00:37
      427000 -- (-771.299) (-765.797) [-763.907] (-766.958) * (-770.217) (-765.961) [-765.332] (-767.548) -- 0:00:37
      427500 -- (-768.059) (-768.744) [-764.169] (-766.160) * (-765.964) [-764.515] (-766.983) (-769.170) -- 0:00:37
      428000 -- (-766.784) (-765.059) (-771.817) [-769.666] * (-764.701) (-763.520) [-767.627] (-766.732) -- 0:00:37
      428500 -- (-768.869) [-767.518] (-769.133) (-765.647) * [-765.580] (-766.690) (-765.086) (-769.990) -- 0:00:37
      429000 -- [-767.543] (-765.536) (-764.011) (-769.433) * [-765.226] (-768.438) (-766.202) (-767.555) -- 0:00:37
      429500 -- (-766.360) (-765.338) (-766.468) [-765.938] * (-767.338) (-767.522) (-765.761) [-766.556] -- 0:00:37
      430000 -- (-767.948) (-765.190) (-765.562) [-767.193] * (-766.260) [-769.123] (-766.625) (-768.084) -- 0:00:37

      Average standard deviation of split frequencies: 0.011268

      430500 -- (-767.524) (-771.182) [-768.473] (-766.187) * (-767.912) (-767.825) [-768.403] (-768.026) -- 0:00:37
      431000 -- (-771.844) (-767.024) (-767.499) [-764.471] * (-767.379) (-765.190) [-766.104] (-767.944) -- 0:00:36
      431500 -- [-769.208] (-767.474) (-767.335) (-765.502) * (-767.680) (-769.950) [-766.152] (-767.001) -- 0:00:36
      432000 -- (-771.297) (-768.827) (-770.475) [-768.213] * (-767.727) (-769.241) [-765.871] (-765.364) -- 0:00:36
      432500 -- [-767.080] (-769.269) (-765.853) (-765.615) * (-767.958) (-767.514) (-767.427) [-767.628] -- 0:00:36
      433000 -- (-766.609) [-767.652] (-765.533) (-766.161) * [-767.854] (-769.209) (-767.027) (-766.432) -- 0:00:36
      433500 -- (-768.221) (-770.213) (-768.609) [-767.781] * (-766.967) (-766.776) [-765.266] (-767.306) -- 0:00:36
      434000 -- (-764.000) (-769.912) [-768.557] (-770.065) * (-766.263) (-766.779) [-764.169] (-767.603) -- 0:00:36
      434500 -- [-765.546] (-767.103) (-766.632) (-769.741) * (-774.204) [-764.396] (-767.260) (-767.629) -- 0:00:36
      435000 -- [-765.886] (-772.737) (-763.819) (-769.232) * (-771.336) (-765.523) (-766.781) [-766.362] -- 0:00:36

      Average standard deviation of split frequencies: 0.010572

      435500 -- (-768.327) (-769.331) [-764.408] (-766.514) * (-771.495) (-766.689) (-765.246) [-766.178] -- 0:00:37
      436000 -- (-766.526) (-769.408) [-765.010] (-768.168) * [-768.859] (-771.397) (-768.317) (-766.161) -- 0:00:37
      436500 -- (-764.773) [-766.619] (-769.077) (-767.513) * (-767.642) (-764.574) [-767.447] (-765.805) -- 0:00:37
      437000 -- (-770.557) (-765.618) [-769.579] (-766.027) * (-769.454) (-770.039) [-768.571] (-766.592) -- 0:00:37
      437500 -- (-770.190) (-765.936) (-767.594) [-767.556] * (-768.026) (-767.392) [-769.087] (-765.843) -- 0:00:37
      438000 -- (-766.574) [-766.307] (-765.262) (-767.163) * (-770.555) [-766.978] (-767.325) (-769.407) -- 0:00:37
      438500 -- [-764.792] (-768.866) (-765.535) (-766.122) * (-767.635) [-766.088] (-769.539) (-767.654) -- 0:00:37
      439000 -- [-765.985] (-765.185) (-764.347) (-767.974) * (-769.930) [-766.465] (-767.436) (-769.691) -- 0:00:37
      439500 -- [-766.646] (-764.497) (-764.368) (-768.302) * [-768.579] (-767.966) (-767.023) (-769.425) -- 0:00:36
      440000 -- (-770.520) (-765.099) [-766.124] (-767.186) * (-768.581) (-766.996) [-767.479] (-768.811) -- 0:00:36

      Average standard deviation of split frequencies: 0.010068

      440500 -- (-766.255) (-765.725) [-765.642] (-769.456) * (-768.028) (-765.890) [-766.351] (-767.171) -- 0:00:36
      441000 -- [-763.049] (-766.001) (-766.458) (-769.548) * [-768.305] (-771.158) (-768.784) (-765.212) -- 0:00:36
      441500 -- (-766.896) (-767.786) (-765.328) [-765.743] * [-766.839] (-765.603) (-767.610) (-767.527) -- 0:00:36
      442000 -- (-764.873) [-766.433] (-764.115) (-766.921) * [-768.673] (-766.464) (-766.691) (-767.526) -- 0:00:36
      442500 -- (-764.835) [-767.404] (-767.090) (-770.578) * [-767.930] (-767.506) (-770.034) (-766.104) -- 0:00:36
      443000 -- (-766.360) (-767.116) [-764.734] (-767.800) * (-766.330) (-764.945) [-765.345] (-766.785) -- 0:00:36
      443500 -- (-767.618) (-767.669) (-767.861) [-766.413] * (-765.297) (-768.279) (-766.130) [-767.867] -- 0:00:36
      444000 -- (-767.347) (-765.368) [-768.358] (-766.746) * (-767.515) (-765.336) (-767.242) [-767.978] -- 0:00:36
      444500 -- (-766.367) [-765.840] (-765.290) (-769.125) * (-769.254) (-765.309) (-767.564) [-770.763] -- 0:00:36
      445000 -- [-764.472] (-771.728) (-768.190) (-765.188) * (-767.320) (-771.693) [-765.002] (-769.411) -- 0:00:36

      Average standard deviation of split frequencies: 0.009219

      445500 -- (-766.737) (-768.546) (-764.193) [-764.878] * (-766.292) (-767.997) (-768.575) [-768.177] -- 0:00:36
      446000 -- [-766.404] (-767.442) (-766.607) (-767.021) * [-766.854] (-768.468) (-767.028) (-767.644) -- 0:00:36
      446500 -- (-771.032) (-765.798) [-769.838] (-766.177) * (-768.977) (-768.243) (-765.916) [-765.962] -- 0:00:35
      447000 -- (-764.951) (-766.880) (-765.406) [-765.300] * (-769.228) (-766.501) [-767.504] (-770.525) -- 0:00:35
      447500 -- (-766.743) (-766.691) [-764.102] (-775.068) * [-765.922] (-767.035) (-765.888) (-767.275) -- 0:00:35
      448000 -- (-770.786) (-765.145) (-764.682) [-769.247] * (-769.593) (-767.845) (-765.622) [-767.992] -- 0:00:35
      448500 -- (-768.092) [-766.132] (-766.833) (-770.802) * [-769.036] (-768.152) (-765.083) (-770.718) -- 0:00:35
      449000 -- (-768.981) (-769.299) [-765.390] (-767.638) * (-767.885) [-766.344] (-766.245) (-767.271) -- 0:00:35
      449500 -- (-764.388) (-766.813) (-769.564) [-766.871] * (-767.177) (-766.259) [-769.243] (-769.595) -- 0:00:35
      450000 -- [-765.747] (-768.367) (-766.712) (-771.966) * [-766.264] (-766.347) (-766.942) (-769.083) -- 0:00:35

