--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:31:46 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ppiA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -765.70 -769.99
2 -765.74 -769.30
--------------------------------------
TOTAL -765.72 -769.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883036 0.090199 0.368067 1.486511 0.845293 1501.00 1501.00 1.000
r(A<->C){all} 0.150130 0.017608 0.000006 0.423978 0.112863 173.96 242.20 1.000
r(A<->G){all} 0.180099 0.023202 0.000088 0.481754 0.138199 130.82 200.50 1.012
r(A<->T){all} 0.150158 0.016189 0.000069 0.402082 0.117084 249.00 274.13 1.002
r(C<->G){all} 0.150459 0.017880 0.000016 0.417932 0.113251 224.49 235.60 1.000
r(C<->T){all} 0.207208 0.024505 0.000606 0.517668 0.173692 218.12 249.15 1.002
r(G<->T){all} 0.161946 0.019084 0.000214 0.450698 0.124604 270.70 301.15 1.000
pi(A){all} 0.224166 0.000315 0.192079 0.260853 0.223866 1355.70 1379.46 1.000
pi(C){all} 0.298174 0.000374 0.258319 0.334109 0.298114 1036.86 1066.35 1.000
pi(G){all} 0.264194 0.000336 0.227610 0.299611 0.263546 1184.50 1258.32 1.000
pi(T){all} 0.213467 0.000293 0.181259 0.247553 0.213126 1401.42 1438.21 1.000
alpha{1,2} 0.331018 0.160755 0.000219 1.094400 0.200225 680.09 997.18 1.000
alpha{3} 0.415117 0.238101 0.000130 1.361331 0.242220 1098.05 1227.22 1.000
pinvar{all} 0.993718 0.000026 0.983385 0.999838 0.995067 1192.02 1337.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -733.341772
Model 2: PositiveSelection -732.967827
Model 0: one-ratio -732.967682
Model 7: beta -733.341773
Model 8: beta&w>1 -732.967818
Model 0 vs 1 0.7481800000000476
Model 2 vs 1 0.7478899999998703
Model 8 vs 7 0.7479100000000471
>C1
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C2
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C3
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C4
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C5
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C6
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
C1 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C2 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C3 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C4 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C5 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C6 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
**************************************************
C1 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C2 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C3 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C4 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C5 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C6 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
**************************************************
C1 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C2 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C3 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C4 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C5 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C6 FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
*********.****************************************
C1 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C2 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C3 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C4 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C5 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C6 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5460]--->[5460]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.722 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C2 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C3 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C4 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C5 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
C6 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
**************************************************
C1 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C2 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C3 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C4 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C5 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
C6 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
**************************************************
C1 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C2 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C3 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C4 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C5 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
C6 FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
*********.****************************************
C1 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C2 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C3 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C4 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C5 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
C6 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.45 C1 C6 99.45
TOP 5 0 99.45 C6 C1 99.45
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.45 C2 C6 99.45
TOP 5 1 99.45 C6 C2 99.45
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.45 C3 C6 99.45
TOP 5 2 99.45 C6 C3 99.45
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.45 C4 C6 99.45
TOP 5 3 99.45 C6 C4 99.45
BOT 4 5 99.45 C5 C6 99.45
TOP 5 4 99.45 C6 C5 99.45
AVG 0 C1 * 99.89
AVG 1 C2 * 99.89
AVG 2 C3 * 99.89
AVG 3 C4 * 99.89
AVG 4 C5 * 99.89
AVG 5 C6 * 99.45
TOT TOT * 99.82
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C2 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C3 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C4 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C5 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
C6 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
**************************************************
C1 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C2 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C3 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C4 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C5 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
C6 CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
**************************************************
C1 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C2 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C3 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C4 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C5 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
C6 ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
**************************************************
C1 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C2 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C3 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C4 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C5 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
C6 GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
**************************************************
C1 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C2 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C3 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C4 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C5 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
C6 TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
**************************************************
C1 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C2 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C3 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C4 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C5 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
C6 ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
**************************************************
C1 TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C2 TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C3 TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C4 TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C5 TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
C6 TTCCACCCTGAGCTTCAGTTCGACAAATCCTACCTGCTAGCGATGGCCAA
*************************** **********************
C1 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C2 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C3 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C4 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C5 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
C6 TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
**************************************************
C1 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C2 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C3 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C4 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C5 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
C6 CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
**************************************************
C1 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C2 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C3 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C4 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C5 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
C6 GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
**************************************************
C1 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C2 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C3 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C4 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C5 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
C6 CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
**********************************************
>C1
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C2
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C3
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C4
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C5
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C6
ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC
CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC
ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG
GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA
TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG
ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA
TTCCACCCTGAGCTTCAGTTCGACAAATCCTACCTGCTAGCGATGGCCAA
TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA
CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT
GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA
CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>C1
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C2
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C3
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C4
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C5
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
>C6
MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 546 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579786221
Setting output file names to "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1903857506
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9256654698
Seed = 1894141969
Swapseed = 1579786221
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1225.376970 -- -24.965149
Chain 2 -- -1225.376788 -- -24.965149
Chain 3 -- -1225.377040 -- -24.965149
Chain 4 -- -1225.375491 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1225.376970 -- -24.965149
Chain 2 -- -1225.376788 -- -24.965149
Chain 3 -- -1225.377040 -- -24.965149
Chain 4 -- -1225.377040 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1225.377] (-1225.377) (-1225.377) (-1225.375) * [-1225.377] (-1225.377) (-1225.377) (-1225.377)
500 -- (-771.474) (-773.997) (-780.622) [-769.150] * (-772.557) (-767.822) [-772.100] (-777.611) -- 0:00:00
1000 -- [-767.604] (-772.355) (-778.772) (-770.808) * (-770.449) (-778.777) [-769.361] (-769.469) -- 0:00:00
1500 -- [-770.819] (-774.499) (-777.607) (-774.887) * [-769.312] (-769.724) (-771.443) (-778.121) -- 0:00:00
2000 -- (-773.847) (-773.492) [-769.975] (-777.380) * (-767.126) [-769.619] (-767.719) (-771.420) -- 0:00:00
2500 -- (-775.603) (-776.047) [-768.749] (-778.079) * [-770.366] (-771.293) (-771.897) (-773.260) -- 0:00:00
3000 -- (-774.341) (-771.591) (-772.255) [-774.239] * (-773.083) [-767.358] (-776.411) (-779.214) -- 0:00:00
3500 -- (-773.499) (-769.226) [-764.066] (-773.281) * [-773.161] (-780.346) (-769.064) (-775.179) -- 0:00:00
4000 -- (-772.817) (-774.609) [-766.357] (-769.392) * (-767.603) (-773.243) [-766.742] (-774.222) -- 0:00:00
4500 -- (-769.146) (-777.829) [-769.808] (-768.430) * (-762.702) (-770.817) [-770.844] (-772.043) -- 0:03:41
5000 -- [-769.257] (-771.456) (-780.690) (-771.371) * [-768.454] (-780.038) (-771.838) (-772.962) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- (-769.566) (-772.105) (-777.988) [-770.545] * (-768.048) (-772.143) [-769.957] (-777.434) -- 0:03:00
6000 -- (-779.314) (-773.916) [-771.654] (-776.108) * (-782.150) (-768.530) [-776.687] (-775.124) -- 0:02:45
6500 -- [-779.958] (-766.372) (-779.036) (-772.678) * (-775.641) [-770.133] (-780.338) (-770.487) -- 0:02:32
7000 -- (-770.788) [-774.145] (-781.726) (-775.586) * [-766.470] (-766.709) (-770.764) (-766.499) -- 0:02:21
7500 -- (-771.333) (-772.918) (-770.620) [-770.158] * (-777.292) [-771.331] (-769.715) (-776.209) -- 0:02:12
8000 -- (-778.046) (-776.240) (-774.548) [-769.664] * (-767.522) (-774.447) [-768.454] (-769.120) -- 0:02:04
8500 -- (-773.912) (-769.654) (-768.196) [-769.823] * [-770.073] (-780.363) (-766.885) (-776.781) -- 0:01:56
9000 -- (-766.169) (-766.795) (-768.511) [-766.610] * (-771.347) (-773.314) (-769.491) [-773.466] -- 0:01:50
9500 -- (-771.853) [-766.455] (-765.632) (-773.791) * (-771.767) (-770.658) (-777.743) [-770.927] -- 0:01:44
10000 -- (-771.238) (-773.154) (-765.803) [-768.502] * (-768.756) (-772.015) [-767.850] (-766.945) -- 0:01:39
Average standard deviation of split frequencies: 0.055243
10500 -- (-775.454) (-771.892) (-768.456) [-769.652] * (-767.708) (-770.331) [-770.935] (-770.732) -- 0:01:34
11000 -- [-774.771] (-774.555) (-768.319) (-770.536) * (-771.820) [-766.666] (-767.820) (-769.383) -- 0:01:29
11500 -- [-776.738] (-774.436) (-766.295) (-771.540) * (-776.047) (-764.867) (-772.764) [-773.240] -- 0:01:25
12000 -- [-769.056] (-777.979) (-766.327) (-771.719) * (-777.571) (-770.136) (-771.480) [-775.129] -- 0:01:22
12500 -- (-779.284) (-770.769) [-766.883] (-766.860) * (-767.516) (-771.999) (-773.736) [-769.345] -- 0:01:19
13000 -- [-769.631] (-772.485) (-768.132) (-782.652) * (-778.331) (-768.195) [-771.985] (-767.869) -- 0:01:15
13500 -- (-770.011) (-765.453) (-767.513) [-774.026] * (-770.723) (-776.011) [-770.391] (-771.251) -- 0:01:13
14000 -- [-769.929] (-771.894) (-768.721) (-769.210) * (-770.364) [-774.104] (-770.875) (-772.577) -- 0:01:10
14500 -- (-771.254) (-764.631) [-767.113] (-773.941) * (-770.936) (-768.595) (-773.309) [-766.337] -- 0:01:07
15000 -- [-774.402] (-774.006) (-765.695) (-779.908) * (-771.460) [-767.637] (-775.638) (-780.605) -- 0:01:05
Average standard deviation of split frequencies: 0.051172
15500 -- [-771.127] (-772.277) (-766.368) (-771.189) * [-765.939] (-772.924) (-775.834) (-774.075) -- 0:01:03
16000 -- [-773.839] (-772.450) (-766.592) (-766.949) * (-776.417) (-769.690) [-768.706] (-778.183) -- 0:01:01
16500 -- [-772.639] (-766.946) (-764.370) (-769.036) * (-777.281) (-774.434) [-769.638] (-775.625) -- 0:00:59
17000 -- (-772.308) [-764.350] (-765.197) (-768.699) * (-776.931) (-776.112) [-772.369] (-772.753) -- 0:00:57
17500 -- (-765.454) (-767.232) [-767.818] (-774.265) * [-771.096] (-768.761) (-776.678) (-773.879) -- 0:00:56
18000 -- (-767.067) [-767.234] (-767.145) (-770.907) * [-765.408] (-773.268) (-775.453) (-774.201) -- 0:00:54
18500 -- [-764.866] (-772.269) (-769.043) (-772.301) * [-766.871] (-781.935) (-779.253) (-768.237) -- 0:00:53