      Average standard deviation of split frequencies: 0.008122

      450500 -- [-766.926] (-771.271) (-768.267) (-767.681) * (-766.627) [-766.694] (-767.136) (-773.428) -- 0:00:35
      451000 -- [-766.455] (-766.370) (-765.622) (-767.414) * (-766.325) (-768.899) [-767.789] (-769.350) -- 0:00:36
      451500 -- (-768.120) (-766.356) (-763.914) [-766.310] * (-774.940) (-767.831) (-766.606) [-766.720] -- 0:00:36
      452000 -- (-766.557) [-766.314] (-765.809) (-766.268) * (-767.344) [-765.647] (-769.043) (-766.523) -- 0:00:36
      452500 -- (-765.399) [-765.095] (-764.821) (-767.815) * (-768.303) [-766.821] (-766.615) (-765.841) -- 0:00:36
      453000 -- (-764.394) (-764.455) [-767.323] (-767.313) * (-771.068) (-765.068) (-766.128) [-766.173] -- 0:00:36
      453500 -- [-764.284] (-767.280) (-764.955) (-772.441) * (-768.496) [-766.945] (-767.594) (-769.026) -- 0:00:36
      454000 -- (-765.275) (-766.397) (-765.623) [-766.483] * [-765.531] (-766.716) (-769.459) (-768.032) -- 0:00:36
      454500 -- (-767.963) (-764.769) (-768.575) [-768.575] * [-765.050] (-766.065) (-766.454) (-767.852) -- 0:00:36
      455000 -- (-768.715) [-765.929] (-764.074) (-764.843) * (-765.945) [-766.021] (-765.716) (-765.987) -- 0:00:35

      Average standard deviation of split frequencies: 0.007845

      455500 -- (-765.747) (-764.839) [-765.082] (-766.828) * (-767.571) (-766.060) [-765.866] (-766.284) -- 0:00:35
      456000 -- (-764.257) [-764.536] (-765.220) (-766.667) * [-767.744] (-770.278) (-766.932) (-767.605) -- 0:00:35
      456500 -- [-765.468] (-768.511) (-766.460) (-766.309) * (-767.477) (-766.723) [-769.098] (-767.605) -- 0:00:35
      457000 -- (-767.268) (-768.088) (-764.993) [-766.757] * (-767.972) [-767.637] (-773.661) (-766.945) -- 0:00:35
      457500 -- (-767.709) (-765.019) [-765.074] (-767.218) * (-767.975) (-766.094) (-767.195) [-766.575] -- 0:00:35
      458000 -- (-770.194) (-768.748) [-765.502] (-767.590) * [-768.372] (-765.659) (-766.201) (-769.161) -- 0:00:35
      458500 -- [-765.012] (-766.069) (-766.691) (-767.885) * [-767.644] (-766.125) (-767.645) (-771.357) -- 0:00:35
      459000 -- (-764.085) (-765.473) [-766.964] (-766.326) * (-766.723) (-767.084) (-765.989) [-767.340] -- 0:00:35
      459500 -- (-766.402) [-763.884] (-767.705) (-768.742) * [-767.995] (-766.149) (-764.209) (-764.556) -- 0:00:35
      460000 -- [-766.933] (-763.156) (-765.356) (-767.210) * (-766.625) (-766.981) [-764.926] (-766.077) -- 0:00:35

      Average standard deviation of split frequencies: 0.008186

      460500 -- (-766.784) (-767.232) (-766.321) [-765.029] * (-770.836) (-766.306) [-766.907] (-764.922) -- 0:00:35
      461000 -- (-769.682) (-765.116) (-766.458) [-764.312] * (-768.612) [-766.540] (-765.789) (-766.100) -- 0:00:35
      461500 -- [-770.006] (-768.535) (-769.532) (-767.547) * (-768.574) (-766.094) (-763.965) [-765.767] -- 0:00:35
      462000 -- (-772.608) (-766.196) [-766.050] (-766.633) * (-769.344) [-765.943] (-767.238) (-767.498) -- 0:00:34
      462500 -- [-769.562] (-767.325) (-767.191) (-766.214) * [-766.804] (-766.862) (-767.793) (-766.333) -- 0:00:34
      463000 -- (-768.615) [-765.989] (-767.527) (-765.125) * (-770.905) [-766.253] (-766.104) (-766.735) -- 0:00:34
      463500 -- (-765.531) (-767.273) (-767.197) [-765.283] * (-765.359) [-766.320] (-767.373) (-764.514) -- 0:00:34
      464000 -- (-766.763) (-767.756) [-766.678] (-767.341) * (-766.344) [-766.141] (-769.462) (-767.557) -- 0:00:34
      464500 -- (-765.047) [-764.896] (-766.903) (-770.138) * (-765.767) [-769.148] (-766.371) (-764.517) -- 0:00:34
      465000 -- (-766.526) [-766.341] (-766.238) (-765.912) * (-764.937) [-763.638] (-766.648) (-767.694) -- 0:00:34

      Average standard deviation of split frequencies: 0.007736

      465500 -- (-770.049) [-765.264] (-767.262) (-768.242) * (-766.397) (-766.877) [-768.017] (-766.178) -- 0:00:34
      466000 -- (-766.488) (-765.775) (-768.769) [-767.573] * (-766.659) [-765.648] (-765.131) (-767.502) -- 0:00:34
      466500 -- (-765.818) (-769.182) (-768.166) [-765.863] * (-766.776) (-766.747) [-766.481] (-765.965) -- 0:00:35
      467000 -- [-767.856] (-767.240) (-767.143) (-766.135) * [-765.981] (-766.088) (-766.173) (-767.627) -- 0:00:35
      467500 -- (-764.413) (-765.627) [-766.685] (-771.040) * (-764.803) (-771.077) [-767.271] (-765.765) -- 0:00:35
      468000 -- (-766.651) (-766.074) (-769.131) [-770.698] * (-767.241) (-768.612) (-767.469) [-765.672] -- 0:00:35
      468500 -- [-766.802] (-764.129) (-768.264) (-765.894) * (-766.485) [-771.409] (-767.136) (-768.477) -- 0:00:35
      469000 -- [-764.755] (-765.379) (-768.606) (-767.712) * (-768.660) (-767.764) (-768.827) [-767.802] -- 0:00:35
      469500 -- (-763.569) [-764.966] (-765.760) (-769.890) * (-767.484) [-765.849] (-768.691) (-765.008) -- 0:00:35
      470000 -- (-766.808) [-765.941] (-766.908) (-767.715) * (-767.932) (-767.292) [-769.249] (-766.170) -- 0:00:34

      Average standard deviation of split frequencies: 0.008071

      470500 -- (-766.131) [-768.794] (-770.155) (-766.241) * (-771.057) [-769.080] (-765.351) (-765.006) -- 0:00:34
      471000 -- [-765.754] (-767.219) (-766.988) (-767.564) * (-769.631) [-768.450] (-765.200) (-767.495) -- 0:00:34
      471500 -- [-765.516] (-773.404) (-767.481) (-768.473) * (-771.659) (-768.891) [-768.009] (-771.630) -- 0:00:34
      472000 -- (-766.346) (-765.341) (-764.425) [-770.439] * (-766.905) [-769.904] (-766.042) (-765.021) -- 0:00:34
      472500 -- (-771.728) [-765.352] (-768.307) (-769.140) * [-767.692] (-768.722) (-766.089) (-764.553) -- 0:00:34
      473000 -- (-767.118) (-766.970) [-767.816] (-768.887) * [-766.827] (-767.477) (-767.340) (-770.141) -- 0:00:34
      473500 -- [-766.606] (-766.300) (-770.539) (-767.009) * (-764.052) (-767.092) (-767.283) [-765.542] -- 0:00:34
      474000 -- [-766.536] (-766.965) (-770.871) (-772.189) * [-766.047] (-765.832) (-766.924) (-766.772) -- 0:00:34
      474500 -- (-768.446) (-766.029) [-766.861] (-769.673) * (-767.298) [-766.477] (-767.603) (-766.755) -- 0:00:34
      475000 -- [-768.631] (-768.366) (-767.985) (-767.890) * (-767.890) (-767.537) (-767.281) [-764.757] -- 0:00:34

      Average standard deviation of split frequencies: 0.008156

      475500 -- (-768.244) (-764.516) [-765.822] (-766.642) * (-770.125) [-767.025] (-768.192) (-764.037) -- 0:00:34
      476000 -- [-765.459] (-765.255) (-766.475) (-769.981) * [-765.856] (-765.807) (-768.269) (-765.191) -- 0:00:34
      476500 -- (-766.245) [-768.670] (-766.690) (-766.582) * (-765.873) (-767.170) [-766.990] (-765.386) -- 0:00:34
      477000 -- (-767.980) [-766.634] (-768.771) (-765.532) * (-767.571) (-764.996) [-766.248] (-766.477) -- 0:00:33
      477500 -- (-765.139) [-765.287] (-771.553) (-767.827) * (-766.494) (-768.996) [-765.743] (-766.125) -- 0:00:33
      478000 -- (-768.414) (-766.230) (-769.358) [-765.419] * [-763.990] (-767.748) (-766.465) (-766.752) -- 0:00:33
      478500 -- (-765.973) (-768.041) (-768.573) [-768.579] * (-766.705) (-768.492) [-764.893] (-766.351) -- 0:00:33
      479000 -- [-767.063] (-766.623) (-767.929) (-765.833) * (-765.215) (-769.942) [-767.148] (-767.905) -- 0:00:33
      479500 -- (-767.478) [-765.855] (-765.769) (-767.523) * (-767.118) (-769.151) [-766.691] (-766.236) -- 0:00:33
      480000 -- (-767.834) (-766.241) [-767.288] (-768.155) * (-770.620) (-768.957) (-767.623) [-769.079] -- 0:00:33

      Average standard deviation of split frequencies: 0.007904

      480500 -- [-766.106] (-764.802) (-766.734) (-766.102) * (-766.352) (-767.725) (-766.779) [-770.833] -- 0:00:33
      481000 -- [-765.609] (-766.257) (-768.830) (-765.289) * [-767.260] (-767.900) (-766.833) (-766.715) -- 0:00:33
      481500 -- (-767.629) [-766.324] (-767.307) (-770.977) * (-765.746) (-766.149) [-768.768] (-769.061) -- 0:00:33
      482000 -- (-766.319) [-765.707] (-766.746) (-766.889) * (-767.630) (-767.896) [-767.894] (-766.128) -- 0:00:34
      482500 -- (-764.889) (-766.110) [-765.441] (-767.678) * (-765.868) [-767.263] (-767.647) (-766.887) -- 0:00:34
      483000 -- (-766.752) [-766.580] (-768.408) (-767.846) * [-765.616] (-768.972) (-767.058) (-765.304) -- 0:00:34
      483500 -- (-771.120) (-776.329) (-767.840) [-768.054] * (-766.728) [-771.306] (-766.992) (-764.741) -- 0:00:34
      484000 -- (-766.546) (-763.057) [-768.789] (-766.594) * (-765.797) [-766.617] (-767.570) (-765.842) -- 0:00:34
      484500 -- (-764.867) (-766.696) [-766.036] (-767.438) * [-765.612] (-767.066) (-764.682) (-766.276) -- 0:00:34
      485000 -- (-766.008) (-765.771) [-765.856] (-768.545) * [-766.953] (-765.047) (-764.849) (-765.936) -- 0:00:33

      Average standard deviation of split frequencies: 0.007988

      485500 -- (-766.320) [-765.364] (-766.168) (-769.810) * (-766.907) (-769.048) [-764.597] (-765.780) -- 0:00:33
      486000 -- (-764.635) [-767.237] (-766.464) (-765.719) * (-765.266) (-766.803) [-766.568] (-764.915) -- 0:00:33
      486500 -- [-765.393] (-767.122) (-773.955) (-767.230) * [-764.208] (-765.553) (-766.764) (-766.790) -- 0:00:33
      487000 -- (-769.317) (-769.541) (-767.413) [-766.821] * (-767.704) (-767.443) [-766.922] (-766.989) -- 0:00:33
      487500 -- (-767.363) [-766.937] (-768.013) (-766.221) * (-768.505) (-767.306) [-765.363] (-766.918) -- 0:00:33
      488000 -- (-769.675) [-767.231] (-768.371) (-767.219) * (-766.705) (-768.294) [-768.097] (-764.984) -- 0:00:33
      488500 -- [-764.825] (-766.027) (-769.354) (-765.608) * (-764.167) (-772.791) (-769.465) [-764.031] -- 0:00:33
      489000 -- (-768.247) (-766.916) [-768.383] (-768.006) * (-766.461) [-771.736] (-770.371) (-765.853) -- 0:00:33
      489500 -- (-767.673) (-766.206) (-767.923) [-767.847] * (-767.049) [-769.644] (-772.733) (-767.841) -- 0:00:33
      490000 -- (-768.128) [-768.702] (-765.397) (-766.388) * (-765.973) (-771.993) (-770.224) [-765.380] -- 0:00:33

      Average standard deviation of split frequencies: 0.007629

      490500 -- [-766.389] (-767.078) (-768.322) (-765.214) * (-764.532) (-767.815) (-767.310) [-765.236] -- 0:00:33
      491000 -- (-767.295) (-773.393) (-767.332) [-766.029] * (-766.347) (-767.442) (-767.711) [-765.686] -- 0:00:33
      491500 -- [-765.138] (-771.176) (-767.940) (-764.050) * [-766.977] (-766.914) (-771.270) (-765.524) -- 0:00:33
      492000 -- (-766.412) [-765.497] (-767.615) (-764.819) * (-768.089) (-769.605) [-768.362] (-769.360) -- 0:00:33
      492500 -- (-765.468) [-766.768] (-764.781) (-765.236) * [-765.210] (-770.344) (-767.437) (-765.592) -- 0:00:32
      493000 -- (-769.494) (-765.891) (-767.692) [-765.261] * (-767.437) (-768.388) (-768.079) [-767.022] -- 0:00:32
      493500 -- (-770.943) (-768.281) (-765.505) [-768.264] * (-766.384) (-768.629) (-769.343) [-767.589] -- 0:00:32
      494000 -- (-766.105) (-765.313) [-767.544] (-771.088) * [-767.701] (-769.157) (-766.919) (-765.792) -- 0:00:32
      494500 -- (-772.212) [-764.467] (-766.755) (-766.573) * (-766.781) (-765.962) [-766.298] (-768.150) -- 0:00:32
      495000 -- (-767.763) (-763.672) [-766.329] (-767.663) * (-766.224) (-765.189) (-769.038) [-770.223] -- 0:00:32

      Average standard deviation of split frequencies: 0.007156

      495500 -- (-770.273) (-768.312) [-767.852] (-769.784) * [-768.837] (-765.606) (-768.073) (-767.442) -- 0:00:32
      496000 -- (-767.444) [-764.525] (-765.494) (-771.944) * (-765.254) (-764.903) (-767.700) [-771.023] -- 0:00:32
      496500 -- (-767.313) (-763.681) (-767.130) [-771.495] * (-767.992) (-767.286) (-767.276) [-766.645] -- 0:00:32
      497000 -- [-766.040] (-767.340) (-771.897) (-765.827) * (-765.811) (-771.319) (-771.056) [-768.768] -- 0:00:32
      497500 -- (-766.834) [-765.813] (-767.729) (-766.067) * (-767.373) (-767.510) [-769.271] (-767.172) -- 0:00:33
      498000 -- (-767.105) (-767.611) (-765.520) [-767.437] * (-769.114) [-763.848] (-770.846) (-766.746) -- 0:00:33
      498500 -- (-766.766) (-766.836) (-767.092) [-766.720] * (-768.111) [-765.977] (-768.775) (-767.032) -- 0:00:33
      499000 -- [-767.080] (-764.714) (-764.463) (-770.518) * (-765.196) (-767.575) (-769.988) [-766.475] -- 0:00:33
      499500 -- [-764.964] (-764.224) (-765.356) (-765.600) * [-765.876] (-768.102) (-766.883) (-765.002) -- 0:00:33
      500000 -- [-765.234] (-767.194) (-765.207) (-766.099) * (-764.833) [-768.948] (-766.540) (-766.349) -- 0:00:33