19000 -- [-772.226] (-765.520) (-769.537) (-767.187) * (-772.027) (-771.822) (-780.712) [-774.293] -- 0:00:51
19500 -- [-773.723] (-765.209) (-766.772) (-767.899) * (-780.248) [-767.259] (-768.989) (-767.754) -- 0:01:40
20000 -- (-768.271) (-764.775) (-770.691) [-772.827] * [-768.247] (-774.503) (-766.875) (-765.531) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- [-764.636] (-766.188) (-768.169) (-775.687) * (-771.729) [-770.960] (-764.083) (-766.846) -- 0:01:35
21000 -- (-774.609) [-765.399] (-765.794) (-776.206) * (-773.191) [-764.570] (-764.978) (-765.582) -- 0:01:33
21500 -- [-776.343] (-766.842) (-767.025) (-773.159) * (-768.814) (-779.581) [-765.953] (-765.074) -- 0:01:31
22000 -- (-777.232) (-765.766) [-768.747] (-777.868) * (-767.595) (-774.275) (-767.646) [-766.676] -- 0:01:28
22500 -- (-770.388) [-767.872] (-771.610) (-773.535) * (-770.767) (-771.555) (-766.742) [-765.481] -- 0:01:26
23000 -- (-778.434) (-768.409) (-769.470) [-775.936] * [-773.934] (-768.058) (-768.132) (-763.623) -- 0:01:24
23500 -- [-773.148] (-767.807) (-768.331) (-765.537) * (-771.330) [-772.026] (-771.793) (-767.008) -- 0:01:23
24000 -- (-772.063) (-764.522) (-768.952) [-768.448] * (-768.608) (-770.210) (-767.308) [-765.353] -- 0:01:21
24500 -- (-769.939) (-765.831) (-768.835) [-766.466] * (-766.229) [-773.486] (-767.182) (-764.823) -- 0:01:19
25000 -- (-769.765) (-763.938) (-768.191) [-768.703] * (-767.339) [-770.491] (-774.548) (-765.593) -- 0:01:18
Average standard deviation of split frequencies: 0.041207
25500 -- (-774.702) [-768.225] (-767.700) (-769.338) * (-765.537) (-774.535) (-771.914) [-770.808] -- 0:01:16
26000 -- (-777.635) (-766.226) (-766.828) [-763.909] * (-766.233) [-771.895] (-765.455) (-767.947) -- 0:01:14
26500 -- [-770.767] (-765.573) (-765.878) (-772.819) * (-766.838) [-770.852] (-766.939) (-766.645) -- 0:01:13
27000 -- [-768.275] (-767.073) (-767.728) (-778.434) * (-767.340) [-775.233] (-767.778) (-766.685) -- 0:01:12
27500 -- (-771.680) [-768.632] (-766.070) (-770.463) * (-768.745) (-772.330) [-767.337] (-765.726) -- 0:01:10
28000 -- (-772.043) (-767.965) (-765.300) [-769.338] * (-765.469) [-769.622] (-767.178) (-769.168) -- 0:01:09
28500 -- (-769.875) (-766.012) [-766.476] (-780.836) * [-766.766] (-767.503) (-766.654) (-768.568) -- 0:01:08
29000 -- (-769.193) [-767.521] (-769.007) (-778.246) * (-764.790) [-767.252] (-766.998) (-768.202) -- 0:01:06
29500 -- (-769.127) (-764.484) [-765.681] (-770.391) * [-767.648] (-773.288) (-767.421) (-767.724) -- 0:01:05
30000 -- (-779.767) (-768.389) [-768.198] (-770.902) * [-766.864] (-765.011) (-771.202) (-766.574) -- 0:01:04
Average standard deviation of split frequencies: 0.040452
30500 -- (-769.813) (-767.141) (-767.516) [-766.648] * (-770.011) [-770.316] (-767.904) (-766.999) -- 0:01:03
31000 -- (-772.462) [-767.474] (-780.747) (-769.281) * (-767.804) [-764.032] (-767.243) (-771.247) -- 0:01:02
31500 -- (-772.295) (-766.930) (-765.032) [-766.869] * (-765.999) [-765.588] (-765.483) (-769.928) -- 0:01:01
32000 -- (-772.825) (-764.338) (-765.013) [-766.075] * (-767.462) [-767.645] (-763.585) (-765.911) -- 0:01:00
32500 -- (-778.488) [-764.487] (-767.812) (-768.431) * (-769.805) [-770.366] (-767.837) (-766.042) -- 0:00:59
33000 -- [-770.200] (-772.501) (-763.585) (-766.570) * (-766.252) (-774.677) [-766.708] (-766.757) -- 0:00:58
33500 -- (-771.615) [-770.830] (-773.499) (-769.760) * [-767.044] (-775.065) (-765.913) (-765.352) -- 0:00:57
34000 -- (-766.213) [-765.127] (-767.069) (-765.845) * (-764.989) [-766.101] (-769.805) (-767.379) -- 0:01:25
34500 -- (-768.187) (-766.430) (-766.318) [-763.704] * (-766.428) [-770.929] (-767.761) (-768.275) -- 0:01:23
35000 -- [-771.744] (-767.820) (-769.540) (-765.034) * (-766.302) (-772.516) (-768.841) [-765.954] -- 0:01:22
Average standard deviation of split frequencies: 0.047795
35500 -- (-771.746) (-769.456) [-764.396] (-768.020) * (-767.544) (-773.691) [-764.459] (-770.707) -- 0:01:21
36000 -- (-773.113) (-767.386) (-765.205) [-765.604] * (-769.785) [-771.259] (-767.368) (-771.733) -- 0:01:20
36500 -- (-774.609) [-766.237] (-766.568) (-770.156) * (-765.603) (-781.838) [-763.949] (-768.112) -- 0:01:19
37000 -- [-770.733] (-767.112) (-771.806) (-767.971) * [-765.694] (-772.820) (-766.822) (-766.711) -- 0:01:18
37500 -- (-779.730) (-771.055) (-770.617) [-765.591] * (-770.866) (-767.344) (-764.916) [-765.101] -- 0:01:17
38000 -- [-775.616] (-766.128) (-769.701) (-771.233) * [-767.667] (-769.738) (-764.311) (-767.527) -- 0:01:15
38500 -- [-769.153] (-765.858) (-767.112) (-767.027) * (-771.398) (-767.961) [-766.755] (-768.256) -- 0:01:14
39000 -- [-768.023] (-766.178) (-768.157) (-764.361) * (-769.952) (-771.012) [-766.644] (-767.784) -- 0:01:13
39500 -- (-768.819) [-767.599] (-773.666) (-769.127) * (-768.831) [-764.951] (-766.610) (-772.948) -- 0:01:12
40000 -- [-766.627] (-764.365) (-764.695) (-766.262) * (-769.685) [-764.178] (-768.244) (-773.666) -- 0:01:12
Average standard deviation of split frequencies: 0.046947
40500 -- [-786.338] (-765.760) (-764.619) (-771.380) * (-771.851) [-765.821] (-764.863) (-767.711) -- 0:01:11
41000 -- [-772.693] (-766.488) (-765.898) (-766.930) * (-767.894) [-764.562] (-772.235) (-772.207) -- 0:01:10
41500 -- [-775.146] (-768.843) (-764.872) (-765.992) * (-767.098) (-768.223) [-767.011] (-767.016) -- 0:01:09
42000 -- [-767.518] (-773.520) (-765.390) (-763.510) * (-768.079) (-767.237) (-766.442) [-765.114] -- 0:01:08
42500 -- (-769.696) (-773.915) [-767.221] (-768.675) * (-768.243) (-772.401) (-766.970) [-765.868] -- 0:01:07
43000 -- (-767.850) (-767.425) [-767.880] (-766.130) * (-769.912) [-768.390] (-769.070) (-767.694) -- 0:01:06
43500 -- (-767.464) (-765.881) (-765.450) [-763.922] * (-764.662) [-766.896] (-771.565) (-768.012) -- 0:01:05
44000 -- (-768.877) (-769.348) (-766.730) [-767.023] * (-771.123) [-769.109] (-769.548) (-768.382) -- 0:01:05
44500 -- (-769.285) (-769.996) [-767.375] (-768.122) * (-769.933) [-766.314] (-767.279) (-767.206) -- 0:01:04
45000 -- (-768.786) (-766.167) (-768.257) [-767.025] * (-765.936) (-766.405) (-766.100) [-764.884] -- 0:01:03
Average standard deviation of split frequencies: 0.040526
45500 -- (-766.634) [-766.093] (-767.771) (-772.279) * (-766.388) (-767.724) [-766.667] (-765.172) -- 0:01:02
46000 -- (-766.391) [-764.618] (-766.455) (-771.303) * (-766.740) [-769.628] (-768.031) (-765.041) -- 0:01:02
46500 -- (-768.277) (-765.912) [-766.109] (-768.396) * [-766.591] (-765.735) (-770.875) (-768.026) -- 0:01:01
47000 -- (-767.479) [-766.547] (-768.738) (-766.786) * (-764.254) (-767.149) (-767.786) [-765.333] -- 0:01:00
47500 -- (-766.935) [-765.641] (-769.257) (-768.568) * (-767.149) (-768.335) [-767.230] (-765.530) -- 0:01:00
48000 -- (-768.412) [-767.760] (-765.764) (-766.927) * (-770.390) (-768.817) [-767.181] (-768.917) -- 0:00:59
48500 -- (-766.466) [-771.206] (-766.518) (-766.812) * (-766.674) (-766.502) (-767.203) [-769.179] -- 0:00:58
49000 -- [-767.445] (-772.745) (-765.686) (-767.703) * [-766.561] (-766.548) (-766.043) (-768.871) -- 0:00:58
49500 -- (-768.054) [-766.481] (-771.242) (-766.352) * (-766.434) (-767.924) (-766.441) [-766.671] -- 0:01:16
50000 -- [-766.009] (-768.398) (-766.027) (-766.695) * (-767.001) (-766.148) (-767.667) [-769.717] -- 0:01:16
Average standard deviation of split frequencies: 0.038908
50500 -- [-765.647] (-767.403) (-767.056) (-766.441) * (-767.909) [-767.887] (-767.499) (-765.155) -- 0:01:15
51000 -- (-766.134) (-766.453) [-767.410] (-763.642) * [-767.780] (-767.782) (-768.299) (-766.304) -- 0:01:14
51500 -- (-766.403) (-765.933) (-770.625) [-765.104] * [-766.335] (-770.774) (-765.832) (-766.673) -- 0:01:13
52000 -- (-768.916) [-766.583] (-766.938) (-765.740) * [-768.611] (-772.524) (-763.840) (-768.657) -- 0:01:12
52500 -- [-765.327] (-766.948) (-766.477) (-768.022) * [-765.407] (-768.748) (-764.684) (-768.325) -- 0:01:12
53000 -- [-765.744] (-766.912) (-767.618) (-766.445) * [-764.629] (-768.612) (-768.287) (-766.332) -- 0:01:11
53500 -- [-770.163] (-766.184) (-768.324) (-766.860) * (-765.908) (-767.961) (-769.283) [-767.430] -- 0:01:10
54000 -- [-772.944] (-766.608) (-771.897) (-765.483) * (-769.669) (-768.248) [-769.625] (-767.457) -- 0:01:10
54500 -- (-769.999) [-766.937] (-766.760) (-765.299) * (-768.564) (-767.123) (-770.659) [-766.080] -- 0:01:09
55000 -- (-771.154) (-767.285) [-765.024] (-769.215) * (-764.757) (-766.243) [-766.787] (-768.503) -- 0:01:08
Average standard deviation of split frequencies: 0.037498
55500 -- [-765.954] (-767.190) (-764.685) (-767.100) * [-766.329] (-768.028) (-772.455) (-768.659) -- 0:01:08
56000 -- (-766.008) (-766.765) [-766.170] (-775.156) * [-769.234] (-767.210) (-770.927) (-765.543) -- 0:01:07
56500 -- (-765.610) (-773.128) [-766.249] (-765.763) * (-768.462) [-767.608] (-766.694) (-765.395) -- 0:01:06
57000 -- (-766.677) (-767.938) (-765.876) [-765.868] * [-767.296] (-767.934) (-767.323) (-764.073) -- 0:01:06
57500 -- (-767.543) (-765.857) [-766.069] (-767.554) * (-770.860) (-767.918) (-765.396) [-763.015] -- 0:01:05
58000 -- (-768.469) (-766.706) (-769.749) [-766.687] * (-765.063) (-767.965) (-766.774) [-766.197] -- 0:01:04
58500 -- (-766.602) [-768.926] (-766.197) (-764.271) * [-767.752] (-768.617) (-767.348) (-766.690) -- 0:01:04
59000 -- (-766.162) (-764.835) (-764.227) [-765.548] * (-772.299) (-768.544) (-767.884) [-768.941] -- 0:01:03
59500 -- [-768.706] (-767.830) (-764.229) (-764.334) * (-768.145) [-766.218] (-769.918) (-768.943) -- 0:01:03
60000 -- (-768.150) [-765.494] (-765.064) (-769.631) * [-765.775] (-766.416) (-768.411) (-768.673) -- 0:01:02
Average standard deviation of split frequencies: 0.036909
60500 -- (-765.307) (-766.141) (-768.176) [-767.981] * (-764.992) (-766.763) (-766.816) [-770.657] -- 0:01:02
61000 -- [-766.655] (-765.550) (-764.771) (-765.162) * (-767.469) (-767.663) (-767.316) [-768.444] -- 0:01:01
61500 -- [-766.144] (-766.704) (-766.518) (-768.333) * (-764.219) (-766.284) (-770.872) [-763.540] -- 0:01:01
62000 -- (-766.313) [-768.283] (-767.096) (-764.987) * (-766.003) (-767.711) (-766.540) [-765.815] -- 0:01:00
62500 -- (-766.505) (-769.004) (-769.668) [-765.251] * (-766.170) (-769.138) [-765.563] (-765.215) -- 0:01:00
63000 -- (-773.389) [-768.886] (-767.752) (-767.619) * (-766.683) (-769.062) (-767.945) [-766.542] -- 0:00:59
63500 -- (-767.890) (-765.803) [-766.878] (-771.225) * (-766.158) [-768.421] (-766.919) (-764.846) -- 0:00:58
64000 -- [-768.086] (-767.021) (-765.698) (-768.103) * (-767.080) (-768.153) (-765.505) [-768.502] -- 0:00:58
64500 -- (-766.570) (-765.890) [-766.442] (-768.021) * (-766.264) [-765.395] (-767.347) (-765.867) -- 0:01:12
65000 -- (-765.966) [-766.864] (-768.317) (-770.883) * (-767.216) (-768.750) [-765.371] (-771.190) -- 0:01:11
Average standard deviation of split frequencies: 0.034738
65500 -- (-765.754) [-765.787] (-766.084) (-766.617) * (-768.014) [-765.935] (-764.147) (-769.306) -- 0:01:11
66000 -- (-768.934) [-765.093] (-767.320) (-766.728) * [-765.926] (-765.833) (-766.866) (-766.239) -- 0:01:10
66500 -- (-768.073) [-767.817] (-769.900) (-768.259) * (-765.460) (-766.407) (-765.016) [-774.984] -- 0:01:10
67000 -- (-767.507) [-766.464] (-769.244) (-769.704) * (-768.026) [-763.557] (-767.009) (-770.283) -- 0:01:09
67500 -- (-767.298) [-765.612] (-768.340) (-769.885) * (-765.749) (-765.654) (-766.558) [-766.864] -- 0:01:09
68000 -- (-767.961) (-766.071) [-766.992] (-771.331) * (-764.322) [-765.787] (-766.627) (-767.573) -- 0:01:08
68500 -- (-772.417) (-764.723) (-766.661) [-765.849] * (-766.220) (-772.375) (-767.288) [-765.985] -- 0:01:07
69000 -- (-766.060) (-766.896) (-766.808) [-767.626] * [-768.348] (-765.923) (-767.700) (-767.605) -- 0:01:07
69500 -- (-766.542) [-765.489] (-764.325) (-769.374) * (-771.109) [-765.898] (-766.590) (-765.971) -- 0:01:06
70000 -- (-767.779) (-767.089) [-766.916] (-768.211) * [-766.788] (-768.250) (-768.316) (-769.285) -- 0:01:06
Average standard deviation of split frequencies: 0.031353
70500 -- (-767.941) (-769.342) (-765.982) [-768.373] * (-766.038) [-767.152] (-768.211) (-766.576) -- 0:01:05
71000 -- [-766.623] (-766.582) (-774.637) (-765.912) * [-769.300] (-766.893) (-769.184) (-765.575) -- 0:01:05
71500 -- [-767.917] (-765.681) (-767.599) (-766.958) * [-767.171] (-767.842) (-766.907) (-765.151) -- 0:01:04
72000 -- [-765.012] (-764.311) (-766.868) (-766.288) * [-766.001] (-770.485) (-767.934) (-764.449) -- 0:01:04
72500 -- (-768.246) [-765.530] (-765.016) (-765.669) * (-769.850) (-768.121) (-767.598) [-765.808] -- 0:01:03
73000 -- (-767.092) (-764.238) (-771.745) [-764.671] * [-765.101] (-769.923) (-765.922) (-768.325) -- 0:01:03
73500 -- (-764.646) (-764.983) [-766.755] (-764.170) * (-764.851) (-769.821) [-767.177] (-768.118) -- 0:01:03
74000 -- (-765.511) (-765.812) [-766.244] (-768.385) * (-766.162) (-767.585) (-767.314) [-772.424] -- 0:01:02
74500 -- (-766.659) (-765.433) (-766.345) [-773.882] * [-766.172] (-766.843) (-767.360) (-766.169) -- 0:01:02
75000 -- [-766.092] (-764.169) (-768.035) (-769.173) * [-765.945] (-766.132) (-764.842) (-767.770) -- 0:01:01
Average standard deviation of split frequencies: 0.029381
75500 -- (-764.278) [-764.987] (-767.172) (-768.076) * (-764.785) (-763.786) (-766.233) [-765.554] -- 0:01:01
76000 -- (-765.137) (-769.807) (-764.984) [-765.749] * (-765.875) (-764.998) [-766.164] (-765.573) -- 0:01:00
76500 -- (-766.390) (-775.370) (-764.343) [-766.294] * (-765.284) (-767.565) [-765.674] (-767.202) -- 0:01:00
77000 -- (-765.707) [-769.163] (-769.623) (-769.030) * (-767.797) (-768.821) (-765.245) [-765.521] -- 0:00:59
77500 -- (-765.725) [-768.762] (-772.712) (-767.984) * [-766.269] (-766.352) (-764.609) (-766.249) -- 0:00:59
78000 -- (-768.268) [-766.111] (-766.952) (-764.889) * (-767.688) (-766.535) [-768.209] (-767.237) -- 0:00:59
78500 -- (-766.386) (-766.959) [-768.320] (-767.569) * (-767.184) [-767.012] (-767.037) (-766.928) -- 0:00:58
79000 -- (-763.972) (-768.775) (-766.209) [-765.856] * (-766.508) (-767.162) (-767.412) [-767.780] -- 0:00:58
79500 -- (-765.496) [-766.985] (-765.668) (-769.135) * [-765.687] (-771.012) (-767.153) (-769.765) -- 0:00:57
80000 -- (-766.237) [-767.780] (-764.584) (-764.015) * (-765.797) (-765.521) [-770.275] (-771.610) -- 0:01:09
Average standard deviation of split frequencies: 0.026759
80500 -- (-765.616) [-767.160] (-768.882) (-767.659) * (-764.935) (-766.284) (-771.017) [-766.824] -- 0:01:08
81000 -- (-766.018) (-767.479) [-764.968] (-767.008) * (-767.753) (-767.020) (-767.836) [-768.010] -- 0:01:08
81500 -- (-768.611) (-767.394) [-764.429] (-767.249) * [-767.911] (-766.696) (-765.654) (-764.972) -- 0:01:07
82000 -- (-766.580) [-767.766] (-771.029) (-768.550) * [-768.534] (-767.963) (-766.162) (-764.497) -- 0:01:07
82500 -- (-775.758) (-768.945) (-764.873) [-765.988] * (-768.457) [-767.174] (-763.554) (-765.394) -- 0:01:06
83000 -- (-767.859) (-768.087) (-765.578) [-765.002] * (-769.127) (-769.249) (-767.836) [-765.936] -- 0:01:06
83500 -- [-771.271] (-767.458) (-766.072) (-766.411) * (-766.982) (-776.467) [-764.212] (-764.839) -- 0:01:05
84000 -- (-767.491) [-768.117] (-766.041) (-768.709) * (-766.477) (-769.685) (-768.356) [-766.413] -- 0:01:05
84500 -- (-766.331) (-768.518) [-765.812] (-765.504) * (-766.088) (-770.596) [-766.999] (-765.778) -- 0:01:05
85000 -- (-766.552) (-768.528) [-766.268] (-767.654) * (-767.966) (-768.420) [-768.812] (-768.745) -- 0:01:04
Average standard deviation of split frequencies: 0.029234
85500 -- (-765.591) (-767.495) (-767.466) [-767.607] * (-765.606) (-769.620) (-766.143) [-768.585] -- 0:01:04
86000 -- [-765.154] (-767.798) (-764.212) (-768.759) * (-765.317) (-768.546) [-767.448] (-767.997) -- 0:01:03
86500 -- (-766.712) (-768.857) [-764.963] (-765.004) * (-767.499) (-769.838) [-765.239] (-768.576) -- 0:01:03
87000 -- (-767.762) (-767.608) (-764.245) [-767.158] * (-765.492) (-772.145) [-766.721] (-768.068) -- 0:01:02
87500 -- (-768.995) (-768.788) [-765.831] (-765.803) * (-765.017) (-765.247) (-767.080) [-768.944] -- 0:01:02
88000 -- (-769.887) (-766.690) (-767.084) [-766.586] * (-766.622) (-767.412) [-767.222] (-768.757) -- 0:01:02