      Average standard deviation of split frequencies: 0.006979

      500500 -- (-771.982) (-766.582) (-766.152) [-769.075] * [-765.517] (-766.710) (-767.846) (-766.096) -- 0:00:32
      501000 -- [-765.739] (-766.865) (-766.115) (-769.024) * (-767.345) [-767.081] (-768.863) (-767.798) -- 0:00:32
      501500 -- [-765.753] (-766.127) (-765.340) (-767.192) * (-767.093) (-765.346) [-767.143] (-774.699) -- 0:00:32
      502000 -- (-765.464) [-764.128] (-766.298) (-769.553) * (-765.117) [-767.166] (-767.757) (-765.927) -- 0:00:32
      502500 -- (-766.253) [-767.718] (-763.777) (-765.659) * [-766.680] (-768.541) (-766.771) (-766.093) -- 0:00:32
      503000 -- (-768.705) (-767.444) (-767.537) [-765.932] * (-766.045) [-772.071] (-766.909) (-766.838) -- 0:00:32
      503500 -- (-774.184) [-765.225] (-769.111) (-768.611) * (-769.123) [-768.580] (-769.398) (-773.823) -- 0:00:32
      504000 -- [-767.491] (-770.588) (-765.771) (-765.599) * (-771.497) (-766.548) (-767.881) [-766.170] -- 0:00:32
      504500 -- (-767.171) (-764.191) [-766.045] (-764.294) * (-766.023) (-767.401) [-768.256] (-765.998) -- 0:00:32
      505000 -- (-763.580) [-767.330] (-766.893) (-768.162) * [-765.740] (-768.373) (-767.983) (-767.039) -- 0:00:32

      Average standard deviation of split frequencies: 0.006521

      505500 -- (-764.909) [-769.029] (-768.071) (-765.022) * (-766.037) (-766.963) (-769.866) [-766.246] -- 0:00:32
      506000 -- [-767.499] (-770.781) (-775.100) (-766.153) * (-766.261) (-766.546) (-766.512) [-766.499] -- 0:00:32
      506500 -- (-767.849) (-769.040) (-769.847) [-767.346] * (-770.826) (-768.966) [-764.585] (-765.874) -- 0:00:32
      507000 -- (-766.286) [-766.429] (-767.282) (-773.540) * (-766.722) (-767.650) (-765.274) [-765.915] -- 0:00:32
      507500 -- (-767.919) (-766.579) (-767.647) [-766.202] * [-766.216] (-769.549) (-766.331) (-766.721) -- 0:00:32
      508000 -- (-768.536) [-765.506] (-766.927) (-766.989) * (-765.614) (-767.270) (-768.317) [-767.475] -- 0:00:31
      508500 -- (-766.001) (-766.334) [-766.221] (-767.891) * (-766.440) [-768.978] (-768.022) (-766.107) -- 0:00:31
      509000 -- (-767.961) (-766.326) (-766.930) [-767.857] * (-773.125) [-770.646] (-766.988) (-768.158) -- 0:00:31
      509500 -- [-766.330] (-767.426) (-771.054) (-766.450) * [-766.974] (-766.191) (-769.802) (-768.386) -- 0:00:31
      510000 -- (-766.484) (-767.679) [-765.427] (-765.945) * (-766.078) (-768.306) (-766.174) [-766.621] -- 0:00:31

      Average standard deviation of split frequencies: 0.007439

      510500 -- [-765.215] (-768.373) (-766.757) (-766.828) * [-765.009] (-770.842) (-766.850) (-766.364) -- 0:00:31
      511000 -- (-765.018) (-767.713) [-768.328] (-767.665) * (-766.036) (-770.039) (-766.442) [-771.537] -- 0:00:31
      511500 -- (-767.089) (-768.054) (-766.562) [-767.266] * (-767.416) [-768.448] (-769.818) (-777.816) -- 0:00:31
      512000 -- (-768.440) (-767.841) (-767.463) [-766.271] * [-764.987] (-767.247) (-768.577) (-771.837) -- 0:00:31
      512500 -- [-768.152] (-765.773) (-771.239) (-770.867) * [-766.932] (-764.546) (-766.868) (-772.605) -- 0:00:31
      513000 -- (-766.120) [-767.074] (-765.736) (-766.447) * [-767.773] (-767.709) (-766.119) (-770.902) -- 0:00:32
      513500 -- (-765.442) (-766.783) [-768.245] (-767.401) * (-766.388) [-766.910] (-768.648) (-765.523) -- 0:00:32
      514000 -- [-767.069] (-769.390) (-766.270) (-766.900) * [-766.351] (-767.746) (-766.289) (-767.276) -- 0:00:32
      514500 -- (-764.203) [-767.447] (-766.503) (-767.661) * (-765.317) (-769.476) [-767.773] (-768.984) -- 0:00:32
      515000 -- [-764.444] (-764.255) (-766.607) (-764.688) * (-769.935) [-767.988] (-766.069) (-768.934) -- 0:00:32

      Average standard deviation of split frequencies: 0.006932

      515500 -- (-767.345) (-767.528) (-766.314) [-768.973] * (-768.901) [-765.021] (-766.494) (-767.661) -- 0:00:31
      516000 -- (-766.994) (-766.741) [-766.158] (-765.145) * (-768.219) (-764.536) [-764.831] (-769.257) -- 0:00:31
      516500 -- (-767.481) (-766.706) [-767.893] (-766.600) * (-764.240) [-767.626] (-765.492) (-767.002) -- 0:00:31
      517000 -- (-768.212) (-767.710) (-766.371) [-763.913] * (-767.353) (-768.514) (-768.302) [-765.801] -- 0:00:31
      517500 -- [-765.378] (-771.889) (-767.939) (-765.656) * (-766.149) (-770.746) [-765.703] (-765.735) -- 0:00:31
      518000 -- [-769.102] (-767.971) (-767.308) (-769.158) * (-766.448) (-767.152) (-769.195) [-765.345] -- 0:00:31
      518500 -- (-768.342) [-767.837] (-769.642) (-767.956) * (-767.055) (-767.958) [-767.232] (-764.250) -- 0:00:31
      519000 -- (-769.109) (-767.652) (-766.454) [-765.376] * (-766.244) [-767.389] (-766.405) (-768.357) -- 0:00:31
      519500 -- (-768.066) [-765.964] (-767.050) (-764.179) * (-769.279) (-767.010) [-767.496] (-764.624) -- 0:00:31
      520000 -- [-765.707] (-767.027) (-765.060) (-767.115) * (-767.538) [-766.303] (-764.717) (-767.439) -- 0:00:31

      Average standard deviation of split frequencies: 0.007243

      520500 -- [-764.500] (-767.705) (-769.201) (-774.814) * (-768.104) [-766.128] (-768.331) (-765.112) -- 0:00:31
      521000 -- (-766.418) [-764.292] (-766.910) (-767.344) * (-763.988) (-766.457) [-765.203] (-765.521) -- 0:00:31
      521500 -- (-774.307) [-768.900] (-768.604) (-765.285) * (-769.200) (-766.302) [-766.162] (-768.788) -- 0:00:31
      522000 -- (-768.087) (-766.400) (-764.399) [-765.496] * (-770.266) (-766.470) (-764.714) [-771.549] -- 0:00:31
      522500 -- (-766.720) [-766.401] (-767.767) (-769.705) * (-767.588) (-764.076) [-765.202] (-766.712) -- 0:00:31
      523000 -- (-769.602) (-765.784) [-770.026] (-769.044) * (-768.547) (-770.195) (-766.289) [-766.853] -- 0:00:31
      523500 -- (-768.643) (-764.285) [-771.428] (-766.636) * (-775.198) (-765.435) (-766.417) [-765.020] -- 0:00:30
      524000 -- (-767.187) (-765.568) [-765.094] (-765.884) * [-769.311] (-764.099) (-763.405) (-765.106) -- 0:00:30
      524500 -- (-765.449) (-766.505) (-764.975) [-763.855] * (-766.714) (-766.981) [-766.327] (-768.547) -- 0:00:30
      525000 -- [-767.020] (-769.275) (-766.557) (-767.704) * (-768.027) (-766.972) (-766.581) [-764.967] -- 0:00:30

      Average standard deviation of split frequencies: 0.006748

      525500 -- [-764.331] (-765.228) (-768.114) (-767.374) * (-766.610) (-768.871) [-766.099] (-766.644) -- 0:00:30
      526000 -- (-765.796) (-765.411) [-770.603] (-768.329) * [-768.254] (-771.176) (-766.436) (-769.662) -- 0:00:30
      526500 -- (-768.395) (-763.549) (-772.223) [-766.807] * (-773.681) (-770.569) (-765.281) [-766.446] -- 0:00:30
      527000 -- (-765.401) (-763.939) (-765.584) [-767.950] * (-766.377) (-766.542) [-766.292] (-772.125) -- 0:00:30
      527500 -- (-766.436) [-766.044] (-766.606) (-766.251) * (-766.344) [-764.334] (-766.074) (-770.807) -- 0:00:30
      528000 -- (-766.168) (-767.811) [-766.550] (-768.806) * (-766.231) [-766.578] (-764.907) (-770.784) -- 0:00:30
      528500 -- (-767.891) [-768.282] (-766.903) (-766.098) * (-767.718) (-767.431) (-767.936) [-770.011] -- 0:00:31
      529000 -- (-764.757) (-769.238) [-764.755] (-769.211) * (-765.994) [-763.879] (-764.264) (-769.874) -- 0:00:31
      529500 -- [-769.489] (-769.058) (-765.667) (-766.996) * (-764.758) (-765.676) (-766.878) [-768.431] -- 0:00:31
      530000 -- [-766.259] (-766.126) (-765.272) (-772.609) * (-766.645) [-766.612] (-771.076) (-769.796) -- 0:00:31

      Average standard deviation of split frequencies: 0.007316

      530500 -- (-768.558) [-765.124] (-767.466) (-772.496) * (-766.930) (-769.764) [-768.131] (-766.346) -- 0:00:30
      531000 -- (-768.016) (-766.055) [-766.766] (-766.477) * (-767.138) (-765.093) (-766.732) [-768.947] -- 0:00:30
      531500 -- (-767.201) (-768.279) [-766.517] (-765.929) * (-765.118) [-762.943] (-765.813) (-766.707) -- 0:00:30
      532000 -- (-765.947) (-766.877) (-768.764) [-765.963] * (-772.112) [-766.031] (-764.976) (-768.783) -- 0:00:30
      532500 -- (-766.021) (-766.632) [-765.435] (-767.220) * (-768.357) (-766.823) (-767.772) [-765.567] -- 0:00:30
      533000 -- [-766.627] (-768.252) (-766.141) (-768.236) * [-767.393] (-766.683) (-763.972) (-768.288) -- 0:00:30
      533500 -- [-766.112] (-767.481) (-765.631) (-768.855) * (-773.729) [-767.762] (-767.795) (-767.844) -- 0:00:30
      534000 -- (-770.556) (-766.688) [-766.137] (-768.233) * (-766.914) (-768.642) [-765.693] (-767.028) -- 0:00:30
      534500 -- (-768.910) (-768.513) (-766.803) [-766.483] * (-765.021) (-767.153) (-765.269) [-765.712] -- 0:00:30
      535000 -- (-766.606) (-769.064) [-764.028] (-767.452) * (-768.694) (-765.642) [-766.397] (-765.704) -- 0:00:30

      Average standard deviation of split frequencies: 0.007243

      535500 -- (-767.911) [-766.741] (-766.112) (-767.037) * (-768.444) (-766.024) [-765.937] (-765.540) -- 0:00:30
      536000 -- (-769.909) [-765.581] (-765.420) (-766.962) * (-766.908) (-766.900) [-767.501] (-770.510) -- 0:00:30
      536500 -- (-765.306) (-768.386) (-766.323) [-763.720] * (-766.613) (-767.526) [-765.321] (-766.435) -- 0:00:30
      537000 -- (-764.410) (-765.787) (-767.020) [-766.642] * [-764.895] (-765.816) (-769.321) (-766.261) -- 0:00:30
      537500 -- (-763.619) (-766.055) (-769.239) [-767.706] * (-765.546) [-766.282] (-766.355) (-772.526) -- 0:00:30
      538000 -- (-767.718) (-766.437) [-767.122] (-772.315) * (-768.458) (-767.697) (-763.921) [-764.200] -- 0:00:30
      538500 -- (-766.568) (-768.310) [-766.685] (-770.437) * (-769.153) (-766.902) [-768.689] (-765.351) -- 0:00:29
      539000 -- (-767.462) (-767.144) [-769.125] (-769.583) * (-768.762) (-768.511) [-767.747] (-765.253) -- 0:00:29
      539500 -- (-765.730) (-769.936) [-766.987] (-769.189) * (-770.062) (-766.729) [-765.205] (-769.064) -- 0:00:29
      540000 -- [-765.012] (-770.780) (-765.714) (-772.007) * [-766.243] (-765.889) (-764.512) (-771.409) -- 0:00:29

      Average standard deviation of split frequencies: 0.007283

      540500 -- [-764.509] (-767.907) (-766.639) (-771.590) * (-768.345) [-767.025] (-765.919) (-770.917) -- 0:00:29
      541000 -- (-766.884) (-768.457) (-768.514) [-770.694] * (-766.156) [-766.280] (-766.665) (-764.444) -- 0:00:29
      541500 -- (-768.890) (-766.497) (-766.825) [-767.850] * (-766.271) (-764.841) [-763.081] (-765.202) -- 0:00:29
      542000 -- [-766.492] (-765.432) (-768.143) (-767.322) * [-767.653] (-769.234) (-766.479) (-765.960) -- 0:00:29
      542500 -- (-767.965) [-766.799] (-767.104) (-769.072) * (-766.543) (-767.783) [-765.685] (-765.658) -- 0:00:29
      543000 -- (-767.924) (-766.135) [-767.034] (-772.199) * (-775.594) [-768.004] (-766.291) (-765.348) -- 0:00:29
      543500 -- (-766.582) (-764.931) (-768.230) [-766.114] * [-768.856] (-768.431) (-767.391) (-764.047) -- 0:00:29
      544000 -- [-768.630] (-764.851) (-768.528) (-767.844) * (-765.377) (-765.919) (-766.346) [-765.420] -- 0:00:30
      544500 -- [-764.654] (-764.767) (-766.565) (-769.702) * (-764.431) [-765.902] (-764.613) (-766.592) -- 0:00:30
      545000 -- (-765.037) [-765.791] (-768.495) (-768.917) * (-766.296) (-770.348) [-764.437] (-768.486) -- 0:00:30

      Average standard deviation of split frequencies: 0.006653

      545500 -- (-766.211) [-767.344] (-765.709) (-769.042) * (-763.795) (-767.310) (-764.939) [-766.847] -- 0:00:29
      546000 -- (-768.551) (-766.190) [-765.474] (-767.830) * (-766.142) (-768.303) [-767.721] (-766.657) -- 0:00:29
      546500 -- [-765.373] (-766.407) (-768.531) (-769.298) * [-764.259] (-766.896) (-764.740) (-767.143) -- 0:00:29
      547000 -- [-765.825] (-766.908) (-766.638) (-771.017) * (-764.458) (-768.220) (-766.523) [-765.660] -- 0:00:29
      547500 -- (-767.902) (-767.750) [-767.070] (-769.518) * (-764.835) (-765.521) (-767.356) [-768.979] -- 0:00:29
      548000 -- [-764.480] (-765.817) (-766.717) (-767.375) * [-769.361] (-767.764) (-766.209) (-765.448) -- 0:00:29
      548500 -- (-765.435) (-768.549) (-768.456) [-764.722] * (-770.287) [-764.278] (-767.094) (-764.615) -- 0:00:29
      549000 -- (-764.617) (-768.199) [-770.353] (-768.906) * (-766.608) [-764.020] (-766.771) (-767.322) -- 0:00:29
      549500 -- [-763.643] (-766.090) (-768.489) (-766.204) * [-765.976] (-765.433) (-766.074) (-768.774) -- 0:00:29
      550000 -- (-767.447) (-770.212) [-766.003] (-765.400) * [-765.822] (-765.744) (-767.849) (-767.822) -- 0:00:29