88500 -- [-765.248] (-766.272) (-765.407) (-765.387) * (-766.593) (-767.818) [-766.735] (-772.703) -- 0:01:01
89000 -- [-764.551] (-765.870) (-767.825) (-765.529) * (-765.231) [-770.084] (-765.945) (-769.446) -- 0:01:01
89500 -- (-765.428) (-766.037) (-766.412) [-764.284] * (-765.399) (-777.855) [-765.341] (-768.349) -- 0:01:01
90000 -- (-766.263) (-767.538) (-767.051) [-765.835] * (-766.789) [-770.767] (-767.756) (-767.048) -- 0:01:00
Average standard deviation of split frequencies: 0.029280
90500 -- (-765.632) (-767.448) [-764.833] (-764.739) * (-767.830) [-767.643] (-766.345) (-772.207) -- 0:01:00
91000 -- (-764.779) (-762.989) (-767.277) [-764.195] * [-766.472] (-766.086) (-766.808) (-769.715) -- 0:00:59
91500 -- (-764.548) (-774.780) [-764.899] (-767.745) * (-765.684) (-767.880) [-765.167] (-770.418) -- 0:00:59
92000 -- [-765.052] (-765.991) (-768.469) (-766.293) * (-765.514) [-765.151] (-769.171) (-768.748) -- 0:00:59
92500 -- (-764.631) (-767.426) [-765.088] (-766.357) * [-765.626] (-768.574) (-765.754) (-768.725) -- 0:00:58
93000 -- [-767.700] (-768.335) (-771.375) (-770.575) * [-766.668] (-767.941) (-767.228) (-770.819) -- 0:00:58
93500 -- (-765.276) [-763.662] (-768.455) (-765.072) * [-767.165] (-773.960) (-768.545) (-767.888) -- 0:00:58
94000 -- (-766.202) [-763.770] (-767.220) (-767.319) * (-768.562) [-768.217] (-767.186) (-771.305) -- 0:00:57
94500 -- (-764.104) (-766.422) [-765.280] (-766.258) * (-767.907) [-763.675] (-766.020) (-768.116) -- 0:00:57
95000 -- (-764.082) [-767.414] (-767.585) (-766.529) * (-766.827) [-764.494] (-766.520) (-765.003) -- 0:00:57
Average standard deviation of split frequencies: 0.027826
95500 -- [-765.797] (-764.805) (-765.462) (-765.973) * (-766.328) [-767.090] (-765.786) (-767.867) -- 0:01:06
96000 -- (-765.865) (-766.293) [-764.365] (-768.925) * (-767.046) (-770.890) [-769.245] (-769.737) -- 0:01:05
96500 -- (-766.883) [-766.156] (-767.897) (-765.044) * [-766.481] (-767.950) (-766.184) (-766.694) -- 0:01:05
97000 -- (-766.798) [-764.708] (-766.428) (-765.938) * [-765.312] (-766.518) (-764.730) (-766.797) -- 0:01:05
97500 -- (-765.204) [-765.421] (-768.354) (-765.931) * [-765.547] (-765.999) (-765.906) (-770.771) -- 0:01:04
98000 -- (-768.384) (-768.113) [-765.417] (-771.084) * (-768.024) (-769.493) [-767.793] (-770.596) -- 0:01:04
98500 -- (-766.750) (-768.595) [-766.430] (-768.824) * (-769.942) (-766.241) [-765.918] (-771.196) -- 0:01:04
99000 -- (-765.187) [-768.215] (-765.889) (-768.062) * (-768.724) [-767.530] (-769.359) (-767.674) -- 0:01:03
99500 -- (-766.539) (-767.443) [-767.579] (-767.375) * (-764.679) [-767.198] (-772.156) (-766.798) -- 0:01:03
100000 -- [-765.374] (-763.777) (-769.333) (-767.119) * (-766.154) [-770.291] (-766.492) (-766.730) -- 0:01:02
Average standard deviation of split frequencies: 0.026796
100500 -- [-766.761] (-765.880) (-767.984) (-767.745) * (-765.534) (-770.691) (-765.434) [-768.905] -- 0:01:02
101000 -- (-767.732) (-765.145) [-764.416] (-767.195) * (-766.352) (-767.679) (-765.750) [-770.693] -- 0:01:02
101500 -- [-769.250] (-767.096) (-766.917) (-769.482) * (-767.752) (-767.884) [-766.131] (-776.201) -- 0:01:01
102000 -- [-769.632] (-765.633) (-768.538) (-767.897) * [-769.079] (-769.731) (-765.561) (-770.095) -- 0:01:01
102500 -- (-769.133) (-770.189) (-766.984) [-765.245] * [-766.848] (-767.369) (-767.140) (-767.474) -- 0:01:01
103000 -- (-774.675) [-767.332] (-767.632) (-771.813) * (-766.500) (-772.214) (-766.833) [-765.067] -- 0:01:00
103500 -- (-769.136) (-771.023) (-770.070) [-768.111] * [-768.273] (-767.833) (-765.526) (-765.307) -- 0:01:00
104000 -- (-767.312) (-769.073) [-764.804] (-767.281) * [-768.023] (-767.073) (-765.848) (-765.665) -- 0:01:00
104500 -- (-769.037) [-775.989] (-765.529) (-766.259) * [-765.546] (-770.249) (-770.794) (-765.146) -- 0:00:59
105000 -- (-763.436) (-765.231) (-767.052) [-766.828] * (-763.634) (-770.432) [-768.909] (-764.892) -- 0:00:59
Average standard deviation of split frequencies: 0.025045
105500 -- (-765.000) [-767.024] (-765.767) (-768.478) * (-767.560) (-766.058) (-769.513) [-763.396] -- 0:00:59
106000 -- [-766.314] (-765.893) (-765.359) (-766.995) * (-774.235) [-767.662] (-765.456) (-767.467) -- 0:00:59
106500 -- [-764.739] (-770.026) (-768.830) (-768.447) * [-766.028] (-767.087) (-764.672) (-765.843) -- 0:00:58
107000 -- (-764.595) (-768.541) [-766.158] (-768.653) * (-766.132) (-767.229) (-764.597) [-765.324] -- 0:00:58
107500 -- (-763.343) (-774.461) [-766.547] (-765.877) * [-766.303] (-765.980) (-766.553) (-766.119) -- 0:00:58
108000 -- (-764.733) [-766.317] (-765.960) (-768.169) * (-766.050) (-766.995) (-767.040) [-767.009] -- 0:00:57
108500 -- (-766.108) (-766.089) [-764.598] (-766.752) * (-767.298) [-768.693] (-765.513) (-765.465) -- 0:00:57
109000 -- [-763.992] (-766.490) (-767.399) (-767.753) * (-766.696) (-767.796) [-766.245] (-766.527) -- 0:00:57
109500 -- [-764.312] (-767.177) (-769.480) (-771.686) * (-772.545) (-770.831) [-766.091] (-766.626) -- 0:00:56
110000 -- (-768.572) (-766.526) [-767.044] (-768.051) * (-767.037) (-770.914) [-766.712] (-767.875) -- 0:00:56
Average standard deviation of split frequencies: 0.023989
110500 -- (-765.252) (-768.169) (-767.137) [-767.211] * (-768.090) (-768.106) (-765.093) [-767.284] -- 0:00:56
111000 -- (-764.383) (-766.190) [-765.611] (-767.810) * (-766.070) [-770.213] (-764.454) (-764.839) -- 0:01:04
111500 -- (-767.401) (-768.504) [-768.178] (-768.047) * (-766.627) [-766.027] (-765.188) (-768.352) -- 0:01:03
112000 -- (-765.725) (-766.956) (-768.117) [-769.028] * (-767.285) (-766.313) [-764.194] (-766.660) -- 0:01:03
112500 -- (-767.681) [-767.335] (-768.334) (-768.990) * (-766.622) (-766.444) (-764.113) [-766.731] -- 0:01:03
113000 -- (-764.758) (-769.451) (-769.227) [-769.932] * (-770.423) (-767.203) (-767.598) [-765.556] -- 0:01:02
113500 -- (-765.075) [-765.379] (-767.853) (-768.651) * [-767.503] (-768.190) (-767.073) (-766.746) -- 0:01:02
114000 -- (-769.152) (-769.558) [-768.475] (-768.227) * (-768.686) (-767.219) [-764.938] (-768.812) -- 0:01:02
114500 -- (-768.165) (-768.220) [-766.800] (-766.516) * (-769.077) (-769.046) (-764.852) [-766.437] -- 0:01:01
115000 -- [-767.529] (-769.279) (-768.109) (-767.912) * (-767.043) (-768.312) (-767.623) [-768.546] -- 0:01:01
Average standard deviation of split frequencies: 0.023741
115500 -- (-765.452) [-768.596] (-767.976) (-767.868) * [-768.661] (-767.766) (-767.550) (-770.923) -- 0:01:01
116000 -- (-765.266) [-765.818] (-766.884) (-768.198) * (-765.157) (-767.936) [-766.556] (-766.021) -- 0:01:00
116500 -- [-767.985] (-764.212) (-765.217) (-766.550) * (-767.572) (-768.658) (-767.676) [-768.025] -- 0:01:00
117000 -- [-766.357] (-766.596) (-766.560) (-766.858) * (-765.069) (-766.129) [-765.381] (-767.637) -- 0:01:00
117500 -- (-765.094) (-771.971) (-766.946) [-767.500] * (-766.737) [-765.967] (-766.895) (-767.223) -- 0:01:00
118000 -- [-764.403] (-769.385) (-768.781) (-767.447) * (-766.525) (-770.479) [-771.294] (-764.531) -- 0:00:59
118500 -- (-767.486) (-767.686) [-767.201] (-766.417) * (-769.567) (-766.645) (-770.743) [-766.477] -- 0:00:59
119000 -- (-767.082) (-765.142) (-769.472) [-767.251] * (-769.619) (-766.604) [-765.230] (-765.332) -- 0:00:59
119500 -- [-766.026] (-767.600) (-766.973) (-766.948) * (-769.865) (-768.844) (-771.683) [-770.322] -- 0:00:58
120000 -- (-766.480) (-770.978) (-772.293) [-765.867] * [-767.317] (-766.963) (-770.036) (-766.130) -- 0:00:58
Average standard deviation of split frequencies: 0.027542
120500 -- (-767.293) (-769.882) [-767.152] (-770.567) * [-766.303] (-767.702) (-770.011) (-765.044) -- 0:00:58
121000 -- (-765.311) [-765.668] (-769.397) (-768.855) * (-765.863) (-767.351) [-771.704] (-769.784) -- 0:00:58
121500 -- [-765.006] (-766.681) (-767.077) (-770.994) * (-768.938) [-766.602] (-775.043) (-765.565) -- 0:00:57
122000 -- [-767.418] (-767.451) (-766.232) (-766.643) * [-765.770] (-766.413) (-764.112) (-766.563) -- 0:00:57
122500 -- (-767.598) (-766.714) (-765.456) [-770.649] * (-769.452) (-767.256) [-766.447] (-765.972) -- 0:00:57
123000 -- (-765.242) (-769.811) (-767.991) [-769.214] * [-770.550] (-769.539) (-767.950) (-766.147) -- 0:00:57
123500 -- (-765.845) (-766.839) (-766.853) [-767.640] * (-768.854) (-769.376) (-768.766) [-764.837] -- 0:00:56
124000 -- (-763.492) (-769.923) [-766.830] (-767.862) * (-769.866) (-773.422) (-773.091) [-765.561] -- 0:00:56
124500 -- [-764.576] (-767.053) (-766.116) (-766.378) * (-765.337) (-769.803) [-765.287] (-767.649) -- 0:00:56
125000 -- (-764.042) (-767.416) [-765.769] (-768.909) * [-767.920] (-769.625) (-766.863) (-769.802) -- 0:00:56
Average standard deviation of split frequencies: 0.023695
125500 -- [-763.248] (-765.365) (-767.879) (-768.861) * (-771.342) [-768.235] (-766.198) (-769.304) -- 0:01:02
126000 -- [-765.139] (-764.569) (-766.156) (-767.801) * (-766.359) (-768.327) (-767.382) [-769.770] -- 0:01:02
126500 -- (-765.965) [-766.967] (-765.923) (-769.315) * [-764.279] (-771.759) (-765.688) (-767.207) -- 0:01:02
127000 -- (-765.279) (-767.697) (-767.765) [-766.294] * (-765.706) (-767.961) [-766.597] (-768.479) -- 0:01:01
127500 -- [-765.965] (-765.891) (-766.015) (-766.211) * [-765.962] (-768.847) (-768.237) (-765.049) -- 0:01:01
128000 -- (-766.122) [-766.584] (-767.850) (-768.693) * [-765.890] (-768.223) (-768.580) (-764.322) -- 0:01:01
128500 -- (-766.599) (-764.717) [-767.948] (-767.831) * [-765.057] (-772.240) (-765.383) (-768.036) -- 0:01:01
129000 -- (-768.403) [-767.222] (-766.440) (-765.592) * (-767.527) [-765.843] (-765.645) (-768.099) -- 0:01:00
129500 -- (-767.602) (-766.640) (-766.969) [-767.088] * (-766.121) (-766.848) (-766.035) [-764.357] -- 0:01:00
130000 -- [-767.584] (-766.628) (-765.215) (-765.852) * (-766.070) (-766.926) [-768.743] (-764.824) -- 0:01:00
Average standard deviation of split frequencies: 0.024853
130500 -- (-771.145) (-764.971) [-768.103] (-766.622) * (-768.157) (-768.753) [-771.203] (-765.292) -- 0:00:59
131000 -- (-769.211) [-765.617] (-764.784) (-767.450) * (-770.234) (-766.059) [-772.635] (-767.115) -- 0:00:59
131500 -- [-769.055] (-764.638) (-765.981) (-766.575) * (-773.882) (-768.224) (-771.981) [-768.307] -- 0:00:59
132000 -- (-768.930) (-764.613) [-768.841] (-765.584) * (-766.756) (-767.710) [-766.266] (-765.523) -- 0:00:59
132500 -- (-765.101) (-770.190) (-765.687) [-767.586] * (-766.612) (-769.967) [-767.854] (-763.390) -- 0:00:58
133000 -- (-763.649) (-771.315) (-764.217) [-766.006] * (-769.353) (-767.663) [-771.704] (-765.112) -- 0:00:58
133500 -- (-763.760) (-765.092) (-768.467) [-767.894] * (-768.059) [-767.611] (-767.802) (-764.897) -- 0:00:58
134000 -- (-766.008) [-769.759] (-768.789) (-765.281) * (-770.868) (-767.725) (-766.170) [-765.258] -- 0:00:58
134500 -- [-765.925] (-766.376) (-768.068) (-767.038) * (-765.933) [-767.891] (-767.010) (-763.792) -- 0:00:57
135000 -- [-766.566] (-765.962) (-765.508) (-765.567) * (-764.916) [-767.004] (-767.853) (-765.406) -- 0:00:57
Average standard deviation of split frequencies: 0.025723
135500 -- (-764.415) (-768.951) [-765.752] (-767.318) * (-766.125) (-766.847) (-767.256) [-765.637] -- 0:00:57
136000 -- (-764.796) (-766.032) (-767.243) [-766.795] * (-764.662) [-764.754] (-768.683) (-768.787) -- 0:00:57
136500 -- (-766.391) (-770.783) [-765.824] (-766.789) * [-765.120] (-766.808) (-768.864) (-765.891) -- 0:00:56
137000 -- [-764.449] (-769.472) (-768.057) (-767.420) * [-767.135] (-767.082) (-768.244) (-772.255) -- 0:00:56
137500 -- [-766.252] (-766.587) (-765.773) (-768.038) * (-768.596) (-767.242) [-769.387] (-770.649) -- 0:00:56
138000 -- (-771.451) (-769.328) [-763.036] (-770.275) * (-765.765) (-765.035) [-766.293] (-765.605) -- 0:00:56
138500 -- [-768.547] (-769.148) (-766.940) (-768.812) * (-766.268) (-767.689) (-769.890) [-764.480] -- 0:00:55
139000 -- (-765.812) [-767.683] (-768.318) (-765.649) * (-765.886) (-767.561) [-766.106] (-771.233) -- 0:00:55
139500 -- [-768.750] (-767.707) (-766.574) (-765.726) * (-768.838) (-767.339) [-767.336] (-767.871) -- 0:00:55
140000 -- [-765.843] (-766.164) (-770.335) (-767.207) * (-764.998) (-766.287) (-772.566) [-765.607] -- 0:01:01
Average standard deviation of split frequencies: 0.028485
140500 -- (-769.779) [-766.570] (-769.555) (-765.188) * (-766.863) (-767.983) (-766.680) [-765.452] -- 0:01:01
141000 -- [-772.352] (-768.584) (-766.401) (-768.833) * (-766.301) (-770.670) (-767.851) [-765.152] -- 0:01:00
141500 -- (-766.395) (-769.841) [-767.073] (-766.942) * (-765.501) (-766.678) [-767.845] (-769.510) -- 0:01:00
142000 -- (-767.899) (-770.282) [-767.773] (-765.091) * (-766.998) (-771.299) [-764.483] (-772.851) -- 0:01:00
142500 -- (-766.590) (-768.202) (-766.898) [-763.911] * (-776.394) (-771.502) [-766.086] (-766.759) -- 0:01:00
143000 -- (-765.989) (-766.222) (-767.101) [-767.146] * (-769.665) (-769.255) (-766.222) [-768.909] -- 0:00:59
143500 -- (-768.121) (-766.256) (-769.889) [-765.371] * (-768.250) [-765.130] (-768.091) (-768.888) -- 0:00:59
144000 -- (-766.757) (-767.742) (-767.502) [-769.281] * (-766.752) [-764.741] (-768.244) (-766.380) -- 0:00:59
144500 -- [-765.776] (-772.175) (-768.951) (-768.942) * [-765.408] (-767.959) (-767.093) (-766.407) -- 0:00:59
145000 -- (-765.425) (-769.860) (-768.332) [-769.715] * (-768.301) (-769.200) (-768.889) [-768.836] -- 0:00:58
Average standard deviation of split frequencies: 0.023451
145500 -- (-765.878) (-766.837) (-769.228) [-769.928] * [-765.732] (-768.322) (-769.566) (-765.073) -- 0:00:58
146000 -- (-767.936) [-766.160] (-769.481) (-767.996) * (-765.894) (-767.388) (-770.770) [-771.164] -- 0:00:58
146500 -- [-765.232] (-767.661) (-768.694) (-767.300) * (-764.279) [-764.439] (-770.200) (-765.914) -- 0:00:58
147000 -- [-769.086] (-765.279) (-770.031) (-768.753) * (-766.259) [-766.558] (-766.301) (-772.158) -- 0:00:58
147500 -- [-764.814] (-765.910) (-770.265) (-768.303) * (-766.645) (-767.982) [-767.332] (-767.945) -- 0:00:57
148000 -- (-772.519) [-767.861] (-769.880) (-769.438) * (-771.331) (-765.501) [-767.193] (-766.675) -- 0:00:57
148500 -- (-764.179) (-768.434) [-768.252] (-768.744) * (-769.366) (-771.503) [-764.268] (-768.280) -- 0:00:57
149000 -- [-767.458] (-766.016) (-769.479) (-767.859) * [-767.210] (-767.502) (-767.160) (-770.397) -- 0:00:57
149500 -- (-771.129) (-766.780) [-768.989] (-768.236) * (-769.496) [-767.482] (-767.896) (-767.735) -- 0:00:56
150000 -- [-767.821] (-769.996) (-769.859) (-767.695) * (-768.872) [-769.610] (-769.097) (-766.831) -- 0:00:56
Average standard deviation of split frequencies: 0.022075
150500 -- (-768.251) [-768.374] (-771.487) (-768.127) * (-769.029) (-766.889) [-766.346] (-770.520) -- 0:00:56
151000 -- (-767.726) (-769.013) [-765.563] (-768.147) * (-764.834) [-767.605] (-770.791) (-768.173) -- 0:00:56
151500 -- (-769.068) (-765.991) (-768.272) [-767.182] * (-766.009) [-767.578] (-768.415) (-766.370) -- 0:00:56
152000 -- (-769.497) [-766.255] (-767.495) (-768.913) * (-765.008) [-766.150] (-768.527) (-773.114) -- 0:00:55
152500 -- (-768.117) [-769.238] (-766.942) (-765.957) * (-767.249) (-769.421) (-767.079) [-767.503] -- 0:00:55
153000 -- (-767.274) [-766.923] (-768.181) (-767.060) * (-765.909) [-766.686] (-769.512) (-766.591) -- 0:00:55
153500 -- (-769.249) (-763.607) (-767.687) [-767.410] * (-772.436) (-765.827) [-767.029] (-766.355) -- 0:00:55
154000 -- (-769.121) (-764.810) [-767.383] (-765.724) * [-769.097] (-766.123) (-768.329) (-764.492) -- 0:00:54
154500 -- (-768.424) [-767.170] (-766.081) (-766.278) * (-771.140) (-769.179) [-766.055] (-763.990) -- 0:00:54
155000 -- [-766.047] (-765.817) (-764.106) (-770.031) * (-768.064) (-768.137) [-766.280] (-765.855) -- 0:00:54
Average standard deviation of split frequencies: 0.023286
155500 -- [-768.886] (-766.934) (-766.975) (-766.551) * [-764.973] (-768.468) (-769.241) (-764.959) -- 0:00:59
156000 -- [-766.587] (-767.084) (-766.250) (-765.663) * (-764.975) (-769.473) [-765.713] (-766.857) -- 0:00:59
156500 -- (-769.604) [-766.306] (-767.689) (-766.663) * (-764.171) [-768.969] (-769.726) (-769.999) -- 0:00:59