      Average standard deviation of split frequencies: 0.006748

      550500 -- (-767.879) (-765.862) [-767.417] (-766.835) * (-767.602) (-766.972) [-766.209] (-765.291) -- 0:00:29
      551000 -- (-767.743) (-769.442) [-767.149] (-767.054) * (-769.925) [-765.713] (-766.167) (-767.585) -- 0:00:29
      551500 -- (-769.191) (-766.409) [-771.245] (-766.140) * (-768.476) (-766.079) [-765.514] (-765.290) -- 0:00:29
      552000 -- [-766.480] (-766.448) (-767.487) (-771.241) * (-770.203) [-768.584] (-767.949) (-765.420) -- 0:00:29
      552500 -- (-770.047) (-767.326) (-766.868) [-765.934] * [-765.380] (-767.503) (-770.062) (-767.831) -- 0:00:29
      553000 -- (-767.979) (-766.358) [-767.200] (-770.494) * (-766.774) (-765.490) (-766.710) [-766.181] -- 0:00:29
      553500 -- [-764.829] (-768.156) (-765.900) (-765.588) * [-768.668] (-763.835) (-768.237) (-765.956) -- 0:00:29
      554000 -- (-768.758) (-766.858) [-764.832] (-766.056) * [-768.206] (-763.265) (-767.733) (-766.906) -- 0:00:28
      554500 -- [-766.129] (-773.766) (-767.273) (-766.626) * (-767.630) [-764.925] (-765.305) (-774.308) -- 0:00:28
      555000 -- (-766.062) [-767.044] (-766.256) (-769.470) * (-764.648) (-767.284) [-764.697] (-766.109) -- 0:00:28

      Average standard deviation of split frequencies: 0.006583

      555500 -- [-765.602] (-765.935) (-769.230) (-766.367) * (-768.712) [-766.653] (-767.395) (-769.977) -- 0:00:28
      556000 -- [-767.667] (-766.267) (-768.630) (-766.563) * (-769.347) (-766.275) [-769.025] (-766.718) -- 0:00:28
      556500 -- (-766.439) (-769.410) [-765.799] (-766.080) * (-766.175) (-765.234) [-765.841] (-766.088) -- 0:00:28
      557000 -- [-766.977] (-769.046) (-768.497) (-764.766) * (-766.053) (-765.600) (-766.641) [-766.943] -- 0:00:28
      557500 -- (-770.642) [-767.746] (-767.990) (-769.011) * (-767.965) (-766.915) (-766.213) [-765.680] -- 0:00:28
      558000 -- (-766.111) (-766.584) [-766.649] (-766.115) * (-768.579) (-766.551) [-766.002] (-766.710) -- 0:00:28
      558500 -- (-765.079) (-770.290) (-772.607) [-766.638] * (-765.624) (-764.542) (-767.417) [-765.531] -- 0:00:28
      559000 -- (-772.148) (-769.082) [-766.768] (-767.107) * [-766.855] (-765.191) (-771.250) (-765.818) -- 0:00:28
      559500 -- (-767.803) (-769.708) [-766.761] (-766.271) * (-766.908) (-765.050) (-768.431) [-767.287] -- 0:00:29
      560000 -- (-768.008) [-767.552] (-768.151) (-766.038) * (-767.940) (-767.450) (-770.117) [-765.671] -- 0:00:29

      Average standard deviation of split frequencies: 0.006380

      560500 -- (-767.949) (-766.862) (-767.073) [-770.554] * (-765.616) (-766.924) [-766.644] (-765.023) -- 0:00:29
      561000 -- (-767.841) (-764.291) (-764.946) [-766.434] * (-767.435) (-765.594) (-767.103) [-766.854] -- 0:00:28
      561500 -- (-766.525) (-767.939) [-766.768] (-766.752) * [-765.034] (-766.830) (-772.434) (-764.839) -- 0:00:28
      562000 -- (-767.122) [-766.305] (-765.634) (-767.226) * (-768.643) (-766.595) [-768.345] (-766.165) -- 0:00:28
      562500 -- [-769.414] (-768.167) (-767.500) (-767.999) * (-768.017) (-764.403) [-765.047] (-767.359) -- 0:00:28
      563000 -- (-766.412) (-765.696) [-766.375] (-768.788) * [-767.617] (-766.453) (-763.614) (-768.855) -- 0:00:28
      563500 -- (-765.835) (-764.180) [-765.337] (-768.066) * (-767.795) (-768.930) [-769.865] (-768.304) -- 0:00:28
      564000 -- (-767.471) (-765.401) [-767.260] (-767.174) * [-767.856] (-766.938) (-766.884) (-766.330) -- 0:00:28
      564500 -- [-765.544] (-765.606) (-766.654) (-768.632) * (-766.382) (-771.967) [-764.194] (-766.418) -- 0:00:28
      565000 -- (-767.525) (-771.312) [-765.157] (-765.453) * (-767.959) (-765.734) [-766.033] (-768.512) -- 0:00:28

      Average standard deviation of split frequencies: 0.006124

      565500 -- (-772.833) [-764.949] (-764.357) (-766.192) * (-769.698) (-767.701) (-766.790) [-768.785] -- 0:00:28
      566000 -- (-769.102) [-769.194] (-768.197) (-767.938) * (-771.155) (-767.196) [-766.651] (-765.414) -- 0:00:28
      566500 -- (-766.361) (-765.254) [-769.302] (-767.038) * (-767.126) [-766.331] (-762.989) (-766.703) -- 0:00:28
      567000 -- (-766.872) [-763.172] (-769.478) (-765.307) * (-770.747) [-765.995] (-765.812) (-766.196) -- 0:00:28
      567500 -- (-768.460) [-765.632] (-764.730) (-767.062) * [-764.690] (-769.700) (-767.952) (-767.942) -- 0:00:28
      568000 -- (-766.926) [-763.635] (-767.906) (-767.353) * (-765.127) (-770.895) [-767.238] (-768.796) -- 0:00:28
      568500 -- (-766.444) [-770.941] (-769.432) (-771.611) * [-766.465] (-768.423) (-767.087) (-766.603) -- 0:00:28
      569000 -- (-765.023) [-766.696] (-766.068) (-767.149) * (-766.056) (-768.178) (-767.219) [-767.208] -- 0:00:28
      569500 -- (-766.774) (-764.886) [-763.553] (-770.886) * [-766.008] (-767.248) (-765.351) (-767.171) -- 0:00:27
      570000 -- (-765.429) [-764.562] (-766.583) (-765.471) * [-767.517] (-766.899) (-767.580) (-767.146) -- 0:00:27

      Average standard deviation of split frequencies: 0.006074

      570500 -- (-766.395) [-767.253] (-766.651) (-767.786) * (-767.101) [-768.055] (-768.497) (-765.432) -- 0:00:27
      571000 -- [-766.260] (-766.666) (-772.764) (-769.358) * (-768.247) [-766.981] (-765.009) (-767.627) -- 0:00:27
      571500 -- [-766.158] (-764.491) (-767.183) (-769.624) * (-766.618) [-766.322] (-766.570) (-771.745) -- 0:00:27
      572000 -- (-766.343) (-765.682) (-765.756) [-767.968] * (-769.405) (-766.633) [-764.636] (-770.311) -- 0:00:27
      572500 -- (-768.704) (-766.362) [-765.249] (-768.740) * (-765.386) (-768.403) (-764.557) [-766.080] -- 0:00:27
      573000 -- (-767.320) [-767.709] (-768.711) (-771.008) * (-766.823) (-768.381) [-767.823] (-769.658) -- 0:00:27
      573500 -- (-764.869) [-766.143] (-767.707) (-771.218) * [-767.465] (-765.717) (-769.268) (-768.409) -- 0:00:27
      574000 -- (-767.501) [-764.301] (-770.430) (-767.669) * (-766.940) (-767.085) [-764.462] (-766.877) -- 0:00:27
      574500 -- [-767.105] (-767.530) (-770.507) (-767.065) * (-768.839) (-766.626) (-767.868) [-769.081] -- 0:00:27
      575000 -- (-765.276) [-767.303] (-772.017) (-767.318) * [-764.057] (-767.240) (-768.058) (-766.220) -- 0:00:28