157000 -- (-769.987) (-767.416) (-766.535) [-766.562] * (-766.706) (-768.173) (-768.489) [-771.008] -- 0:00:59
157500 -- (-768.001) [-766.492] (-766.171) (-766.201) * (-770.287) (-767.065) [-766.067] (-765.958) -- 0:00:58
158000 -- [-768.339] (-767.091) (-766.911) (-765.889) * (-767.812) (-766.608) [-766.514] (-766.380) -- 0:00:58
158500 -- [-766.824] (-769.899) (-765.803) (-767.215) * (-767.480) (-769.472) (-766.132) [-766.634] -- 0:00:58
159000 -- (-766.396) (-765.832) [-764.107] (-770.839) * (-766.064) (-768.493) (-767.176) [-764.955] -- 0:00:58
159500 -- (-767.666) [-767.465] (-765.627) (-766.296) * [-765.973] (-768.375) (-767.008) (-769.516) -- 0:00:57
160000 -- (-769.526) (-767.247) [-764.398] (-768.039) * (-767.773) (-770.384) [-766.690] (-765.224) -- 0:00:57
Average standard deviation of split frequencies: 0.024335
160500 -- (-767.258) (-767.077) [-766.483] (-767.320) * (-765.920) (-768.417) (-769.530) [-764.329] -- 0:00:57
161000 -- [-768.359] (-765.734) (-765.386) (-770.643) * (-766.307) [-766.175] (-766.216) (-765.780) -- 0:00:57
161500 -- (-769.704) (-766.308) [-767.270] (-769.155) * (-767.015) (-767.370) (-768.248) [-766.163] -- 0:00:57
162000 -- (-767.371) (-767.481) (-765.606) [-766.668] * (-768.252) [-766.803] (-765.784) (-767.515) -- 0:00:56
162500 -- [-770.964] (-765.102) (-767.765) (-766.914) * (-767.678) (-767.421) (-768.515) [-766.903] -- 0:00:56
163000 -- [-767.622] (-765.218) (-765.232) (-765.515) * [-767.377] (-768.363) (-770.557) (-767.076) -- 0:00:56
163500 -- [-766.356] (-766.638) (-766.049) (-767.411) * (-768.193) (-768.316) (-766.688) [-768.357] -- 0:00:56
164000 -- (-766.264) (-769.516) [-765.356] (-767.268) * (-765.493) [-766.605] (-765.509) (-766.890) -- 0:00:56
164500 -- (-764.658) [-763.928] (-770.449) (-767.676) * [-764.757] (-766.347) (-769.051) (-766.290) -- 0:00:55
165000 -- [-764.286] (-768.369) (-765.288) (-765.175) * (-766.621) (-767.260) (-767.050) [-766.570] -- 0:00:55
Average standard deviation of split frequencies: 0.022245
165500 -- [-766.425] (-766.542) (-768.709) (-768.036) * (-767.047) [-769.456] (-767.998) (-766.221) -- 0:00:55
166000 -- (-767.352) (-766.899) (-769.294) [-766.260] * (-765.312) [-765.417] (-765.680) (-768.081) -- 0:00:55
166500 -- (-769.135) [-766.619] (-769.407) (-766.318) * (-766.499) (-766.163) [-768.049] (-767.478) -- 0:00:55
167000 -- (-766.746) (-765.697) [-770.142] (-768.505) * (-769.489) (-767.221) (-770.699) [-765.986] -- 0:00:54
167500 -- (-766.685) [-772.287] (-765.485) (-769.504) * [-770.559] (-770.178) (-765.881) (-768.550) -- 0:00:54
168000 -- [-766.350] (-768.505) (-768.517) (-767.082) * (-765.442) (-769.799) (-771.598) [-764.067] -- 0:00:54
168500 -- (-765.735) [-765.826] (-766.683) (-771.140) * [-767.153] (-769.763) (-769.531) (-766.719) -- 0:00:54
169000 -- (-765.097) (-766.714) [-767.569] (-766.401) * [-767.127] (-766.230) (-770.567) (-763.364) -- 0:00:54
169500 -- (-764.464) (-767.200) [-767.000] (-765.216) * [-769.234] (-767.637) (-767.364) (-765.089) -- 0:00:53
170000 -- (-768.251) (-767.088) [-768.842] (-766.936) * (-767.786) (-765.911) [-766.085] (-765.028) -- 0:00:53
Average standard deviation of split frequencies: 0.020716
170500 -- (-769.194) (-767.090) [-766.848] (-765.586) * (-767.768) (-768.731) (-766.114) [-765.164] -- 0:00:53
171000 -- (-766.142) (-766.687) [-766.677] (-764.419) * [-767.584] (-768.006) (-766.649) (-765.036) -- 0:00:58
171500 -- (-764.608) (-767.237) [-766.981] (-765.796) * (-769.666) [-769.472] (-764.876) (-765.712) -- 0:00:57
172000 -- [-765.349] (-768.511) (-769.154) (-765.850) * [-768.590] (-770.260) (-767.511) (-764.445) -- 0:00:57
172500 -- [-765.339] (-766.427) (-769.659) (-767.844) * (-768.164) (-767.934) (-766.417) [-765.718] -- 0:00:57
173000 -- [-766.159] (-764.583) (-766.040) (-767.899) * (-768.497) [-766.982] (-768.101) (-763.566) -- 0:00:57
173500 -- (-767.687) (-764.877) [-764.557] (-765.108) * [-766.347] (-768.116) (-767.641) (-766.051) -- 0:00:57
174000 -- (-767.390) (-766.706) (-769.199) [-766.645] * [-767.560] (-770.862) (-767.211) (-770.067) -- 0:00:56
174500 -- (-766.561) (-766.266) [-763.496] (-769.320) * [-767.057] (-767.863) (-770.809) (-766.883) -- 0:00:56
175000 -- (-770.775) (-768.111) [-764.911] (-767.388) * [-767.223] (-765.970) (-767.899) (-769.205) -- 0:00:56
Average standard deviation of split frequencies: 0.020981
175500 -- (-772.597) [-764.461] (-769.349) (-767.034) * (-767.253) (-767.510) [-767.095] (-768.102) -- 0:00:56
176000 -- [-767.354] (-764.469) (-768.511) (-769.474) * [-767.168] (-766.566) (-767.831) (-766.276) -- 0:00:56
176500 -- (-767.162) [-765.060] (-764.376) (-772.206) * [-767.042] (-767.105) (-766.287) (-765.965) -- 0:00:55
177000 -- (-766.153) (-766.678) [-765.517] (-766.008) * (-768.849) [-767.274] (-763.514) (-765.320) -- 0:00:55
177500 -- (-769.092) (-766.080) (-764.755) [-769.539] * (-767.729) (-766.739) [-765.751] (-766.731) -- 0:00:55
178000 -- (-766.336) [-769.169] (-765.827) (-767.805) * (-775.438) (-767.483) (-765.334) [-764.840] -- 0:00:55
178500 -- (-764.598) (-766.224) (-764.577) [-768.530] * (-766.495) (-768.103) (-770.740) [-763.386] -- 0:00:55
179000 -- [-769.062] (-764.854) (-763.919) (-768.516) * (-769.286) (-768.834) (-767.002) [-764.888] -- 0:00:55
179500 -- (-767.066) [-764.666] (-765.179) (-768.999) * [-765.927] (-766.713) (-766.552) (-764.114) -- 0:00:54
180000 -- (-766.814) (-768.842) [-765.059] (-770.185) * (-765.385) (-767.437) (-767.404) [-766.759] -- 0:00:54
Average standard deviation of split frequencies: 0.021599
180500 -- [-767.440] (-766.716) (-765.540) (-768.549) * (-765.355) [-766.923] (-766.843) (-764.798) -- 0:00:54
181000 -- (-767.290) (-768.726) (-769.161) [-769.109] * (-773.523) [-766.446] (-766.382) (-766.184) -- 0:00:54
181500 -- (-767.472) (-765.214) [-766.255] (-770.824) * (-769.138) (-767.019) (-767.964) [-767.939] -- 0:00:54
182000 -- (-768.347) [-765.402] (-767.370) (-766.733) * [-767.815] (-767.569) (-767.716) (-768.104) -- 0:00:53
182500 -- (-767.974) [-764.771] (-768.218) (-768.154) * [-768.302] (-766.892) (-769.078) (-766.759) -- 0:00:53
183000 -- [-767.119] (-765.057) (-764.924) (-770.236) * (-765.429) (-771.387) (-767.850) [-771.803] -- 0:00:53
183500 -- (-766.942) (-766.984) (-769.253) [-767.694] * [-765.272] (-773.344) (-767.733) (-773.467) -- 0:00:53
184000 -- [-765.944] (-765.743) (-764.310) (-766.709) * (-764.910) [-769.659] (-767.313) (-767.943) -- 0:00:53
184500 -- (-766.613) (-765.981) [-764.473] (-771.477) * [-764.416] (-767.198) (-767.047) (-764.657) -- 0:00:53
185000 -- [-766.828] (-766.390) (-765.807) (-768.885) * [-767.328] (-769.606) (-769.250) (-766.697) -- 0:00:52
Average standard deviation of split frequencies: 0.020542
185500 -- (-770.821) (-775.371) (-767.114) [-765.747] * (-771.395) (-766.330) (-769.356) [-768.176] -- 0:00:52
186000 -- (-767.912) (-765.563) (-767.153) [-764.721] * (-765.947) [-767.490] (-770.059) (-767.790) -- 0:00:52
186500 -- (-766.785) (-768.090) [-766.532] (-767.278) * (-767.081) [-769.436] (-767.332) (-766.084) -- 0:00:56
187000 -- (-769.158) (-764.640) [-765.296] (-766.460) * (-766.816) (-770.288) [-767.830] (-766.009) -- 0:00:56
187500 -- [-766.796] (-768.641) (-772.859) (-769.066) * (-766.943) (-768.780) (-766.369) [-764.468] -- 0:00:56
188000 -- (-765.756) (-768.026) (-765.496) [-767.283] * [-765.478] (-768.205) (-767.532) (-766.629) -- 0:00:56
188500 -- (-766.212) [-767.553] (-765.430) (-767.367) * [-766.994] (-766.585) (-766.728) (-766.383) -- 0:00:55
189000 -- (-767.965) (-765.830) (-770.405) [-766.165] * (-764.727) (-769.393) (-769.300) [-766.936] -- 0:00:55
189500 -- (-767.810) [-765.274] (-771.305) (-766.444) * (-766.537) (-764.634) [-768.395] (-768.706) -- 0:00:55
190000 -- (-766.803) (-765.239) (-766.768) [-766.941] * (-765.661) [-764.847] (-766.336) (-766.095) -- 0:00:55
Average standard deviation of split frequencies: 0.020820
190500 -- [-767.568] (-765.917) (-767.479) (-768.545) * (-767.515) (-767.333) [-767.285] (-765.957) -- 0:00:55
191000 -- [-768.327] (-770.371) (-763.673) (-773.395) * (-766.668) (-767.394) (-768.475) [-765.563] -- 0:00:55
191500 -- (-767.440) [-764.755] (-766.651) (-766.831) * [-765.603] (-766.678) (-770.102) (-765.511) -- 0:00:54
192000 -- (-770.477) (-763.279) [-764.913] (-766.894) * (-766.105) (-766.607) (-768.083) [-763.958] -- 0:00:54
192500 -- (-769.773) (-766.112) [-765.941] (-766.764) * (-767.445) [-766.171] (-767.157) (-763.898) -- 0:00:54
193000 -- (-767.931) (-764.808) (-768.475) [-768.181] * (-771.035) (-769.206) (-767.592) [-764.196] -- 0:00:54
193500 -- [-765.665] (-771.041) (-766.492) (-769.812) * (-773.906) (-768.340) (-768.503) [-764.947] -- 0:00:54
194000 -- (-769.642) [-767.415] (-767.413) (-767.154) * (-766.960) (-767.719) (-768.052) [-764.828] -- 0:00:54
194500 -- [-766.913] (-770.212) (-774.102) (-767.143) * [-766.838] (-767.449) (-766.996) (-766.287) -- 0:00:53
195000 -- (-766.489) [-770.021] (-769.962) (-767.329) * [-765.033] (-768.911) (-767.629) (-765.279) -- 0:00:53
Average standard deviation of split frequencies: 0.021899
195500 -- [-766.312] (-768.600) (-766.806) (-769.379) * (-766.661) (-765.707) [-764.936] (-767.060) -- 0:00:53
196000 -- [-764.442] (-767.737) (-766.766) (-768.407) * (-765.634) (-768.233) [-767.078] (-764.364) -- 0:00:53
196500 -- (-766.499) (-767.777) (-767.185) [-764.447] * (-766.436) (-765.428) [-767.109] (-765.080) -- 0:00:53
197000 -- (-769.667) (-765.595) (-768.553) [-765.707] * (-764.379) (-771.992) (-767.175) [-766.530] -- 0:00:52
197500 -- [-767.048] (-768.897) (-764.212) (-769.417) * [-765.846] (-766.350) (-770.741) (-765.293) -- 0:00:52
198000 -- (-773.811) (-766.326) [-765.893] (-771.309) * [-765.571] (-771.013) (-765.043) (-766.533) -- 0:00:52
198500 -- (-768.142) (-766.354) (-764.759) [-767.448] * [-766.216] (-769.533) (-765.304) (-765.746) -- 0:00:52
199000 -- [-766.578] (-768.024) (-767.733) (-770.229) * (-766.668) [-764.321] (-765.047) (-772.713) -- 0:00:52
199500 -- (-766.819) (-767.873) (-767.682) [-764.900] * (-767.312) (-764.896) (-765.903) [-766.763] -- 0:00:52
200000 -- (-764.512) [-766.620] (-767.251) (-766.423) * (-764.395) (-766.746) [-768.000] (-764.888) -- 0:00:51
Average standard deviation of split frequencies: 0.021273
200500 -- [-764.379] (-766.702) (-771.415) (-769.822) * [-766.925] (-766.361) (-767.129) (-768.172) -- 0:00:51
201000 -- (-767.143) (-766.497) (-765.931) [-766.962] * (-771.696) [-766.152] (-763.503) (-763.700) -- 0:00:51
201500 -- (-766.858) (-768.259) (-766.778) [-765.349] * (-767.834) [-766.515] (-765.173) (-765.477) -- 0:00:51
202000 -- [-764.252] (-766.642) (-766.048) (-765.136) * (-767.560) (-767.912) (-775.090) [-766.173] -- 0:00:55
202500 -- [-767.653] (-764.927) (-764.088) (-765.886) * (-770.104) (-764.659) (-765.791) [-765.557] -- 0:00:55
203000 -- [-768.028] (-765.329) (-767.173) (-769.477) * (-767.786) (-768.646) (-764.421) [-765.661] -- 0:00:54
203500 -- (-763.830) [-767.925] (-765.306) (-769.308) * (-766.064) (-766.540) [-766.349] (-765.976) -- 0:00:54
204000 -- [-766.313] (-767.999) (-768.828) (-768.013) * [-768.043] (-765.460) (-768.302) (-766.479) -- 0:00:54
204500 -- (-770.583) (-767.798) (-767.521) [-766.456] * (-766.680) [-766.349] (-764.936) (-767.635) -- 0:00:54
205000 -- [-768.366] (-763.596) (-764.986) (-764.160) * (-766.872) (-767.843) [-764.737] (-767.735) -- 0:00:54
Average standard deviation of split frequencies: 0.021994
205500 -- (-766.215) (-765.182) (-767.962) [-764.229] * (-765.691) (-765.184) [-769.332] (-765.967) -- 0:00:54
206000 -- (-766.699) (-767.282) [-766.904] (-767.538) * (-766.184) (-766.470) (-766.469) [-767.195] -- 0:00:53
206500 -- (-768.012) [-767.365] (-765.244) (-767.346) * (-766.078) (-763.778) (-768.946) [-765.593] -- 0:00:53
207000 -- (-766.471) (-771.642) (-764.342) [-767.605] * [-769.510] (-763.408) (-766.422) (-766.758) -- 0:00:53
207500 -- [-766.378] (-769.537) (-763.370) (-770.732) * (-766.783) (-764.855) [-769.067] (-766.552) -- 0:00:53
208000 -- (-765.999) (-767.100) [-766.251] (-765.665) * (-767.197) [-764.702] (-765.777) (-765.793) -- 0:00:53
208500 -- (-765.480) (-766.985) (-764.037) [-765.914] * (-765.862) (-765.609) [-768.773] (-766.076) -- 0:00:53
209000 -- (-764.748) (-767.167) (-764.734) [-764.758] * (-768.838) (-766.740) (-766.700) [-763.102] -- 0:00:52
209500 -- (-768.524) [-765.214] (-768.765) (-764.425) * [-768.025] (-767.460) (-766.050) (-770.238) -- 0:00:52
210000 -- (-767.260) (-764.868) (-768.773) [-768.005] * (-768.115) (-766.157) (-766.430) [-768.765] -- 0:00:52
Average standard deviation of split frequencies: 0.022004
210500 -- (-768.026) (-769.511) [-767.351] (-766.695) * (-772.046) (-767.212) [-765.372] (-764.717) -- 0:00:52
211000 -- [-767.025] (-769.288) (-774.102) (-766.252) * (-767.373) (-766.618) (-765.875) [-763.745] -- 0:00:52
211500 -- [-767.422] (-765.731) (-770.099) (-767.723) * [-768.657] (-771.059) (-766.378) (-769.985) -- 0:00:52
212000 -- (-766.123) (-765.507) (-766.278) [-764.869] * (-764.879) [-766.964] (-768.245) (-764.163) -- 0:00:52
212500 -- (-768.863) (-768.318) (-766.161) [-767.353] * (-765.965) (-768.158) [-766.387] (-765.331) -- 0:00:51
213000 -- (-766.086) (-773.606) (-767.908) [-768.761] * (-764.827) (-767.790) (-769.447) [-766.433] -- 0:00:51
213500 -- (-767.932) (-767.234) [-767.732] (-767.223) * (-763.505) (-768.790) (-768.714) [-765.198] -- 0:00:51
214000 -- (-766.226) (-766.217) [-767.377] (-767.043) * [-763.550] (-768.155) (-767.661) (-766.848) -- 0:00:51
214500 -- (-771.495) (-765.481) (-769.494) [-765.260] * (-771.487) (-765.220) (-767.724) [-764.869] -- 0:00:51
215000 -- (-767.398) (-764.435) (-765.269) [-767.630] * (-769.608) [-765.995] (-766.442) (-766.444) -- 0:00:51
Average standard deviation of split frequencies: 0.023622
215500 -- [-766.859] (-767.935) (-766.591) (-765.869) * (-766.687) (-764.837) (-765.392) [-766.195] -- 0:00:50
216000 -- [-767.766] (-766.279) (-768.898) (-765.371) * (-766.530) (-767.148) (-764.500) [-767.210] -- 0:00:50
216500 -- [-767.086] (-765.532) (-766.342) (-765.478) * (-766.727) [-766.346] (-764.669) (-764.569) -- 0:00:50
217000 -- (-768.490) (-764.419) [-767.905] (-766.509) * (-768.305) (-767.332) (-767.768) [-769.325] -- 0:00:50
217500 -- (-769.639) (-766.364) [-767.584] (-769.509) * (-768.332) [-763.420] (-766.959) (-766.079) -- 0:00:53
218000 -- (-768.261) [-766.845] (-768.985) (-766.899) * (-765.835) (-765.933) [-766.358] (-768.213) -- 0:00:53
218500 -- (-767.126) [-765.915] (-766.997) (-767.241) * [-766.720] (-768.921) (-768.156) (-766.431) -- 0:00:53
219000 -- (-767.122) (-767.512) (-772.555) [-764.122] * (-768.060) [-767.586] (-767.920) (-766.683) -- 0:00:53
219500 -- (-767.743) (-768.516) (-765.788) [-767.999] * (-765.707) (-764.307) (-763.781) [-764.781] -- 0:00:53
220000 -- (-766.298) (-764.412) [-766.706] (-767.709) * (-770.946) (-765.913) [-763.851] (-769.955) -- 0:00:53
Average standard deviation of split frequencies: 0.022906
220500 -- [-766.062] (-766.490) (-765.473) (-768.960) * (-765.591) (-765.913) [-764.452] (-766.520) -- 0:00:53
221000 -- (-768.212) (-767.523) (-768.263) [-766.234] * (-766.694) [-765.071] (-765.581) (-767.809) -- 0:00:52
221500 -- (-771.655) (-766.324) [-770.299] (-764.903) * [-770.199] (-764.968) (-768.095) (-766.592) -- 0:00:52
222000 -- (-766.444) [-766.480] (-769.235) (-766.806) * (-768.004) (-766.168) [-769.143] (-769.194) -- 0:00:52
222500 -- (-767.789) (-764.642) [-765.125] (-769.560) * (-770.174) (-766.443) [-767.344] (-767.160) -- 0:00:52
223000 -- (-767.006) [-766.216] (-766.726) (-769.452) * (-767.597) (-766.317) (-765.045) [-767.402] -- 0:00:52
223500 -- (-767.665) (-765.665) (-766.410) [-767.323] * (-765.913) (-768.623) (-769.999) [-769.147] -- 0:00:52
224000 -- (-766.676) (-766.566) [-766.297] (-768.748) * (-765.230) [-767.440] (-766.041) (-768.356) -- 0:00:51
224500 -- (-766.878) [-764.513] (-766.902) (-766.006) * (-764.533) (-769.838) [-768.761] (-768.143) -- 0:00:51
225000 -- (-766.933) (-767.292) [-765.823] (-766.567) * (-765.544) (-766.820) [-765.792] (-765.813) -- 0:00:51
Average standard deviation of split frequencies: 0.021067
225500 -- (-767.303) [-767.063] (-767.404) (-767.015) * (-765.271) (-765.956) [-764.769] (-769.142) -- 0:00:51