      Average standard deviation of split frequencies: 0.006258

      575500 -- (-765.928) (-770.308) (-766.227) [-765.027] * (-765.503) [-766.631] (-771.291) (-765.527) -- 0:00:28
      576000 -- (-766.646) (-766.029) (-769.563) [-763.827] * (-767.442) (-767.053) (-777.355) [-768.432] -- 0:00:27
      576500 -- (-766.652) [-770.114] (-769.251) (-765.942) * (-765.807) (-767.137) (-765.321) [-769.516] -- 0:00:27
      577000 -- [-767.158] (-766.850) (-767.741) (-763.770) * [-765.388] (-767.160) (-765.975) (-768.455) -- 0:00:27
      577500 -- (-765.393) (-766.861) (-767.328) [-765.983] * [-767.469] (-764.350) (-766.997) (-771.168) -- 0:00:27
      578000 -- (-766.892) [-764.441] (-767.840) (-764.121) * (-765.556) (-772.023) [-764.193] (-766.272) -- 0:00:27
      578500 -- (-767.012) (-766.968) [-771.352] (-764.385) * (-764.691) [-768.752] (-768.682) (-767.638) -- 0:00:27
      579000 -- (-768.367) (-764.880) [-766.714] (-767.555) * (-769.557) (-768.366) (-770.440) [-766.522] -- 0:00:27
      579500 -- [-764.184] (-766.901) (-769.611) (-767.135) * [-766.953] (-768.981) (-767.754) (-765.847) -- 0:00:27
      580000 -- (-768.017) (-767.146) [-767.160] (-765.997) * [-771.483] (-767.155) (-766.312) (-765.625) -- 0:00:27

      Average standard deviation of split frequencies: 0.005731

      580500 -- [-765.832] (-769.255) (-766.932) (-766.930) * (-767.004) (-766.219) [-766.097] (-766.155) -- 0:00:27
      581000 -- (-766.727) [-765.468] (-764.906) (-766.307) * (-767.005) (-770.075) [-766.466] (-767.100) -- 0:00:27
      581500 -- [-765.944] (-769.646) (-767.180) (-764.046) * (-765.859) (-764.788) (-766.318) [-765.272] -- 0:00:27
      582000 -- [-767.035] (-767.481) (-766.748) (-766.905) * (-765.913) (-765.188) (-768.056) [-766.356] -- 0:00:27
      582500 -- (-768.499) (-772.166) (-768.757) [-767.555] * (-766.798) [-765.586] (-767.613) (-767.379) -- 0:00:27
      583000 -- (-766.182) [-766.813] (-767.723) (-764.649) * [-767.843] (-766.017) (-767.765) (-766.302) -- 0:00:27
      583500 -- (-768.049) (-767.288) (-772.467) [-765.181] * (-764.082) (-766.623) (-767.336) [-766.703] -- 0:00:27
      584000 -- (-765.589) (-763.744) [-767.838] (-766.272) * (-766.347) (-770.122) (-766.416) [-766.466] -- 0:00:27
      584500 -- (-765.147) (-767.598) [-766.981] (-765.462) * [-768.375] (-766.146) (-768.089) (-771.447) -- 0:00:27
      585000 -- (-766.114) (-769.843) (-767.341) [-776.642] * [-768.317] (-765.632) (-767.815) (-772.754) -- 0:00:26

      Average standard deviation of split frequencies: 0.005868

      585500 -- (-765.207) [-766.116] (-766.485) (-775.837) * (-769.512) (-766.451) (-768.788) [-770.562] -- 0:00:26
      586000 -- (-765.932) [-764.334] (-766.708) (-769.954) * [-765.840] (-766.173) (-766.311) (-769.097) -- 0:00:26
      586500 -- (-767.596) (-768.874) (-767.555) [-765.657] * (-766.123) [-764.611] (-766.752) (-775.268) -- 0:00:26
      587000 -- [-768.141] (-768.165) (-766.359) (-765.191) * (-767.104) (-766.827) [-767.352] (-767.700) -- 0:00:26
      587500 -- (-767.130) (-766.573) [-766.170] (-768.480) * [-767.116] (-766.409) (-768.876) (-766.335) -- 0:00:26
      588000 -- (-765.583) [-765.399] (-768.047) (-765.644) * [-769.880] (-765.480) (-766.850) (-767.245) -- 0:00:26
      588500 -- (-767.983) (-765.912) (-772.085) [-765.298] * [-767.396] (-766.249) (-766.734) (-765.045) -- 0:00:26
      589000 -- (-766.004) [-765.966] (-768.339) (-767.005) * (-770.097) (-769.862) (-768.072) [-765.898] -- 0:00:26
      589500 -- [-765.796] (-767.576) (-768.175) (-765.305) * (-767.362) [-766.496] (-766.058) (-769.979) -- 0:00:26
      590000 -- (-767.066) (-767.750) (-766.972) [-766.284] * (-766.905) [-769.056] (-768.434) (-763.907) -- 0:00:26

      Average standard deviation of split frequencies: 0.006197

      590500 -- (-766.053) [-766.621] (-768.002) (-769.609) * (-764.206) (-765.895) (-768.189) [-765.718] -- 0:00:27
      591000 -- (-766.237) (-765.052) (-768.030) [-767.062] * (-767.844) (-765.635) (-773.116) [-766.605] -- 0:00:26
      591500 -- (-767.456) (-770.945) (-767.872) [-763.560] * (-768.148) (-772.833) [-767.061] (-766.460) -- 0:00:26
      592000 -- [-766.113] (-769.405) (-768.094) (-764.509) * (-766.386) (-767.899) (-768.344) [-763.966] -- 0:00:26
      592500 -- (-766.669) [-769.337] (-768.117) (-765.663) * (-765.302) (-771.558) (-767.396) [-766.869] -- 0:00:26
      593000 -- [-765.374] (-767.244) (-764.925) (-766.710) * (-766.760) (-767.780) [-765.852] (-766.866) -- 0:00:26
      593500 -- [-766.737] (-769.480) (-767.179) (-764.869) * [-765.816] (-765.647) (-767.633) (-766.480) -- 0:00:26
      594000 -- (-765.607) [-770.356] (-767.428) (-765.072) * (-770.754) (-769.123) [-765.258] (-764.093) -- 0:00:26
      594500 -- (-766.065) (-768.025) [-767.094] (-764.514) * (-769.741) [-765.031] (-768.682) (-770.292) -- 0:00:26
      595000 -- (-766.008) (-769.941) [-765.617] (-764.697) * (-768.040) [-766.161] (-766.936) (-768.095) -- 0:00:26

      Average standard deviation of split frequencies: 0.006048

      595500 -- (-765.281) (-770.212) [-763.745] (-765.335) * (-769.422) [-765.469] (-767.739) (-767.464) -- 0:00:26
      596000 -- (-767.146) (-771.458) [-767.267] (-767.270) * (-766.995) (-766.275) [-765.233] (-775.878) -- 0:00:26
      596500 -- [-765.067] (-769.402) (-765.839) (-767.946) * (-768.437) [-767.172] (-766.426) (-767.030) -- 0:00:26
      597000 -- [-766.149] (-764.561) (-766.946) (-765.419) * (-769.210) [-764.334] (-768.661) (-765.938) -- 0:00:26
      597500 -- [-765.722] (-768.480) (-766.236) (-765.476) * [-769.739] (-766.940) (-769.935) (-768.827) -- 0:00:26
      598000 -- (-767.169) (-769.641) (-768.796) [-764.865] * (-764.378) (-766.318) [-769.561] (-771.067) -- 0:00:26
      598500 -- [-766.935] (-775.487) (-768.014) (-768.996) * (-766.800) (-766.268) (-764.691) [-766.647] -- 0:00:26
      599000 -- (-768.169) [-766.512] (-766.654) (-766.253) * (-767.313) [-765.626] (-767.319) (-766.126) -- 0:00:26
      599500 -- (-766.897) (-769.711) [-767.902] (-768.217) * (-764.974) (-768.616) (-769.119) [-765.736] -- 0:00:26
      600000 -- (-769.732) [-772.494] (-768.480) (-765.030) * (-765.188) (-766.837) (-767.836) [-768.411] -- 0:00:25