226000 -- (-766.534) (-766.337) [-764.428] (-767.008) * (-766.945) (-767.679) (-765.749) [-765.986] -- 0:00:51
226500 -- (-765.619) (-767.994) [-766.220] (-767.400) * [-767.376] (-767.248) (-768.838) (-767.748) -- 0:00:51
227000 -- (-771.086) [-768.708] (-767.999) (-772.135) * (-766.777) (-766.143) (-768.680) [-768.731] -- 0:00:51
227500 -- (-767.467) (-770.010) (-767.518) [-766.226] * [-765.740] (-766.250) (-767.186) (-765.539) -- 0:00:50
228000 -- (-766.408) [-768.900] (-770.185) (-768.767) * [-765.798] (-770.046) (-764.866) (-764.338) -- 0:00:50
228500 -- (-766.118) (-770.435) (-766.650) [-769.372] * [-770.156] (-767.204) (-766.094) (-766.674) -- 0:00:50
229000 -- (-768.499) [-767.123] (-766.579) (-769.057) * (-766.020) [-765.552] (-767.487) (-770.661) -- 0:00:50
229500 -- (-768.294) (-769.131) (-765.382) [-766.752] * (-768.499) (-765.913) (-768.184) [-771.187] -- 0:00:50
230000 -- (-767.318) (-770.219) (-773.122) [-767.883] * [-774.097] (-765.767) (-765.484) (-766.200) -- 0:00:50
Average standard deviation of split frequencies: 0.020544
230500 -- (-770.517) [-766.995] (-767.842) (-767.426) * (-766.473) (-766.538) (-766.289) [-764.860] -- 0:00:50
231000 -- (-766.562) (-768.871) [-765.971] (-769.828) * (-767.198) (-765.186) (-768.765) [-765.143] -- 0:00:49
231500 -- (-768.096) (-767.913) (-768.442) [-768.676] * [-764.654] (-769.943) (-769.315) (-767.505) -- 0:00:49
232000 -- [-766.629] (-770.902) (-766.939) (-767.573) * (-770.496) (-767.921) (-765.247) [-768.490] -- 0:00:49
232500 -- (-772.382) (-768.458) [-768.127] (-764.242) * (-769.510) (-766.088) [-766.059] (-767.139) -- 0:00:49
233000 -- (-766.440) (-765.436) (-767.634) [-767.120] * (-767.270) (-767.535) [-765.061] (-766.560) -- 0:00:52
233500 -- (-765.519) (-766.081) (-766.689) [-766.561] * (-766.374) (-770.122) (-769.957) [-766.895] -- 0:00:52
234000 -- (-764.588) [-765.130] (-766.248) (-767.276) * (-769.969) (-768.682) [-771.457] (-766.150) -- 0:00:52
234500 -- (-767.810) (-766.997) [-765.656] (-766.324) * (-769.679) (-767.949) [-765.323] (-773.812) -- 0:00:52
235000 -- [-764.994] (-768.619) (-764.052) (-765.740) * [-766.591] (-768.165) (-764.725) (-769.236) -- 0:00:52
Average standard deviation of split frequencies: 0.020562
235500 -- (-767.885) [-768.314] (-765.367) (-768.149) * [-767.160] (-766.569) (-769.579) (-766.756) -- 0:00:51
236000 -- (-769.233) [-766.942] (-767.822) (-766.540) * (-767.596) (-764.921) (-770.081) [-768.702] -- 0:00:51
236500 -- (-765.370) [-768.239] (-765.003) (-766.190) * (-765.966) (-765.274) [-766.914] (-765.423) -- 0:00:51
237000 -- [-766.759] (-768.123) (-765.565) (-768.929) * (-766.749) (-765.113) (-769.586) [-767.093] -- 0:00:51
237500 -- (-768.482) [-767.451] (-765.406) (-767.486) * (-768.620) [-767.070] (-769.228) (-769.083) -- 0:00:51
238000 -- (-770.403) (-774.689) (-771.488) [-768.686] * (-767.481) (-767.565) (-770.072) [-764.999] -- 0:00:51
238500 -- (-769.393) (-767.648) (-773.309) [-771.161] * [-769.364] (-769.267) (-768.993) (-765.117) -- 0:00:51
239000 -- (-768.315) (-767.081) (-764.974) [-767.408] * [-768.897] (-770.791) (-767.630) (-766.821) -- 0:00:50
239500 -- [-768.481] (-768.641) (-768.540) (-767.621) * [-767.459] (-767.990) (-765.265) (-766.620) -- 0:00:50
240000 -- (-766.566) (-768.157) [-765.966] (-766.575) * [-769.536] (-765.884) (-767.929) (-769.290) -- 0:00:50
Average standard deviation of split frequencies: 0.020855
240500 -- (-766.196) [-767.969] (-766.550) (-767.018) * [-765.620] (-766.468) (-768.223) (-768.647) -- 0:00:50
241000 -- [-764.771] (-772.569) (-768.062) (-766.586) * [-769.144] (-766.584) (-768.145) (-770.291) -- 0:00:50
241500 -- (-767.323) (-765.597) [-766.245] (-767.669) * (-767.232) (-767.209) (-767.148) [-765.997] -- 0:00:50
242000 -- (-764.113) (-766.606) (-769.569) [-766.753] * [-766.121] (-765.856) (-767.460) (-766.679) -- 0:00:50
242500 -- [-765.234] (-764.767) (-768.401) (-767.250) * [-765.272] (-766.157) (-767.428) (-766.975) -- 0:00:49
243000 -- (-767.045) [-766.905] (-767.200) (-766.922) * (-764.745) (-770.536) (-766.156) [-769.169] -- 0:00:49
243500 -- (-766.553) [-764.642] (-766.763) (-767.424) * (-764.110) (-765.983) [-766.519] (-771.098) -- 0:00:49
244000 -- (-765.625) (-766.295) (-767.587) [-766.413] * (-768.225) [-764.595] (-764.687) (-769.261) -- 0:00:49
244500 -- (-770.670) [-766.642] (-768.118) (-767.876) * (-769.331) (-765.700) (-767.461) [-766.114] -- 0:00:49
245000 -- [-765.900] (-769.217) (-766.976) (-767.467) * [-769.582] (-766.992) (-769.096) (-766.092) -- 0:00:49
Average standard deviation of split frequencies: 0.019163
245500 -- (-767.993) [-768.598] (-765.642) (-769.155) * (-768.220) (-765.253) (-769.572) [-766.457] -- 0:00:49
246000 -- (-764.993) [-765.329] (-766.713) (-767.426) * (-764.989) [-767.069] (-768.622) (-767.653) -- 0:00:49
246500 -- (-766.409) (-768.736) (-768.091) [-773.099] * (-768.309) [-765.105] (-768.204) (-769.367) -- 0:00:48
247000 -- (-764.564) (-770.763) (-767.407) [-768.832] * [-764.966] (-765.017) (-768.786) (-767.889) -- 0:00:48
247500 -- (-766.423) [-767.486] (-767.540) (-768.840) * (-767.506) [-764.866] (-769.054) (-765.852) -- 0:00:48
248000 -- (-768.010) [-766.420] (-767.718) (-768.925) * (-765.727) [-764.412] (-767.557) (-764.869) -- 0:00:48
248500 -- (-768.347) [-767.353] (-770.146) (-770.731) * (-765.159) (-770.694) [-767.440] (-773.969) -- 0:00:48
249000 -- [-767.060] (-766.978) (-767.807) (-766.279) * (-764.542) [-767.635] (-767.613) (-765.097) -- 0:00:51
249500 -- (-767.187) [-767.752] (-768.111) (-767.970) * (-768.360) (-766.980) (-766.893) [-767.481] -- 0:00:51
250000 -- (-767.651) [-766.925] (-764.316) (-768.566) * (-769.080) (-763.573) (-766.915) [-767.771] -- 0:00:51
Average standard deviation of split frequencies: 0.019691
250500 -- [-768.644] (-766.579) (-774.239) (-766.155) * (-769.264) [-770.281] (-767.151) (-768.702) -- 0:00:50
251000 -- (-765.847) [-767.813] (-770.531) (-770.967) * (-767.984) (-765.225) (-765.108) [-768.549] -- 0:00:50
251500 -- (-766.385) [-766.589] (-766.466) (-768.064) * (-766.615) (-765.867) [-765.625] (-767.404) -- 0:00:50
252000 -- (-766.986) [-766.206] (-767.306) (-765.797) * (-768.320) [-766.307] (-766.290) (-767.649) -- 0:00:50
252500 -- (-768.528) (-766.035) [-766.773] (-767.397) * (-766.975) (-764.605) (-766.015) [-767.467] -- 0:00:50
253000 -- (-768.148) (-766.141) [-769.236] (-765.964) * (-767.163) [-764.815] (-769.233) (-764.353) -- 0:00:50
253500 -- (-767.972) (-766.054) [-771.205] (-765.613) * (-766.239) [-764.462] (-766.832) (-766.359) -- 0:00:50
254000 -- (-768.326) (-766.026) (-768.192) [-766.470] * (-765.651) (-766.343) (-766.945) [-766.617] -- 0:00:49
254500 -- (-773.251) [-766.525] (-769.385) (-766.656) * (-768.206) (-766.839) (-766.184) [-765.700] -- 0:00:49
255000 -- (-767.127) [-770.170] (-767.999) (-767.462) * [-767.577] (-765.360) (-765.688) (-766.318) -- 0:00:49
Average standard deviation of split frequencies: 0.018619
255500 -- (-766.922) [-767.160] (-765.780) (-767.020) * (-768.302) [-764.133] (-766.666) (-766.275) -- 0:00:49
256000 -- (-767.277) [-766.948] (-765.445) (-767.543) * (-766.743) (-765.414) (-767.785) [-765.195] -- 0:00:49
256500 -- (-766.478) (-766.650) [-766.452] (-766.266) * [-766.659] (-767.807) (-768.921) (-768.647) -- 0:00:49
257000 -- [-766.667] (-768.771) (-766.450) (-766.804) * (-766.271) (-765.863) (-767.138) [-768.057] -- 0:00:49
257500 -- (-768.310) (-770.860) [-766.614] (-768.358) * (-767.640) (-764.663) (-764.949) [-766.494] -- 0:00:49
258000 -- (-767.356) (-770.631) [-765.733] (-770.792) * (-765.805) (-766.998) (-769.157) [-765.818] -- 0:00:48
258500 -- (-766.617) [-766.424] (-765.783) (-768.805) * (-768.265) (-765.710) (-765.285) [-766.180] -- 0:00:48
259000 -- (-766.828) (-767.523) [-768.776] (-766.809) * [-768.427] (-767.589) (-767.701) (-766.100) -- 0:00:48
259500 -- [-767.091] (-763.922) (-770.556) (-771.147) * (-768.764) (-767.411) (-765.848) [-766.248] -- 0:00:48
260000 -- [-768.273] (-768.957) (-775.825) (-768.275) * (-769.562) [-770.657] (-767.242) (-769.702) -- 0:00:48
Average standard deviation of split frequencies: 0.017281
260500 -- (-768.053) (-767.834) [-764.767] (-767.530) * (-767.589) [-771.653] (-769.077) (-772.330) -- 0:00:48
261000 -- (-768.490) (-767.067) [-766.777] (-767.773) * (-765.452) (-768.568) (-768.427) [-768.659] -- 0:00:48
261500 -- (-770.521) [-767.407] (-767.437) (-767.132) * (-768.941) (-766.324) [-767.330] (-769.962) -- 0:00:48
262000 -- (-769.800) [-767.841] (-766.679) (-768.295) * [-764.919] (-767.013) (-769.364) (-767.803) -- 0:00:47
262500 -- [-766.435] (-764.883) (-768.488) (-768.038) * (-765.277) (-767.487) [-765.239] (-767.233) -- 0:00:47
263000 -- (-765.036) [-763.600] (-772.852) (-766.708) * (-764.977) [-764.996] (-768.838) (-769.338) -- 0:00:47
263500 -- (-772.227) (-765.850) [-770.363] (-766.561) * (-765.830) [-765.153] (-768.503) (-768.497) -- 0:00:47
264000 -- (-769.563) [-766.639] (-765.986) (-769.122) * (-766.545) (-767.535) (-765.889) [-768.461] -- 0:00:47
264500 -- (-764.283) (-767.835) (-767.199) [-767.627] * (-767.253) (-769.267) [-764.905] (-770.351) -- 0:00:50
265000 -- [-765.894] (-765.002) (-769.264) (-768.551) * [-766.147] (-770.914) (-768.773) (-772.327) -- 0:00:49
Average standard deviation of split frequencies: 0.017131
265500 -- [-765.702] (-767.835) (-767.290) (-767.172) * [-764.897] (-766.103) (-769.778) (-766.675) -- 0:00:49
266000 -- (-770.117) (-765.646) [-767.784] (-767.282) * (-767.365) (-765.922) (-771.381) [-766.632] -- 0:00:49
266500 -- (-767.724) (-765.328) [-765.267] (-766.579) * (-766.573) (-764.986) (-766.960) [-765.144] -- 0:00:49
267000 -- [-767.237] (-765.099) (-769.551) (-768.359) * (-766.625) (-766.706) (-769.207) [-764.437] -- 0:00:49
267500 -- (-769.847) (-770.563) [-768.690] (-769.017) * (-767.028) (-766.276) (-766.102) [-769.231] -- 0:00:49
268000 -- (-766.923) [-765.871] (-766.823) (-768.174) * (-767.248) [-765.255] (-768.429) (-769.049) -- 0:00:49
268500 -- (-767.379) [-765.474] (-767.205) (-765.610) * (-766.733) (-767.266) (-769.565) [-768.490] -- 0:00:49
269000 -- (-768.486) (-764.654) [-766.518] (-767.315) * (-766.990) [-767.781] (-770.975) (-767.522) -- 0:00:48
269500 -- (-769.519) [-765.078] (-770.724) (-770.389) * [-767.292] (-772.149) (-766.106) (-768.223) -- 0:00:48
270000 -- (-767.127) (-763.845) [-766.596] (-765.402) * [-767.824] (-768.351) (-765.149) (-770.670) -- 0:00:48
Average standard deviation of split frequencies: 0.017852
270500 -- (-767.107) (-764.633) [-766.590] (-769.679) * (-766.238) [-767.121] (-767.480) (-768.234) -- 0:00:48
271000 -- (-765.862) [-765.787] (-768.351) (-768.961) * (-767.835) [-768.988] (-766.046) (-767.929) -- 0:00:48
271500 -- (-769.737) (-766.713) (-767.721) [-772.095] * [-767.955] (-765.869) (-767.528) (-765.344) -- 0:00:48
272000 -- (-771.749) (-767.508) (-767.392) [-766.426] * (-770.956) [-766.386] (-765.622) (-765.851) -- 0:00:48
272500 -- [-767.192] (-767.031) (-766.987) (-766.198) * (-770.111) (-766.569) (-767.747) [-766.564] -- 0:00:48
273000 -- (-766.020) (-765.698) [-767.533] (-768.295) * (-769.428) (-766.660) (-769.420) [-767.558] -- 0:00:47
273500 -- (-766.831) [-764.275] (-766.087) (-766.820) * (-768.287) [-765.780] (-768.722) (-767.944) -- 0:00:47
274000 -- (-766.852) [-766.647] (-768.683) (-765.955) * (-769.505) (-765.860) [-768.365] (-766.825) -- 0:00:47
274500 -- [-766.445] (-765.551) (-767.296) (-768.250) * (-767.969) (-766.494) (-767.190) [-765.675] -- 0:00:47
275000 -- (-766.201) (-774.267) (-767.017) [-769.617] * (-769.754) [-768.256] (-765.453) (-768.402) -- 0:00:47
Average standard deviation of split frequencies: 0.018147
275500 -- (-767.250) [-768.154] (-765.104) (-767.388) * [-767.529] (-766.957) (-767.902) (-767.236) -- 0:00:47
276000 -- (-767.930) (-765.274) (-767.291) [-766.829] * (-767.669) (-767.329) [-765.142] (-766.732) -- 0:00:47
276500 -- (-769.870) [-764.917] (-768.902) (-767.733) * (-769.554) (-764.734) [-765.390] (-766.883) -- 0:00:47
277000 -- (-765.862) (-766.201) (-769.081) [-768.398] * (-768.612) (-768.933) [-765.992] (-767.198) -- 0:00:46
277500 -- (-766.072) (-765.466) [-766.389] (-767.268) * (-767.006) (-768.446) (-767.282) [-770.336] -- 0:00:46
278000 -- [-764.615] (-765.579) (-765.563) (-768.808) * (-765.955) (-767.575) (-767.476) [-768.930] -- 0:00:46
278500 -- [-769.109] (-766.082) (-765.698) (-773.839) * (-766.077) [-769.209] (-765.419) (-768.527) -- 0:00:46
279000 -- [-765.397] (-765.681) (-765.497) (-767.753) * (-768.777) (-767.750) (-766.675) [-766.641] -- 0:00:46
279500 -- [-766.064] (-767.496) (-765.110) (-771.999) * (-766.515) (-768.089) [-766.699] (-768.532) -- 0:00:46
280000 -- (-769.544) [-765.712] (-764.502) (-768.151) * (-772.665) [-768.083] (-769.633) (-769.661) -- 0:00:48
Average standard deviation of split frequencies: 0.017586
280500 -- (-769.840) [-764.594] (-765.476) (-766.782) * (-772.988) (-767.272) (-767.504) [-769.555] -- 0:00:48
281000 -- (-773.021) (-768.366) (-770.405) [-766.492] * (-767.652) (-765.951) [-767.591] (-764.352) -- 0:00:48
281500 -- (-769.835) [-767.138] (-770.024) (-770.365) * (-768.238) (-766.043) (-768.044) [-766.364] -- 0:00:48
282000 -- (-769.116) (-767.985) [-765.249] (-767.375) * [-764.325] (-766.098) (-766.888) (-766.666) -- 0:00:48
282500 -- (-767.129) (-768.671) [-766.847] (-770.348) * (-767.221) (-766.661) [-770.387] (-773.773) -- 0:00:48
283000 -- (-767.159) (-773.203) [-764.429] (-766.233) * [-768.521] (-769.888) (-767.497) (-768.025) -- 0:00:48
283500 -- [-766.567] (-765.655) (-763.647) (-766.499) * (-769.340) [-772.566] (-766.683) (-768.493) -- 0:00:48
284000 -- [-767.117] (-773.338) (-765.922) (-771.052) * [-767.941] (-765.361) (-766.642) (-768.962) -- 0:00:47
284500 -- (-764.532) (-769.933) (-765.078) [-764.457] * (-767.691) (-766.722) [-769.659] (-766.359) -- 0:00:47
285000 -- (-767.898) (-767.955) [-765.935] (-766.015) * [-767.667] (-766.333) (-769.534) (-767.749) -- 0:00:47
Average standard deviation of split frequencies: 0.017937
285500 -- (-767.848) (-765.724) (-768.446) [-766.392] * (-767.558) [-767.122] (-768.688) (-766.197) -- 0:00:47
286000 -- (-768.520) [-765.096] (-768.560) (-765.479) * [-766.779] (-768.021) (-769.538) (-764.339) -- 0:00:47
286500 -- (-768.010) (-765.955) [-766.959] (-764.583) * [-766.741] (-770.737) (-770.988) (-765.281) -- 0:00:47
287000 -- (-771.084) [-768.723] (-765.887) (-766.386) * (-766.226) (-767.780) [-766.505] (-767.430) -- 0:00:47
287500 -- [-768.769] (-766.307) (-772.864) (-766.698) * (-769.233) (-768.442) [-765.622] (-767.850) -- 0:00:47
288000 -- (-765.523) [-767.585] (-767.726) (-770.417) * (-764.089) (-765.155) (-765.581) [-764.869] -- 0:00:46
288500 -- (-766.472) [-766.495] (-766.275) (-766.982) * (-766.026) (-767.502) [-768.043] (-766.360) -- 0:00:46
289000 -- [-764.840] (-767.098) (-768.481) (-768.279) * (-765.555) (-765.537) (-765.885) [-766.478] -- 0:00:46
289500 -- [-765.250] (-767.557) (-766.991) (-764.412) * [-767.717] (-766.606) (-766.661) (-766.316) -- 0:00:46
290000 -- (-768.110) (-770.665) [-765.159] (-767.691) * (-765.907) [-768.248] (-766.552) (-765.845) -- 0:00:46
Average standard deviation of split frequencies: 0.017458
290500 -- (-771.317) (-769.496) [-768.387] (-767.806) * [-769.095] (-768.453) (-767.381) (-768.036) -- 0:00:46
291000 -- [-764.839] (-767.657) (-765.069) (-767.267) * [-767.767] (-765.735) (-767.164) (-766.077) -- 0:00:46
291500 -- [-765.078] (-767.140) (-766.481) (-767.797) * (-768.016) (-767.825) (-767.096) [-766.414] -- 0:00:46
292000 -- (-767.642) (-773.599) (-767.053) [-772.732] * (-765.479) (-766.125) [-766.331] (-765.290) -- 0:00:46
292500 -- (-767.470) (-768.101) (-763.914) [-767.029] * (-768.844) [-764.963] (-764.396) (-767.587) -- 0:00:45
293000 -- (-768.479) (-766.546) [-767.707] (-769.715) * (-769.875) (-769.090) [-767.738] (-769.039) -- 0:00:45
293500 -- (-766.679) [-763.620] (-767.464) (-769.231) * (-767.432) (-768.235) (-769.892) [-767.115] -- 0:00:45
294000 -- [-766.896] (-765.710) (-768.795) (-776.272) * (-766.003) (-774.527) (-764.833) [-767.113] -- 0:00:45
294500 -- (-766.879) (-766.436) [-764.761] (-766.980) * (-766.687) [-768.939] (-765.837) (-771.876) -- 0:00:45
295000 -- [-766.103] (-768.129) (-764.837) (-766.922) * (-766.682) (-766.522) [-765.657] (-769.754) -- 0:00:45
Average standard deviation of split frequencies: 0.016368
295500 -- [-767.719] (-766.798) (-767.390) (-767.742) * (-766.126) (-765.035) (-767.350) [-767.441] -- 0:00:47
296000 -- (-764.969) [-766.607] (-767.601) (-767.859) * (-763.551) (-770.734) [-771.385] (-772.606) -- 0:00:47
296500 -- (-767.271) (-768.092) [-766.559] (-766.761) * [-764.362] (-766.972) (-768.775) (-765.547) -- 0:00:47
297000 -- [-766.774] (-766.825) (-766.021) (-766.578) * (-766.251) (-768.285) (-768.220) [-765.247] -- 0:00:47
297500 -- (-765.718) [-764.620] (-766.240) (-767.430) * [-763.704] (-763.838) (-765.525) (-765.655) -- 0:00:47
298000 -- [-767.669] (-764.224) (-764.673) (-767.233) * (-768.294) (-765.462) [-765.943] (-768.572) -- 0:00:47
298500 -- (-765.064) [-765.868] (-765.851) (-769.581) * (-765.729) [-767.601] (-767.272) (-769.296) -- 0:00:47
299000 -- (-768.480) (-764.959) (-763.862) [-765.845] * (-768.014) (-764.146) [-767.690] (-766.346) -- 0:00:46
299500 -- [-768.114] (-765.187) (-766.310) (-767.206) * (-766.337) (-765.228) [-766.216] (-769.821) -- 0:00:46
300000 -- (-768.206) [-765.765] (-769.934) (-766.293) * (-765.053) [-767.793] (-767.017) (-766.503) -- 0:00:46
Average standard deviation of split frequencies: 0.015125
300500 -- (-768.826) [-766.590] (-766.401) (-770.658) * (-765.477) (-768.929) (-767.416) [-769.385] -- 0:00:46
301000 -- [-767.326] (-768.361) (-765.423) (-767.074) * (-765.746) (-767.062) (-765.145) [-769.957] -- 0:00:46
301500 -- (-768.423) (-767.553) [-765.953] (-767.166) * (-768.577) (-767.748) (-768.110) [-765.544] -- 0:00:46
302000 -- [-768.029] (-767.991) (-767.113) (-768.987) * [-764.317] (-766.436) (-765.093) (-766.169) -- 0:00:46
302500 -- (-766.102) (-766.239) [-765.883] (-764.560) * (-764.741) [-768.347] (-763.773) (-767.307) -- 0:00:46
303000 -- [-767.371] (-766.755) (-765.677) (-766.935) * (-767.027) (-765.074) [-767.567] (-766.812) -- 0:00:46
303500 -- [-766.825] (-766.331) (-765.444) (-767.454) * (-765.496) [-766.601] (-766.518) (-768.314) -- 0:00:45
304000 -- (-766.811) (-765.023) (-766.443) [-768.052] * (-765.532) [-766.011] (-764.434) (-770.303) -- 0:00:45
304500 -- (-772.759) [-763.576] (-766.967) (-767.058) * (-766.614) [-766.534] (-765.595) (-770.405) -- 0:00:45
305000 -- (-766.494) (-763.606) [-766.034] (-766.340) * (-768.253) (-768.243) [-765.720] (-765.120) -- 0:00:45
Average standard deviation of split frequencies: 0.014550
305500 -- (-772.298) [-764.968] (-763.649) (-767.846) * (-771.234) (-769.604) [-765.892] (-766.891) -- 0:00:45
306000 -- (-767.463) (-769.236) (-764.677) [-766.602] * (-763.993) (-769.662) [-767.185] (-767.728) -- 0:00:45
306500 -- [-764.990] (-767.952) (-766.123) (-767.085) * [-766.013] (-770.106) (-766.247) (-766.610) -- 0:00:45
307000 -- (-766.408) (-765.530) [-765.369] (-766.702) * (-768.792) [-766.349] (-764.632) (-768.877) -- 0:00:45
307500 -- [-764.889] (-767.209) (-765.489) (-767.762) * (-765.584) [-766.145] (-766.214) (-768.643) -- 0:00:45
308000 -- (-765.584) (-767.640) (-767.216) [-765.796] * (-766.998) (-771.203) (-766.787) [-767.492] -- 0:00:44
308500 -- (-766.969) [-769.222] (-767.791) (-765.250) * (-768.153) (-768.246) (-770.344) [-763.545] -- 0:00:44
309000 -- [-766.883] (-766.950) (-767.063) (-769.086) * (-765.478) (-764.843) [-765.652] (-772.879) -- 0:00:44
309500 -- (-768.006) (-765.411) [-767.019] (-768.996) * (-770.288) (-766.270) (-764.062) [-765.634] -- 0:00:44
310000 -- (-769.080) [-765.283] (-767.380) (-768.032) * [-764.458] (-768.977) (-766.181) (-765.812) -- 0:00:44
Average standard deviation of split frequencies: 0.014752
310500 -- (-769.126) (-765.797) (-766.532) [-764.849] * (-770.840) (-765.741) (-767.992) [-764.198] -- 0:00:44
311000 -- (-768.286) (-763.116) (-766.208) [-767.114] * (-767.049) [-770.693] (-776.496) (-765.424) -- 0:00:46
311500 -- [-768.451] (-767.034) (-766.520) (-768.878) * (-771.429) [-768.579] (-766.739) (-763.941) -- 0:00:46
312000 -- (-766.276) (-765.994) (-766.277) [-767.733] * (-765.688) [-768.378] (-767.426) (-768.170) -- 0:00:46
312500 -- (-766.560) [-771.161] (-768.873) (-765.610) * (-765.454) (-776.086) [-765.046] (-768.576) -- 0:00:46
313000 -- (-767.159) (-765.788) [-767.751] (-769.814) * [-762.490] (-766.317) (-765.362) (-765.650) -- 0:00:46
313500 -- (-768.612) (-769.958) (-766.215) [-768.777] * (-765.939) [-766.299] (-766.842) (-766.283) -- 0:00:45
314000 -- [-766.781] (-771.817) (-768.890) (-767.282) * (-764.905) (-768.335) (-765.624) [-770.515] -- 0:00:45
314500 -- [-768.851] (-766.599) (-767.313) (-765.212) * [-766.333] (-768.188) (-764.878) (-766.898) -- 0:00:45
315000 -- (-765.700) (-767.670) (-766.773) [-766.048] * [-766.111] (-767.377) (-768.572) (-767.393) -- 0:00:45
Average standard deviation of split frequencies: 0.014742
315500 -- (-769.997) [-768.844] (-765.122) (-768.091) * [-765.718] (-764.554) (-767.283) (-767.785) -- 0:00:45
316000 -- [-768.383] (-770.003) (-763.722) (-764.640) * (-766.271) (-767.061) (-773.486) [-765.529] -- 0:00:45
316500 -- (-765.959) (-764.978) (-765.861) [-765.788] * (-765.905) (-767.289) (-769.535) [-764.505] -- 0:00:45
317000 -- (-768.294) (-769.232) [-766.740] (-763.891) * [-775.422] (-767.372) (-768.252) (-764.423) -- 0:00:45
317500 -- (-769.220) (-767.085) (-770.282) [-763.893] * (-770.990) [-766.785] (-768.554) (-771.310) -- 0:00:45
318000 -- (-768.303) (-766.526) [-767.457] (-765.843) * (-769.726) (-767.402) (-769.548) [-772.205] -- 0:00:45
318500 -- [-771.245] (-766.389) (-770.603) (-766.093) * (-772.900) (-767.710) (-766.238) [-767.356] -- 0:00:44
319000 -- (-767.019) (-769.755) (-767.140) [-766.717] * [-769.520] (-767.859) (-765.427) (-766.561) -- 0:00:44
319500 -- (-765.194) (-766.121) (-769.767) [-765.826] * (-766.518) [-764.781] (-769.038) (-765.066) -- 0:00:44
320000 -- (-766.949) [-767.475] (-768.349) (-765.964) * (-765.882) [-764.447] (-766.950) (-764.978) -- 0:00:44
Average standard deviation of split frequencies: 0.014095
320500 -- (-765.907) (-766.144) (-766.593) [-768.206] * (-767.605) [-765.635] (-771.318) (-767.144) -- 0:00:44
321000 -- (-766.297) [-765.851] (-766.489) (-768.701) * (-765.941) (-767.773) [-767.369] (-766.362) -- 0:00:44
321500 -- (-765.524) (-771.688) [-767.282] (-768.993) * (-766.444) [-766.191] (-766.984) (-766.486) -- 0:00:44
322000 -- (-767.135) [-763.978] (-767.124) (-766.490) * (-765.710) [-767.141] (-769.777) (-766.597) -- 0:00:44
322500 -- (-769.350) [-766.044] (-766.629) (-766.756) * (-766.730) [-763.810] (-767.109) (-766.908) -- 0:00:44
323000 -- (-765.542) [-766.559] (-766.781) (-768.456) * (-765.743) [-764.827] (-767.993) (-766.350) -- 0:00:44
323500 -- (-766.066) [-765.131] (-767.466) (-767.317) * (-769.722) (-767.176) (-771.592) [-766.334] -- 0:00:43
324000 -- (-771.839) [-767.150] (-767.966) (-770.312) * (-768.146) (-769.275) (-771.439) [-767.340] -- 0:00:43
324500 -- (-770.108) (-767.595) (-767.070) [-768.415] * (-767.985) [-770.756] (-766.564) (-768.236) -- 0:00:43
325000 -- (-766.415) [-767.672] (-765.830) (-769.385) * (-764.479) [-768.501] (-766.454) (-766.902) -- 0:00:43
Average standard deviation of split frequencies: 0.013354
325500 -- (-764.795) (-764.760) [-765.948] (-766.114) * (-766.179) (-767.486) [-768.736] (-769.862) -- 0:00:43
326000 -- (-768.619) (-766.597) [-764.731] (-765.239) * [-768.955] (-764.753) (-766.868) (-772.166) -- 0:00:43
326500 -- (-765.204) (-767.140) [-766.731] (-768.769) * (-764.810) [-764.497] (-766.365) (-771.191) -- 0:00:45
327000 -- [-765.773] (-769.772) (-764.940) (-770.157) * (-764.138) (-763.849) [-767.921] (-768.340) -- 0:00:45
327500 -- [-767.274] (-767.876) (-770.465) (-768.653) * (-766.327) [-765.168] (-765.415) (-767.951) -- 0:00:45
328000 -- (-767.118) (-766.956) [-770.949] (-766.202) * (-765.817) (-766.777) (-768.007) [-766.214] -- 0:00:45
328500 -- [-766.045] (-768.062) (-767.060) (-765.293) * (-765.458) [-767.000] (-764.725) (-766.746) -- 0:00:44
329000 -- (-770.311) (-768.512) (-767.791) [-766.674] * (-765.991) (-764.076) [-764.601] (-767.899) -- 0:00:44
329500 -- (-767.180) [-766.341] (-767.441) (-764.900) * (-766.285) [-766.575] (-766.977) (-766.464) -- 0:00:44
330000 -- (-768.174) (-770.416) [-765.281] (-769.016) * (-767.590) [-765.389] (-766.321) (-771.814) -- 0:00:44
Average standard deviation of split frequencies: 0.013418
330500 -- (-772.119) [-768.225] (-772.174) (-767.228) * (-768.356) (-766.149) (-764.749) [-769.410] -- 0:00:44
331000 -- (-768.886) (-766.433) (-766.365) [-767.039] * (-765.850) (-769.123) (-768.262) [-768.600] -- 0:00:44
331500 -- [-765.240] (-767.106) (-765.700) (-768.846) * (-764.768) (-768.607) (-767.486) [-767.743] -- 0:00:44
332000 -- (-768.269) [-768.593] (-767.377) (-768.277) * (-769.657) [-766.745] (-766.599) (-766.261) -- 0:00:44
332500 -- [-766.899] (-766.013) (-766.716) (-766.296) * (-767.748) (-770.760) (-765.989) [-766.872] -- 0:00:44
333000 -- (-766.891) (-771.329) [-766.181] (-767.474) * (-766.978) [-768.034] (-766.241) (-766.499) -- 0:00:44
333500 -- (-766.464) (-766.100) [-767.671] (-767.722) * (-766.766) [-765.338] (-768.165) (-767.135) -- 0:00:43
334000 -- (-766.676) (-767.814) (-767.430) [-765.896] * (-768.362) (-769.189) [-767.306] (-765.466) -- 0:00:43
334500 -- [-766.911] (-766.735) (-766.700) (-766.700) * (-766.988) [-767.451] (-769.122) (-765.946) -- 0:00:43
335000 -- [-765.063] (-767.689) (-766.925) (-766.210) * (-767.642) [-766.122] (-766.914) (-767.480) -- 0:00:43
Average standard deviation of split frequencies: 0.013452
335500 -- (-764.368) (-766.202) (-766.875) [-765.771] * (-769.673) (-765.957) (-766.690) [-766.383] -- 0:00:43
336000 -- (-766.946) [-770.039] (-770.840) (-766.799) * (-767.375) (-768.280) [-766.369] (-766.022) -- 0:00:43
336500 -- (-764.884) (-766.869) (-768.143) [-766.830] * [-765.738] (-766.679) (-768.305) (-766.471) -- 0:00:43
337000 -- [-763.971] (-768.828) (-765.296) (-767.160) * [-765.857] (-764.957) (-767.368) (-767.247) -- 0:00:43
337500 -- (-765.328) [-765.815] (-767.946) (-766.319) * (-765.875) (-765.556) (-768.037) [-767.030] -- 0:00:43
338000 -- (-767.202) (-763.763) (-768.029) [-766.383] * [-767.014] (-766.877) (-766.554) (-765.598) -- 0:00:43
338500 -- [-767.385] (-766.549) (-768.373) (-767.120) * [-764.296] (-766.256) (-764.488) (-767.484) -- 0:00:42
339000 -- (-766.319) [-768.947] (-774.215) (-766.838) * (-774.208) [-765.884] (-769.140) (-766.306) -- 0:00:42
339500 -- [-765.074] (-768.372) (-766.778) (-767.435) * [-765.995] (-765.907) (-767.840) (-771.272) -- 0:00:42
340000 -- (-766.458) (-767.268) [-767.640] (-767.512) * [-767.842] (-763.822) (-763.954) (-768.257) -- 0:00:42
Average standard deviation of split frequencies: 0.012047
340500 -- (-767.640) [-766.754] (-772.119) (-766.760) * (-766.712) [-767.464] (-766.056) (-765.129) -- 0:00:42
341000 -- (-767.755) (-769.953) (-767.990) [-766.653] * (-764.635) (-768.268) (-767.064) [-764.040] -- 0:00:42
341500 -- (-767.398) [-767.582] (-768.210) (-769.558) * (-766.065) [-766.292] (-765.427) (-764.353) -- 0:00:42
342000 -- (-767.013) (-764.915) [-767.975] (-765.352) * (-763.178) (-765.522) [-765.893] (-765.532) -- 0:00:44
342500 -- (-770.037) [-766.663] (-771.176) (-768.805) * (-765.252) [-766.929] (-766.698) (-763.392) -- 0:00:44
343000 -- (-769.802) [-766.512] (-766.656) (-767.813) * (-769.754) (-771.934) (-763.613) [-764.422] -- 0:00:44
343500 -- (-768.818) (-766.043) (-766.989) [-770.358] * (-764.112) (-767.861) (-766.282) [-769.455] -- 0:00:43
344000 -- [-766.789] (-766.202) (-768.033) (-767.588) * (-767.096) (-768.408) [-765.540] (-769.337) -- 0:00:43
344500 -- [-766.214] (-766.650) (-770.708) (-767.137) * (-766.763) (-768.257) (-764.330) [-767.276] -- 0:00:43
345000 -- [-765.376] (-766.196) (-770.238) (-768.609) * (-764.852) (-768.228) [-764.649] (-767.817) -- 0:00:43
Average standard deviation of split frequencies: 0.011461
345500 -- (-766.021) (-764.675) (-765.733) [-767.503] * (-766.633) (-766.330) (-764.295) [-767.747] -- 0:00:43
346000 -- (-766.119) (-765.037) [-768.463] (-770.904) * [-766.016] (-767.093) (-767.756) (-764.996) -- 0:00:43
346500 -- (-766.534) [-765.714] (-768.889) (-770.738) * (-769.767) [-767.873] (-765.273) (-767.419) -- 0:00:43
347000 -- [-764.563] (-764.278) (-769.092) (-769.120) * [-763.404] (-767.446) (-766.114) (-767.513) -- 0:00:43
347500 -- (-765.309) (-767.169) [-765.371] (-769.760) * (-769.076) [-765.040] (-769.272) (-771.327) -- 0:00:43
348000 -- (-765.823) [-764.940] (-770.026) (-766.803) * [-766.903] (-765.806) (-765.595) (-765.279) -- 0:00:43
348500 -- (-764.349) (-769.546) (-771.602) [-766.319] * (-765.902) (-765.916) (-766.357) [-767.598] -- 0:00:42
349000 -- [-766.099] (-772.840) (-766.721) (-770.120) * (-765.224) (-767.054) (-766.685) [-767.034] -- 0:00:42
349500 -- (-771.484) (-767.236) [-768.940] (-768.454) * (-770.940) (-767.195) (-766.709) [-766.538] -- 0:00:42
350000 -- [-767.534] (-767.616) (-768.658) (-767.494) * (-766.077) [-767.363] (-766.222) (-765.347) -- 0:00:42
Average standard deviation of split frequencies: 0.011007
350500 -- (-770.206) (-767.514) [-766.652] (-769.507) * (-768.100) [-764.414] (-767.737) (-765.152) -- 0:00:42
351000 -- (-767.931) [-763.454] (-765.787) (-765.677) * (-766.937) [-766.864] (-765.009) (-767.016) -- 0:00:42
351500 -- (-766.371) (-763.710) (-769.574) [-766.536] * (-767.752) [-765.568] (-766.684) (-768.026) -- 0:00:42
352000 -- [-766.869] (-765.206) (-771.874) (-767.506) * (-766.229) [-766.235] (-768.119) (-765.535) -- 0:00:42
352500 -- (-766.941) (-767.791) (-768.349) [-767.495] * (-765.871) [-766.059] (-769.479) (-765.381) -- 0:00:42
353000 -- [-765.673] (-768.472) (-768.046) (-767.947) * (-767.150) (-770.171) (-765.587) [-768.486] -- 0:00:42
353500 -- [-766.239] (-765.139) (-766.576) (-769.224) * (-769.033) (-764.831) [-765.022] (-764.397) -- 0:00:42
354000 -- (-765.570) (-766.511) (-766.500) [-769.070] * (-764.448) (-769.769) [-766.977] (-765.763) -- 0:00:41
354500 -- [-766.002] (-767.724) (-766.641) (-770.764) * (-765.913) (-770.031) [-765.676] (-765.339) -- 0:00:41
355000 -- (-765.636) [-767.207] (-767.218) (-770.688) * [-764.314] (-766.357) (-767.819) (-766.395) -- 0:00:41
Average standard deviation of split frequencies: 0.010905
355500 -- [-768.508] (-767.419) (-767.940) (-769.627) * (-768.446) (-770.714) (-767.144) [-767.714] -- 0:00:41
356000 -- (-764.488) (-766.651) [-766.550] (-768.195) * (-767.136) (-770.323) (-767.506) [-768.369] -- 0:00:41
356500 -- (-767.468) (-764.288) [-766.360] (-767.307) * (-767.558) (-765.834) [-766.524] (-767.371) -- 0:00:41
357000 -- (-766.779) (-765.861) [-766.277] (-765.058) * (-766.380) (-773.180) [-766.892] (-766.564) -- 0:00:41
357500 -- [-766.208] (-765.141) (-766.243) (-767.136) * (-765.005) [-767.173] (-765.954) (-766.516) -- 0:00:43
358000 -- [-765.543] (-774.418) (-766.987) (-766.690) * (-767.775) (-766.339) (-768.706) [-766.620] -- 0:00:43
358500 -- [-766.124] (-767.472) (-765.520) (-765.531) * (-764.936) (-766.079) [-766.333] (-766.108) -- 0:00:42
359000 -- (-767.332) (-767.439) (-767.336) [-767.601] * [-763.418] (-765.377) (-766.343) (-764.767) -- 0:00:42
359500 -- [-766.032] (-765.795) (-766.787) (-774.998) * (-765.861) [-766.009] (-769.891) (-766.216) -- 0:00:42
360000 -- [-764.125] (-766.177) (-765.698) (-768.316) * (-766.905) (-767.600) (-767.490) [-766.262] -- 0:00:42
Average standard deviation of split frequencies: 0.010918
360500 -- (-767.620) [-764.374] (-771.894) (-771.263) * (-766.996) [-772.406] (-765.488) (-768.382) -- 0:00:42
361000 -- (-768.477) (-764.584) (-769.282) [-768.720] * (-767.608) (-767.885) [-766.105] (-764.164) -- 0:00:42
361500 -- (-765.851) (-767.843) [-766.486] (-765.571) * (-767.660) [-771.687] (-770.057) (-763.926) -- 0:00:42
362000 -- (-768.035) (-766.650) [-768.461] (-766.964) * (-767.343) (-774.083) (-771.171) [-764.165] -- 0:00:42
362500 -- (-766.936) (-764.781) (-767.401) [-769.061] * (-767.268) (-772.521) (-768.014) [-765.605] -- 0:00:42
363000 -- (-764.860) (-765.001) (-767.077) [-765.391] * (-764.329) (-771.790) (-769.546) [-764.029] -- 0:00:42