      Average standard deviation of split frequencies: 0.005909

      600500 -- [-766.236] (-767.255) (-767.528) (-769.750) * (-766.752) (-766.465) (-765.170) [-767.647] -- 0:00:25
      601000 -- (-768.130) (-767.755) [-769.924] (-768.575) * (-765.904) (-765.574) [-765.707] (-768.804) -- 0:00:25
      601500 -- (-767.500) (-766.843) (-767.243) [-766.600] * [-766.131] (-767.396) (-765.799) (-767.506) -- 0:00:25
      602000 -- (-766.981) (-768.959) (-766.872) [-765.545] * [-766.279] (-767.948) (-766.288) (-768.973) -- 0:00:25
      602500 -- (-766.401) (-764.575) (-768.152) [-766.290] * [-767.690] (-768.177) (-766.841) (-770.327) -- 0:00:25
      603000 -- (-769.491) (-766.573) (-768.135) [-765.344] * (-771.419) [-766.025] (-768.619) (-770.418) -- 0:00:25
      603500 -- [-768.618] (-766.580) (-767.429) (-767.641) * (-769.013) [-765.771] (-768.976) (-773.921) -- 0:00:25
      604000 -- (-767.853) [-765.672] (-767.320) (-768.240) * (-767.522) (-766.267) [-766.362] (-773.360) -- 0:00:25
      604500 -- [-765.842] (-765.418) (-769.673) (-766.985) * (-764.469) (-766.380) [-766.356] (-767.420) -- 0:00:25
      605000 -- (-767.302) (-768.446) (-766.534) [-767.392] * (-766.361) (-770.236) [-768.624] (-767.391) -- 0:00:25

      Average standard deviation of split frequencies: 0.006132

      605500 -- [-765.156] (-769.156) (-768.070) (-768.582) * [-765.810] (-768.869) (-765.861) (-766.241) -- 0:00:25
      606000 -- (-765.185) (-768.202) [-767.923] (-769.265) * (-767.429) [-768.098] (-766.626) (-769.297) -- 0:00:26
      606500 -- (-764.415) [-766.415] (-775.156) (-766.073) * (-765.983) (-771.224) [-766.816] (-766.499) -- 0:00:25
      607000 -- (-765.853) (-768.296) [-770.865] (-767.300) * (-773.091) (-772.651) (-765.843) [-764.360] -- 0:00:25
      607500 -- [-766.286] (-765.572) (-766.347) (-767.231) * (-770.090) (-766.994) (-770.131) [-765.382] -- 0:00:25
      608000 -- (-768.027) [-766.898] (-767.453) (-766.402) * (-766.544) [-764.565] (-770.089) (-764.780) -- 0:00:25
      608500 -- (-765.213) [-766.427] (-768.641) (-769.321) * (-767.365) (-771.499) [-769.140] (-769.797) -- 0:00:25
      609000 -- (-765.142) (-765.163) [-768.641] (-767.609) * [-768.115] (-768.810) (-766.816) (-765.514) -- 0:00:25
      609500 -- (-768.668) (-768.549) [-769.106] (-774.074) * [-764.911] (-765.926) (-769.867) (-766.395) -- 0:00:25
      610000 -- [-766.331] (-765.790) (-767.891) (-765.946) * [-766.435] (-765.845) (-772.721) (-765.846) -- 0:00:25

      Average standard deviation of split frequencies: 0.006357

      610500 -- (-764.661) (-767.257) (-768.108) [-765.632] * (-766.820) [-764.924] (-769.838) (-765.915) -- 0:00:25
      611000 -- [-765.352] (-771.174) (-767.435) (-765.599) * (-766.676) [-767.221] (-765.686) (-766.839) -- 0:00:25
      611500 -- (-765.859) [-767.773] (-767.727) (-767.580) * (-765.706) (-767.417) [-766.945] (-766.292) -- 0:00:25
      612000 -- [-766.569] (-771.711) (-766.933) (-767.395) * (-768.225) (-768.384) (-767.677) [-766.486] -- 0:00:25
      612500 -- [-763.839] (-772.697) (-766.424) (-767.736) * (-770.243) [-766.428] (-766.390) (-766.609) -- 0:00:25
      613000 -- [-766.214] (-769.002) (-766.371) (-767.230) * (-771.987) (-767.021) (-766.658) [-763.920] -- 0:00:25
      613500 -- (-770.653) (-765.918) (-766.757) [-764.251] * (-767.524) (-766.589) (-766.595) [-765.554] -- 0:00:25
      614000 -- (-765.288) (-765.555) (-770.041) [-767.481] * (-770.322) (-765.575) (-766.970) [-769.655] -- 0:00:25
      614500 -- [-766.567] (-767.555) (-770.674) (-766.830) * (-771.214) (-764.978) (-774.662) [-767.930] -- 0:00:25
      615000 -- (-767.752) [-768.213] (-771.212) (-768.106) * [-771.252] (-767.626) (-766.913) (-767.556) -- 0:00:25

      Average standard deviation of split frequencies: 0.006302

      615500 -- [-768.909] (-766.249) (-766.792) (-768.817) * (-766.862) [-766.557] (-766.255) (-766.739) -- 0:00:24
      616000 -- (-764.941) [-766.055] (-765.681) (-770.390) * (-765.729) (-770.589) (-768.804) [-766.017] -- 0:00:24
      616500 -- (-767.586) [-765.812] (-768.730) (-770.998) * (-766.242) (-767.142) [-769.767] (-767.614) -- 0:00:24
      617000 -- (-768.824) (-766.201) (-766.251) [-768.311] * (-764.825) (-768.302) [-768.455] (-769.486) -- 0:00:24
      617500 -- (-765.220) (-765.512) (-770.399) [-769.475] * (-764.783) (-767.841) [-764.631] (-765.672) -- 0:00:24
      618000 -- (-765.911) (-766.399) [-769.233] (-768.650) * [-764.175] (-766.750) (-767.965) (-764.635) -- 0:00:24
      618500 -- (-766.311) (-763.850) (-768.798) [-764.235] * (-768.477) (-768.389) (-768.706) [-766.564] -- 0:00:24
      619000 -- (-767.796) (-764.020) [-770.771] (-765.148) * [-765.688] (-766.851) (-767.454) (-766.754) -- 0:00:24
      619500 -- (-766.461) (-768.294) (-773.534) [-767.276] * (-770.751) (-768.932) [-765.998] (-768.403) -- 0:00:24
      620000 -- (-766.680) (-767.121) [-767.021] (-766.736) * (-765.242) (-767.840) (-766.305) [-764.582] -- 0:00:24

      Average standard deviation of split frequencies: 0.005719

      620500 -- (-766.047) [-764.307] (-770.673) (-767.886) * (-766.069) (-767.424) (-765.646) [-764.176] -- 0:00:24
      621000 -- (-769.396) (-766.051) [-769.084] (-765.962) * [-766.483] (-771.292) (-768.545) (-766.253) -- 0:00:24
      621500 -- (-766.162) (-774.858) (-770.809) [-769.643] * (-764.917) [-766.019] (-768.709) (-766.986) -- 0:00:24
      622000 -- [-767.309] (-764.673) (-768.145) (-768.633) * (-765.807) [-767.569] (-769.181) (-766.852) -- 0:00:24
      622500 -- [-766.159] (-767.821) (-767.071) (-766.139) * (-766.464) [-770.507] (-768.322) (-766.134) -- 0:00:24
      623000 -- (-769.034) (-765.770) (-768.102) [-767.588] * (-769.828) (-766.178) (-772.492) [-764.758] -- 0:00:24
      623500 -- (-766.420) (-764.352) (-768.005) [-766.554] * (-769.324) [-765.633] (-766.529) (-766.419) -- 0:00:24
      624000 -- (-768.007) [-767.207] (-769.031) (-766.639) * (-773.076) (-769.292) (-768.700) [-766.706] -- 0:00:24
      624500 -- (-766.940) (-772.944) [-765.962] (-765.909) * (-767.626) (-765.493) (-770.012) [-766.904] -- 0:00:24
      625000 -- (-765.545) (-771.140) [-767.924] (-768.711) * (-769.228) (-766.766) [-766.881] (-769.009) -- 0:00:24

      Average standard deviation of split frequencies: 0.005847

      625500 -- (-765.354) [-766.679] (-767.257) (-767.717) * [-766.926] (-767.618) (-766.389) (-767.585) -- 0:00:24
      626000 -- (-767.549) (-766.834) (-767.784) [-766.441] * (-769.731) [-766.210] (-768.009) (-769.019) -- 0:00:24
      626500 -- (-766.973) (-766.264) (-768.017) [-765.645] * (-768.986) [-766.633] (-766.439) (-768.541) -- 0:00:24
      627000 -- [-766.588] (-767.842) (