363500 -- [-767.868] (-765.294) (-766.388) (-768.064) * (-766.610) (-766.650) [-765.628] (-764.519) -- 0:00:42
364000 -- (-765.402) (-765.158) (-765.762) [-765.392] * (-768.372) (-767.295) [-765.004] (-765.197) -- 0:00:41
364500 -- (-769.006) (-765.690) (-766.064) [-773.702] * [-768.906] (-769.377) (-771.472) (-766.974) -- 0:00:41
365000 -- (-770.755) [-764.640] (-766.911) (-766.026) * [-766.920] (-767.604) (-767.104) (-768.217) -- 0:00:41
Average standard deviation of split frequencies: 0.011019
365500 -- (-768.703) (-768.422) (-767.208) [-767.763] * [-765.833] (-767.663) (-766.400) (-767.737) -- 0:00:41
366000 -- (-767.395) (-765.436) (-767.598) [-767.210] * (-771.999) (-767.754) (-766.325) [-767.229] -- 0:00:41
366500 -- (-766.006) (-764.672) [-765.630] (-769.004) * (-766.774) (-766.560) (-765.536) [-767.317] -- 0:00:41
367000 -- (-767.072) (-763.863) (-765.698) [-768.451] * (-770.545) (-765.464) [-766.035] (-768.430) -- 0:00:41
367500 -- [-764.971] (-767.392) (-766.619) (-766.436) * (-764.272) (-768.521) (-772.499) [-767.412] -- 0:00:41
368000 -- (-769.194) (-767.619) [-766.134] (-767.590) * [-765.426] (-766.629) (-770.799) (-768.229) -- 0:00:41
368500 -- [-766.230] (-766.812) (-767.140) (-766.638) * (-769.680) (-767.085) [-767.447] (-771.791) -- 0:00:41
369000 -- [-764.288] (-765.938) (-767.674) (-768.317) * (-769.156) [-766.732] (-768.103) (-773.766) -- 0:00:41
369500 -- (-764.178) [-763.928] (-767.390) (-766.303) * [-769.294] (-766.348) (-768.191) (-766.830) -- 0:00:40
370000 -- (-765.910) (-767.043) [-767.428] (-768.666) * [-768.161] (-766.968) (-766.707) (-767.089) -- 0:00:40
Average standard deviation of split frequencies: 0.010739
370500 -- (-768.600) (-767.358) (-766.950) [-766.948] * (-770.505) [-767.715] (-766.317) (-767.133) -- 0:00:40
371000 -- [-768.626] (-766.750) (-766.567) (-779.775) * [-769.869] (-768.912) (-766.483) (-767.423) -- 0:00:40
371500 -- (-769.268) (-768.518) [-766.813] (-768.062) * (-765.105) (-769.251) (-769.037) [-767.499] -- 0:00:40
372000 -- (-765.534) (-768.983) (-765.157) [-767.272] * (-769.560) (-770.924) (-766.429) [-764.742] -- 0:00:40
372500 -- (-769.253) (-770.042) [-765.110] (-768.002) * (-766.986) (-765.481) (-768.907) [-766.585] -- 0:00:40
373000 -- (-766.348) (-763.951) [-764.678] (-769.427) * (-766.102) [-770.360] (-767.084) (-767.579) -- 0:00:42
373500 -- (-768.930) (-766.886) [-764.814] (-766.822) * (-767.764) [-768.504] (-770.778) (-770.225) -- 0:00:41
374000 -- (-765.177) (-766.597) (-766.548) [-773.049] * (-771.218) [-770.921] (-770.817) (-767.313) -- 0:00:41
374500 -- (-768.015) (-767.420) (-767.994) [-768.665] * (-766.028) [-767.664] (-770.719) (-768.579) -- 0:00:41
375000 -- (-766.848) (-770.183) [-766.399] (-768.186) * [-764.099] (-769.386) (-770.755) (-767.066) -- 0:00:41
Average standard deviation of split frequencies: 0.011800
375500 -- [-764.141] (-767.064) (-765.633) (-767.467) * [-766.608] (-768.515) (-768.335) (-772.759) -- 0:00:41
376000 -- (-767.343) (-768.151) (-766.617) [-768.008] * [-766.906] (-770.182) (-768.619) (-771.080) -- 0:00:41
376500 -- [-769.105] (-766.505) (-765.951) (-773.309) * (-766.394) (-768.798) (-766.704) [-767.097] -- 0:00:41
377000 -- (-768.312) (-763.360) (-766.148) [-767.914] * (-765.568) [-767.399] (-766.156) (-768.248) -- 0:00:41
377500 -- (-770.724) [-764.175] (-769.667) (-766.441) * (-767.897) (-767.465) (-767.853) [-764.967] -- 0:00:41
378000 -- (-767.608) (-768.714) (-766.200) [-766.887] * (-771.894) (-772.521) (-768.340) [-765.965] -- 0:00:41
378500 -- (-767.517) (-766.997) (-765.081) [-771.432] * [-765.992] (-772.891) (-769.912) (-765.951) -- 0:00:41
379000 -- (-767.980) [-765.269] (-768.107) (-766.039) * (-768.024) (-768.315) (-766.957) [-768.098] -- 0:00:40
379500 -- (-767.922) (-763.573) [-766.367] (-766.938) * [-768.910] (-771.503) (-767.663) (-767.746) -- 0:00:40
380000 -- (-770.395) (-765.198) [-770.229] (-766.223) * [-766.985] (-766.786) (-766.971) (-767.314) -- 0:00:40
Average standard deviation of split frequencies: 0.011801
380500 -- (-767.033) (-769.540) [-767.285] (-768.246) * (-765.681) (-768.548) [-766.407] (-765.112) -- 0:00:40
381000 -- (-765.849) (-773.320) (-765.551) [-766.467] * (-771.386) (-768.636) [-768.478] (-764.480) -- 0:00:40
381500 -- [-767.960] (-768.014) (-769.000) (-768.504) * (-766.734) (-771.044) [-767.410] (-768.304) -- 0:00:40
382000 -- (-770.211) (-766.451) [-767.506] (-767.685) * (-767.333) (-771.146) [-770.744] (-764.733) -- 0:00:40
382500 -- (-769.707) (-764.040) (-766.876) [-766.926] * (-768.641) (-769.658) (-767.778) [-764.890] -- 0:00:40
383000 -- [-769.107] (-764.722) (-766.130) (-767.118) * [-766.726] (-767.636) (-767.426) (-768.770) -- 0:00:40
383500 -- (-771.885) (-766.266) [-766.059] (-768.541) * (-768.149) (-764.914) (-767.027) [-765.824] -- 0:00:40
384000 -- (-772.038) (-765.722) [-766.851] (-766.945) * (-767.918) (-769.269) (-766.396) [-763.311] -- 0:00:40
384500 -- (-767.366) (-767.993) [-770.258] (-766.727) * (-767.822) (-767.783) (-767.771) [-764.763] -- 0:00:40
385000 -- [-765.191] (-764.918) (-767.114) (-767.238) * (-767.776) (-767.618) (-767.569) [-763.827] -- 0:00:39
Average standard deviation of split frequencies: 0.011638
385500 -- [-766.337] (-767.185) (-770.847) (-766.797) * (-770.080) (-766.431) [-767.817] (-766.152) -- 0:00:39
386000 -- [-765.684] (-769.825) (-767.964) (-766.939) * (-770.219) (-767.607) [-766.166] (-763.885) -- 0:00:39
386500 -- (-767.908) (-766.528) [-772.713] (-774.106) * (-767.025) (-770.116) [-765.892] (-767.500) -- 0:00:39
387000 -- (-764.248) (-763.727) (-769.502) [-766.301] * [-764.572] (-771.161) (-772.917) (-767.534) -- 0:00:39
387500 -- [-766.425] (-773.301) (-771.075) (-768.334) * [-765.963] (-766.844) (-769.606) (-769.413) -- 0:00:39
388000 -- (-774.561) (-766.096) (-769.336) [-771.175] * [-770.588] (-769.331) (-772.005) (-766.221) -- 0:00:39
388500 -- [-768.267] (-765.560) (-769.335) (-769.402) * (-770.181) (-768.549) (-769.096) [-764.944] -- 0:00:39
389000 -- (-768.896) [-764.112] (-768.094) (-771.339) * (-766.443) (-765.780) (-768.301) [-764.375] -- 0:00:40
389500 -- (-766.983) (-769.210) (-766.722) [-767.518] * (-766.675) [-764.513] (-766.733) (-767.672) -- 0:00:40
390000 -- [-766.240] (-768.820) (-768.748) (-768.543) * (-766.673) (-767.058) (-768.289) [-765.731] -- 0:00:40
Average standard deviation of split frequencies: 0.011783
390500 -- [-767.206] (-766.177) (-766.522) (-768.417) * [-769.511] (-770.275) (-766.794) (-765.930) -- 0:00:40
391000 -- (-767.549) (-769.140) [-766.384] (-770.199) * (-768.280) [-770.013] (-766.710) (-767.617) -- 0:00:40
391500 -- (-768.038) (-765.778) (-766.577) [-767.449] * (-767.123) (-770.659) (-768.871) [-765.161] -- 0:00:40
392000 -- (-767.809) (-767.501) [-765.876] (-768.743) * (-774.028) [-769.600] (-768.515) (-771.558) -- 0:00:40
392500 -- (-764.297) (-766.642) (-766.423) [-767.239] * [-771.050] (-768.212) (-768.008) (-768.980) -- 0:00:40
393000 -- (-766.355) (-768.977) (-768.597) [-769.626] * [-766.693] (-766.604) (-768.684) (-768.275) -- 0:00:40
393500 -- (-768.611) (-769.138) (-767.141) [-767.159] * (-769.812) (-768.721) (-770.170) [-764.718] -- 0:00:40
394000 -- [-768.467] (-764.454) (-768.338) (-767.663) * (-768.286) (-770.794) (-771.875) [-765.999] -- 0:00:39
394500 -- (-765.197) (-767.781) [-765.667] (-767.501) * (-769.915) (-768.667) (-765.720) [-764.705] -- 0:00:39
395000 -- (-765.024) [-768.823] (-769.419) (-767.194) * (-768.027) (-766.734) [-767.178] (-766.981) -- 0:00:39
Average standard deviation of split frequencies: 0.012499
395500 -- (-764.112) (-766.849) (-771.201) [-766.428] * [-766.647] (-765.946) (-766.142) (-767.439) -- 0:00:39
396000 -- (-764.648) [-766.992] (-767.363) (-765.811) * (-767.243) (-769.121) [-766.945] (-765.809) -- 0:00:39
396500 -- (-765.154) [-765.735] (-767.708) (-765.686) * (-768.074) (-769.770) (-768.322) [-767.756] -- 0:00:39
397000 -- (-767.313) (-767.808) (-765.526) [-766.958] * (-766.300) (-765.685) (-766.086) [-766.453] -- 0:00:39
397500 -- (-766.122) [-767.407] (-767.939) (-766.589) * [-770.497] (-767.588) (-769.022) (-769.418) -- 0:00:39
398000 -- (-772.937) [-766.531] (-767.404) (-767.220) * (-769.646) (-763.983) (-770.089) [-767.967] -- 0:00:39
398500 -- (-765.906) [-768.226] (-767.656) (-766.764) * (-765.371) [-771.781] (-770.717) (-764.379) -- 0:00:39
399000 -- (-766.739) (-766.714) [-767.065] (-767.757) * (-764.976) (-768.737) (-766.955) [-765.683] -- 0:00:39
399500 -- (-765.177) [-768.103] (-764.821) (-768.560) * [-765.565] (-770.250) (-769.673) (-764.295) -- 0:00:39
400000 -- (-766.154) (-771.618) (-765.793) [-767.387] * [-765.260] (-768.037) (-770.904) (-766.156) -- 0:00:39
Average standard deviation of split frequencies: 0.012388
400500 -- [-766.417] (-768.014) (-766.249) (-768.553) * (-771.148) (-766.884) [-767.897] (-764.462) -- 0:00:38
401000 -- (-765.461) [-764.718] (-768.394) (-767.197) * (-768.088) (-766.849) (-769.626) [-768.309] -- 0:00:38
401500 -- (-767.881) [-767.961] (-767.351) (-767.280) * (-767.921) (-768.619) (-767.629) [-767.005] -- 0:00:38
402000 -- (-765.102) (-765.504) [-767.492] (-767.099) * (-766.891) [-764.390] (-765.786) (-765.254) -- 0:00:38
402500 -- [-764.820] (-770.745) (-770.783) (-768.319) * (-768.110) [-767.142] (-770.077) (-765.861) -- 0:00:38
403000 -- (-764.872) (-773.475) (-771.707) [-768.760] * (-766.625) (-769.813) (-767.539) [-766.370] -- 0:00:38
403500 -- (-765.622) (-767.019) (-770.986) [-771.221] * (-766.752) [-766.718] (-767.174) (-771.248) -- 0:00:38
404000 -- (-764.613) (-766.931) [-766.581] (-767.245) * (-772.671) (-765.735) (-766.683) [-767.731] -- 0:00:38
404500 -- (-766.644) [-766.623] (-765.820) (-771.111) * (-767.599) [-764.295] (-767.541) (-766.447) -- 0:00:39
405000 -- (-764.470) [-766.334] (-766.403) (-767.201) * (-769.437) (-766.228) [-764.813] (-769.008) -- 0:00:39
Average standard deviation of split frequencies: 0.012362
405500 -- (-766.291) [-766.825] (-767.382) (-766.813) * (-766.263) (-764.077) [-766.142] (-762.861) -- 0:00:39
406000 -- [-766.542] (-766.078) (-766.347) (-768.982) * (-767.451) (-765.303) (-768.376) [-767.950] -- 0:00:39
406500 -- (-764.214) (-766.483) [-764.856] (-768.643) * (-766.271) (-765.780) [-767.265] (-768.997) -- 0:00:39
407000 -- (-767.500) (-774.505) (-768.504) [-765.341] * (-765.990) [-763.839] (-769.432) (-764.470) -- 0:00:39
407500 -- [-771.935] (-767.614) (-767.558) (-767.204) * (-766.929) [-763.925] (-767.360) (-768.703) -- 0:00:39
408000 -- [-766.798] (-765.896) (-769.748) (-766.828) * (-766.448) [-768.279] (-765.147) (-767.994) -- 0:00:39
408500 -- (-766.849) (-765.306) [-764.067] (-767.825) * (-766.258) (-766.416) [-766.163] (-768.838) -- 0:00:39
409000 -- (-767.838) [-766.758] (-765.691) (-769.773) * (-768.823) [-765.569] (-767.194) (-765.637) -- 0:00:39
409500 -- (-771.521) (-766.011) [-765.963] (-766.116) * (-766.701) (-764.234) [-765.439] (-769.784) -- 0:00:38
410000 -- (-768.184) [-765.292] (-767.188) (-766.932) * [-765.904] (-770.565) (-766.505) (-764.863) -- 0:00:38
Average standard deviation of split frequencies: 0.012154
410500 -- (-764.554) (-767.824) [-765.676] (-768.553) * (-767.090) (-767.875) [-769.259] (-765.086) -- 0:00:38
411000 -- (-764.045) (-765.501) (-769.543) [-765.294] * (-763.610) (-765.227) [-767.356] (-764.143) -- 0:00:38
411500 -- (-765.181) [-765.538] (-765.794) (-770.885) * (-765.390) [-766.417] (-768.735) (-766.386) -- 0:00:38
412000 -- (-764.544) [-764.597] (-764.379) (-767.071) * (-764.548) [-766.349] (-767.909) (-765.143) -- 0:00:38
412500 -- (-770.034) (-764.468) (-767.946) [-768.280] * (-770.024) [-766.202] (-765.064) (-766.597) -- 0:00:38
413000 -- (-768.763) (-767.216) (-767.087) [-767.389] * (-774.165) (-768.051) (-766.194) [-765.180] -- 0:00:38
413500 -- (-767.404) [-766.088] (-770.363) (-768.709) * (-767.990) (-765.217) (-768.724) [-767.041] -- 0:00:38
414000 -- (-767.331) (-767.534) (-766.668) [-768.812] * (-768.739) [-764.872] (-770.316) (-768.669) -- 0:00:38
414500 -- (-765.166) (-765.766) (-766.300) [-766.792] * (-768.878) [-764.050] (-765.995) (-768.872) -- 0:00:38
415000 -- (-766.784) (-768.377) [-767.443] (-768.150) * (-766.001) (-765.132) (-765.827) [-765.631] -- 0:00:38
Average standard deviation of split frequencies: 0.012332
415500 -- (-767.936) [-766.554] (-767.968) (-768.199) * (-766.185) [-765.734] (-766.517) (-765.851) -- 0:00:37
416000 -- [-768.254] (-766.564) (-766.042) (-772.233) * (-769.470) (-768.840) [-769.392] (-766.119) -- 0:00:37
416500 -- (-766.455) (-768.473) [-768.546] (-772.236) * (-772.372) (-775.510) [-765.924] (-765.990) -- 0:00:37
417000 -- [-775.672] (-769.726) (-765.533) (-766.651) * (-773.551) (-767.522) [-766.526] (-769.353) -- 0:00:37
417500 -- (-770.917) (-769.854) (-766.237) [-765.470] * [-768.065] (-766.810) (-767.310) (-769.036) -- 0:00:37
418000 -- (-765.860) (-772.360) [-767.725] (-766.736) * (-769.981) (-766.526) (-767.809) [-765.241] -- 0:00:37
418500 -- (-770.443) (-766.904) [-766.159] (-766.389) * (-769.329) (-766.220) (-765.843) [-766.835] -- 0:00:37
419000 -- [-766.089] (-771.177) (-765.642) (-768.495) * (-771.107) (-767.253) [-766.698] (-766.445) -- 0:00:37
419500 -- (-773.287) [-767.495] (-767.267) (-767.793) * (-768.448) (-767.731) (-771.217) [-764.876] -- 0:00:37
420000 -- [-766.406] (-771.849) (-768.019) (-768.069) * (-766.872) (-768.798) (-769.985) [-769.605] -- 0:00:38
Average standard deviation of split frequencies: 0.011338
420500 -- (-766.897) (-766.615) [-766.743] (-764.747) * (-767.654) (-769.392) (-770.475) [-764.720] -- 0:00:38
421000 -- (-769.259) (-767.458) (-767.636) [-770.911] * (-769.782) (-764.811) (-766.671) [-766.351] -- 0:00:38
421500 -- (-766.299) (-767.289) (-768.682) [-765.436] * (-766.224) (-766.846) (-766.876) [-765.980] -- 0:00:38
422000 -- [-766.037] (-767.044) (-764.664) (-766.670) * (-766.770) (-766.350) (-767.105) [-765.875] -- 0:00:38
422500 -- [-767.542] (-766.601) (-770.786) (-766.586) * [-766.900] (-765.487) (-766.943) (-764.767) -- 0:00:38
423000 -- (-765.889) (-768.231) [-766.740] (-767.660) * (-770.832) (-766.020) [-767.081] (-765.064) -- 0:00:38
423500 -- (-766.869) (-769.799) [-768.039] (-770.722) * (-770.842) (-767.640) (-772.142) [-767.620] -- 0:00:38
424000 -- (-767.041) (-766.709) [-765.879] (-766.068) * (-773.007) [-766.449] (-769.065) (-769.452) -- 0:00:38
424500 -- (-769.107) (-767.137) (-766.911) [-765.309] * (-769.622) (-766.952) [-764.571] (-772.078) -- 0:00:37
425000 -- (-770.115) (-767.854) (-768.258) [-765.109] * (-767.106) (-767.129) [-765.534] (-769.799) -- 0:00:37
Average standard deviation of split frequencies: 0.010871
425500 -- (-765.483) [-765.715] (-771.599) (-766.379) * (-768.753) (-768.530) [-769.334] (-767.206) -- 0:00:37
426000 -- (-768.005) [-766.970] (-770.005) (-767.819) * [-770.864] (-765.942) (-767.031) (-766.986) -- 0:00:37
426500 -- [-765.745] (-769.281) (-764.071) (-766.772) * (-772.512) (-765.819) [-766.623] (-769.123) -- 0:00:37
427000 -- (-771.299) (-765.797) [-763.907] (-766.958) * (-770.217) (-765.961) [-765.332] (-767.548) -- 0:00:37
427500 -- (-768.059) (-768.744) [-764.169] (-766.160) * (-765.964) [-764.515] (-766.983) (-769.170) -- 0:00:37
428000 -- (-766.784) (-765.059) (-771.817) [-769.666] * (-764.701) (-763.520) [-767.627] (-766.732) -- 0:00:37
428500 -- (-768.869) [-767.518] (-769.133) (-765.647) * [-765.580] (-766.690) (-765.086) (-769.990) -- 0:00:37
429000 -- [-767.543] (-765.536) (-764.011) (-769.433) * [-765.226] (-768.438) (-766.202) (-767.555) -- 0:00:37
429500 -- (-766.360) (-765.338) (-766.468) [-765.938] * (-767.338) (-767.522) (-765.761) [-766.556] -- 0:00:37
430000 -- (-767.948) (-765.190) (-765.562) [-767.193] * (-766.260) [-769.123] (-766.625) (-768.084) -- 0:00:37
Average standard deviation of split frequencies: 0.011268
430500 -- (-767.524) (-771.182) [-768.473] (-766.187) * (-767.912) (-767.825) [-768.403] (-768.026) -- 0:00:37
431000 -- (-771.844) (-767.024) (-767.499) [-764.471] * (-767.379) (-765.190) [-766.104] (-767.944) -- 0:00:36
431500 -- [-769.208] (-767.474) (-767.335) (-765.502) * (-767.680) (-769.950) [-766.152] (-767.001) -- 0:00:36
432000 -- (-771.297) (-768.827) (-770.475) [-768.213] * (-767.727) (-769.241) [-765.871] (-765.364) -- 0:00:36
432500 -- [-767.080] (-769.269) (-765.853) (-765.615) * (-767.958) (-767.514) (-767.427) [-767.628] -- 0:00:36
433000 -- (-766.609) [-767.652] (-765.533) (-766.161) * [-767.854] (-769.209) (-767.027) (-766.432) -- 0:00:36
433500 -- (-768.221) (-770.213) (-768.609) [-767.781] * (-766.967) (-766.776) [-765.266] (-767.306) -- 0:00:36
434000 -- (-764.000) (-769.912) [-768.557] (-770.065) * (-766.263) (-766.779) [-764.169] (-767.603) -- 0:00:36
434500 -- [-765.546] (-767.103) (-766.632) (-769.741) * (-774.204) [-764.396] (-767.260) (-767.629) -- 0:00:36
435000 -- [-765.886] (-772.737) (-763.819) (-769.232) * (-771.336) (-765.523) (-766.781) [-766.362] -- 0:00:36
Average standard deviation of split frequencies: 0.010572
435500 -- (-768.327) (-769.331) [-764.408] (-766.514) * (-771.495) (-766.689) (-765.246) [-766.178] -- 0:00:37
436000 -- (-766.526) (-769.408) [-765.010] (-768.168) * [-768.859] (-771.397) (-768.317) (-766.161) -- 0:00:37
436500 -- (-764.773) [-766.619] (-769.077) (-767.513) * (-767.642) (-764.574) [-767.447] (-765.805) -- 0:00:37
437000 -- (-770.557) (-765.618) [-769.579] (-766.027) * (-769.454) (-770.039) [-768.571] (-766.592) -- 0:00:37
437500 -- (-770.190) (-765.936) (-767.594) [-767.556] * (-768.026) (-767.392) [-769.087] (-765.843) -- 0:00:37
438000 -- (-766.574) [-766.307] (-765.262) (-767.163) * (-770.555) [-766.978] (-767.325) (-769.407) -- 0:00:37
438500 -- [-764.792] (-768.866) (-765.535) (-766.122) * (-767.635) [-766.088] (-769.539) (-767.654) -- 0:00:37
439000 -- [-765.985] (-765.185) (-764.347) (-767.974) * (-769.930) [-766.465] (-767.436) (-769.691) -- 0:00:37
439500 -- [-766.646] (-764.497) (-764.368) (-768.302) * [-768.579] (-767.966) (-767.023) (-769.425) -- 0:00:36
440000 -- (-770.520) (-765.099) [-766.124] (-767.186) * (-768.581) (-766.996) [-767.479] (-768.811) -- 0:00:36
Average standard deviation of split frequencies: 0.010068
440500 -- (-766.255) (-765.725) [-765.642] (-769.456) * (-768.028) (-765.890) [-766.351] (-767.171) -- 0:00:36
441000 -- [-763.049] (-766.001) (-766.458) (-769.548) * [-768.305] (-771.158) (-768.784) (-765.212) -- 0:00:36
441500 -- (-766.896) (-767.786) (-765.328) [-765.743] * [-766.839] (-765.603) (-767.610) (-767.527) -- 0:00:36
442000 -- (-764.873) [-766.433] (-764.115) (-766.921) * [-768.673] (-766.464) (-766.691) (-767.526) -- 0:00:36
442500 -- (-764.835) [-767.404] (-767.090) (-770.578) * [-767.930] (-767.506) (-770.034) (-766.104) -- 0:00:36
443000 -- (-766.360) (-767.116) [-764.734] (-767.800) * (-766.330) (-764.945) [-765.345] (-766.785) -- 0:00:36
443500 -- (-767.618) (-767.669) (-767.861) [-766.413] * (-765.297) (-768.279) (-766.130) [-767.867] -- 0:00:36
444000 -- (-767.347) (-765.368) [-768.358] (-766.746) * (-767.515) (-765.336) (-767.242) [-767.978] -- 0:00:36
444500 -- (-766.367) [-765.840] (-765.290) (-769.125) * (-769.254) (-765.309) (-767.564) [-770.763] -- 0:00:36
445000 -- [-764.472] (-771.728) (-768.190) (-765.188) * (-767.320) (-771.693) [-765.002] (-769.411) -- 0:00:36
Average standard deviation of split frequencies: 0.009219
445500 -- (-766.737) (-768.546) (-764.193) [-764.878] * (-766.292) (-767.997) (-768.575) [-768.177] -- 0:00:36
446000 -- [-766.404] (-767.442) (-766.607) (-767.021) * [-766.854] (-768.468) (-767.028) (-767.644) -- 0:00:36
446500 -- (-771.032) (-765.798) [-769.838] (-766.177) * (-768.977) (-768.243) (-765.916) [-765.962] -- 0:00:35
447000 -- (-764.951) (-766.880) (-765.406) [-765.300] * (-769.228) (-766.501) [-767.504] (-770.525) -- 0:00:35
447500 -- (-766.743) (-766.691) [-764.102] (-775.068) * [-765.922] (-767.035) (-765.888) (-767.275) -- 0:00:35
448000 -- (-770.786) (-765.145) (-764.682) [-769.247] * (-769.593) (-767.845) (-765.622) [-767.992] -- 0:00:35
448500 -- (-768.092) [-766.132] (-766.833) (-770.802) * [-769.036] (-768.152) (-765.083) (-770.718) -- 0:00:35
449000 -- (-768.981) (-769.299) [-765.390] (-767.638) * (-767.885) [-766.344] (-766.245) (-767.271) -- 0:00:35
449500 -- (-764.388) (-766.813) (-769.564) [-766.871] * (-767.177) (-766.259) [-769.243] (-769.595) -- 0:00:35
450000 -- [-765.747] (-768.367) (-766.712) (-771.966) * [-766.264] (-766.347) (-766.942) (-769.083) -- 0:00:35
Average standard deviation of split frequencies: 0.008122
450500 -- [-766.926] (-771.271) (-768.267) (-767.681) * (-766.627) [-766.694] (-767.136) (-773.428) -- 0:00:35
451000 -- [-766.455] (-766.370) (-765.622) (-767.414) * (-766.325) (-768.899) [-767.789] (-769.350) -- 0:00:36
451500 -- (-768.120) (-766.356) (-763.914) [-766.310] * (-774.940) (-767.831) (-766.606) [-766.720] -- 0:00:36
452000 -- (-766.557) [-766.314] (-765.809) (-766.268) * (-767.344) [-765.647] (-769.043) (-766.523) -- 0:00:36
452500 -- (-765.399) [-765.095] (-764.821) (-767.815) * (-768.303) [-766.821] (-766.615) (-765.841) -- 0:00:36
453000 -- (-764.394) (-764.455) [-767.323] (-767.313) * (-771.068) (-765.068) (-766.128) [-766.173] -- 0:00:36
453500 -- [-764.284] (-767.280) (-764.955) (-772.441) * (-768.496) [-766.945] (-767.594) (-769.026) -- 0:00:36
454000 -- (-765.275) (-766.397) (-765.623) [-766.483] * [-765.531] (-766.716) (-769.459) (-768.032) -- 0:00:36
454500 -- (-767.963) (-764.769) (-768.575) [-768.575] * [-765.050] (-766.065) (-766.454) (-767.852) -- 0:00:36
455000 -- (-768.715) [-765.929] (-764.074) (-764.843) * (-765.945) [-766.021] (-765.716) (-765.987) -- 0:00:35
Average standard deviation of split frequencies: 0.007845
455500 -- (-765.747) (-764.839) [-765.082] (-766.828) * (-767.571) (-766.060) [-765.866] (-766.284) -- 0:00:35
456000 -- (-764.257) [-764.536] (-765.220) (-766.667) * [-767.744] (-770.278) (-766.932) (-767.605) -- 0:00:35
456500 -- [-765.468] (-768.511) (-766.460) (-766.309) * (-767.477) (-766.723) [-769.098] (-767.605) -- 0:00:35
457000 -- (-767.268) (-768.088) (-764.993) [-766.757] * (-767.972) [-767.637] (-773.661) (-766.945) -- 0:00:35
457500 -- (-767.709) (-765.019) [-765.074] (-767.218) * (-767.975) (-766.094) (-767.195) [-766.575] -- 0:00:35
458000 -- (-770.194) (-768.748) [-765.502] (-767.590) * [-768.372] (-765.659) (-766.201) (-769.161) -- 0:00:35
458500 -- [-765.012] (-766.069) (-766.691) (-767.885) * [-767.644] (-766.125) (-767.645) (-771.357) -- 0:00:35
459000 -- (-764.085) (-765.473) [-766.964] (-766.326) * (-766.723) (-767.084) (-765.989) [-767.340] -- 0:00:35
459500 -- (-766.402) [-763.884] (-767.705) (-768.742) * [-767.995] (-766.149) (-764.209) (-764.556) -- 0:00:35
460000 -- [-766.933] (-763.156) (-765.356) (-767.210) * (-766.625) (-766.981) [-764.926] (-766.077) -- 0:00:35
Average standard deviation of split frequencies: 0.008186
460500 -- (-766.784) (-767.232) (-766.321) [-765.029] * (-770.836) (-766.306) [-766.907] (-764.922) -- 0:00:35
461000 -- (-769.682) (-765.116) (-766.458) [-764.312] * (-768.612) [-766.540] (-765.789) (-766.100) -- 0:00:35
461500 -- [-770.006] (-768.535) (-769.532) (-767.547) * (-768.574) (-766.094) (-763.965) [-765.767] -- 0:00:35
462000 -- (-772.608) (-766.196) [-766.050] (-766.633) * (-769.344) [-765.943] (-767.238) (-767.498) -- 0:00:34
462500 -- [-769.562] (-767.325) (-767.191) (-766.214) * [-766.804] (-766.862) (-767.793) (-766.333) -- 0:00:34
463000 -- (-768.615) [-765.989] (-767.527) (-765.125) * (-770.905) [-766.253] (-766.104) (-766.735) -- 0:00:34
463500 -- (-765.531) (-767.273) (-767.197) [-765.283] * (-765.359) [-766.320] (-767.373) (-764.514) -- 0:00:34
464000 -- (-766.763) (-767.756) [-766.678] (-767.341) * (-766.344) [-766.141] (-769.462) (-767.557) -- 0:00:34
464500 -- (-765.047) [-764.896] (-766.903) (-770.138) * (-765.767) [-769.148] (-766.371) (-764.517) -- 0:00:34
465000 -- (-766.526) [-766.341] (-766.238) (-765.912) * (-764.937) [-763.638] (-766.648) (-767.694) -- 0:00:34
Average standard deviation of split frequencies: 0.007736
465500 -- (-770.049) [-765.264] (-767.262) (-768.242) * (-766.397) (-766.877) [-768.017] (-766.178) -- 0:00:34
466000 -- (-766.488) (-765.775) (-768.769) [-767.573] * (-766.659) [-765.648] (-765.131) (-767.502) -- 0:00:34
466500 -- (-765.818) (-769.182) (-768.166) [-765.863] * (-766.776) (-766.747) [-766.481] (-765.965) -- 0:00:35
467000 -- [-767.856] (-767.240) (-767.143) (-766.135) * [-765.981] (-766.088) (-766.173) (-767.627) -- 0:00:35
467500 -- (-764.413) (-765.627) [-766.685] (-771.040) * (-764.803) (-771.077) [-767.271] (-765.765) -- 0:00:35
468000 -- (-766.651) (-766.074) (-769.131) [-770.698] * (-767.241) (-768.612) (-767.469) [-765.672] -- 0:00:35
468500 -- [-766.802] (-764.129) (-768.264) (-765.894) * (-766.485) [-771.409] (-767.136) (-768.477) -- 0:00:35
469000 -- [-764.755] (-765.379) (-768.606) (-767.712) * (-768.660) (-767.764) (-768.827) [-767.802] -- 0:00:35
469500 -- (-763.569) [-764.966] (-765.760) (-769.890) * (-767.484) [-765.849] (-768.691) (-765.008) -- 0:00:35
470000 -- (-766.808) [-765.941] (-766.908) (-767.715) * (-767.932) (-767.292) [-769.249] (-766.170) -- 0:00:34
Average standard deviation of split frequencies: 0.008071
470500 -- (-766.131) [-768.794] (-770.155) (-766.241) * (-771.057) [-769.080] (-765.351) (-765.006) -- 0:00:34
471000 -- [-765.754] (-767.219) (-766.988) (-767.564) * (-769.631) [-768.450] (-765.200) (-767.495) -- 0:00:34
471500 -- [-765.516] (-773.404) (-767.481) (-768.473) * (-771.659) (-768.891) [-768.009] (-771.630) -- 0:00:34
472000 -- (-766.346) (-765.341) (-764.425) [-770.439] * (-766.905) [-769.904] (-766.042) (-765.021) -- 0:00:34
472500 -- (-771.728) [-765.352] (-768.307) (-769.140) * [-767.692] (-768.722) (-766.089) (-764.553) -- 0:00:34
473000 -- (-767.118) (-766.970) [-767.816] (-768.887) * [-766.827] (-767.477) (-767.340) (-770.141) -- 0:00:34
473500 -- [-766.606] (-766.300) (-770.539) (-767.009) * (-764.052) (-767.092) (-767.283) [-765.542] -- 0:00:34
474000 -- [-766.536] (-766.965) (-770.871) (-772.189) * [-766.047] (-765.832) (-766.924) (-766.772) -- 0:00:34
474500 -- (-768.446) (-766.029) [-766.861] (-769.673) * (-767.298) [-766.477] (-767.603) (-766.755) -- 0:00:34
475000 -- [-768.631] (-768.366) (-767.985) (-767.890) * (-767.890) (-767.537) (-767.281) [-764.757] -- 0:00:34
Average standard deviation of split frequencies: 0.008156
475500 -- (-768.244) (-764.516) [-765.822] (-766.642) * (-770.125) [-767.025] (-768.192) (-764.037) -- 0:00:34
476000 -- [-765.459] (-765.255) (-766.475) (-769.981) * [-765.856] (-765.807) (-768.269) (-765.191) -- 0:00:34
476500 -- (-766.245) [-768.670] (-766.690) (-766.582) * (-765.873) (-767.170) [-766.990] (-765.386) -- 0:00:34
477000 -- (-767.980) [-766.634] (-768.771) (-765.532) * (-767.571) (-764.996) [-766.248] (-766.477) -- 0:00:33
477500 -- (-765.139) [-765.287] (-771.553) (-767.827) * (-766.494) (-768.996) [-765.743] (-766.125) -- 0:00:33
478000 -- (-768.414) (-766.230) (-769.358) [-765.419] * [-763.990] (-767.748) (-766.465) (-766.752) -- 0:00:33
478500 -- (-765.973) (-768.041) (-768.573) [-768.579] * (-766.705) (-768.492) [-764.893] (-766.351) -- 0:00:33
479000 -- [-767.063] (-766.623) (-767.929) (-765.833) * (-765.215) (-769.942) [-767.148] (-767.905) -- 0:00:33
479500 -- (-767.478) [-765.855] (-765.769) (-767.523) * (-767.118) (-769.151) [-766.691] (-766.236) -- 0:00:33
480000 -- (-767.834) (-766.241) [-767.288] (-768.155) * (-770.620) (-768.957) (-767.623) [-769.079] -- 0:00:33
Average standard deviation of split frequencies: 0.007904
480500 -- [-766.106] (-764.802) (-766.734) (-766.102) * (-766.352) (-767.725) (-766.779) [-770.833] -- 0:00:33
481000 -- [-765.609] (-766.257) (-768.830) (-765.289) * [-767.260] (-767.900) (-766.833) (-766.715) -- 0:00:33
481500 -- (-767.629) [-766.324] (-767.307) (-770.977) * (-765.746) (-766.149) [-768.768] (-769.061) -- 0:00:33
482000 -- (-766.319) [-765.707] (-766.746) (-766.889) * (-767.630) (-767.896) [-767.894] (-766.128) -- 0:00:34
482500 -- (-764.889) (-766.110) [-765.441] (-767.678) * (-765.868) [-767.263] (-767.647) (-766.887) -- 0:00:34
483000 -- (-766.752) [-766.580] (-768.408) (-767.846) * [-765.616] (-768.972) (-767.058) (-765.304) -- 0:00:34
483500 -- (-771.120) (-776.329) (-767.840) [-768.054] * (-766.728) [-771.306] (-766.992) (-764.741) -- 0:00:34
484000 -- (-766.546) (-763.057) [-768.789] (-766.594) * (-765.797) [-766.617] (-767.570) (-765.842) -- 0:00:34
484500 -- (-764.867) (-766.696) [-766.036] (-767.438) * [-765.612] (-767.066) (-764.682) (-766.276) -- 0:00:34
485000 -- (-766.008) (-765.771) [-765.856] (-768.545) * [-766.953] (-765.047) (-764.849) (-765.936) -- 0:00:33
Average standard deviation of split frequencies: 0.007988
485500 -- (-766.320) [-765.364] (-766.168) (-769.810) * (-766.907) (-769.048) [-764.597] (-765.780) -- 0:00:33
486000 -- (-764.635) [-767.237] (-766.464) (-765.719) * (-765.266) (-766.803) [-766.568] (-764.915) -- 0:00:33
486500 -- [-765.393] (-767.122) (-773.955) (-767.230) * [-764.208] (-765.553) (-766.764) (-766.790) -- 0:00:33
487000 -- (-769.317) (-769.541) (-767.413) [-766.821] * (-767.704) (-767.443) [-766.922] (-766.989) -- 0:00:33
487500 -- (-767.363) [-766.937] (-768.013) (-766.221) * (-768.505) (-767.306) [-765.363] (-766.918) -- 0:00:33
488000 -- (-769.675) [-767.231] (-768.371) (-767.219) * (-766.705) (-768.294) [-768.097] (-764.984) -- 0:00:33
488500 -- [-764.825] (-766.027) (-769.354) (-765.608) * (-764.167) (-772.791) (-769.465) [-764.031] -- 0:00:33
489000 -- (-768.247) (-766.916) [-768.383] (-768.006) * (-766.461) [-771.736] (-770.371) (-765.853) -- 0:00:33
489500 -- (-767.673) (-766.206) (-767.923) [-767.847] * (-767.049) [-769.644] (-772.733) (-767.841) -- 0:00:33
490000 -- (-768.128) [-768.702] (-765.397) (-766.388) * (-765.973) (-771.993) (-770.224) [-765.380] -- 0:00:33
Average standard deviation of split frequencies: 0.007629
490500 -- [-766.389] (-767.078) (-768.322) (-765.214) * (-764.532) (-767.815) (-767.310) [-765.236] -- 0:00:33
491000 -- (-767.295) (-773.393) (-767.332) [-766.029] * (-766.347) (-767.442) (-767.711) [-765.686] -- 0:00:33
491500 -- [-765.138] (-771.176) (-767.940) (-764.050) * [-766.977] (-766.914) (-771.270) (-765.524) -- 0:00:33
492000 -- (-766.412) [-765.497] (-767.615) (-764.819) * (-768.089) (-769.605) [-768.362] (-769.360) -- 0:00:33
492500 -- (-765.468) [-766.768] (-764.781) (-765.236) * [-765.210] (-770.344) (-767.437) (-765.592) -- 0:00:32
493000 -- (-769.494) (-765.891) (-767.692) [-765.261] * (-767.437) (-768.388) (-768.079) [-767.022] -- 0:00:32
493500 -- (-770.943) (-768.281) (-765.505) [-768.264] * (-766.384) (-768.629) (-769.343) [-767.589] -- 0:00:32
494000 -- (-766.105) (-765.313) [-767.544] (-771.088) * [-767.701] (-769.157) (-766.919) (-765.792) -- 0:00:32
494500 -- (-772.212) [-764.467] (-766.755) (-766.573) * (-766.781) (-765.962) [-766.298] (-768.150) -- 0:00:32
495000 -- (-767.763) (-763.672) [-766.329] (-767.663) * (-766.224) (-765.189) (-769.038) [-770.223] -- 0:00:32
Average standard deviation of split frequencies: 0.007156
495500 -- (-770.273) (-768.312) [-767.852] (-769.784) * [-768.837] (-765.606) (-768.073) (-767.442) -- 0:00:32
496000 -- (-767.444) [-764.525] (-765.494) (-771.944) * (-765.254) (-764.903) (-767.700) [-771.023] -- 0:00:32
496500 -- (-767.313) (-763.681) (-767.130) [-771.495] * (-767.992) (-767.286) (-767.276) [-766.645] -- 0:00:32
497000 -- [-766.040] (-767.340) (-771.897) (-765.827) * (-765.811) (-771.319) (-771.056) [-768.768] -- 0:00:32
497500 -- (-766.834) [-765.813] (-767.729) (-766.067) * (-767.373) (-767.510) [-769.271] (-767.172) -- 0:00:33
498000 -- (-767.105) (-767.611) (-765.520) [-767.437] * (-769.114) [-763.848] (-770.846) (-766.746) -- 0:00:33
498500 -- (-766.766) (-766.836) (-767.092) [-766.720] * (-768.111) [-765.977] (-768.775) (-767.032) -- 0:00:33
499000 -- [-767.080] (-764.714) (-764.463) (-770.518) * (-765.196) (-767.575) (-769.988) [-766.475] -- 0:00:33
499500 -- [-764.964] (-764.224) (-765.356) (-765.600) * [-765.876] (-768.102) (-766.883) (-765.002) -- 0:00:33
500000 -- [-765.234] (-767.194) (-765.207) (-766.099) * (-764.833) [-768.948] (-766.540) (-766.349) -- 0:00:33
Average standard deviation of split frequencies: 0.006979
500500 -- (-771.982) (-766.582) (-766.152) [-769.075] * [-765.517] (-766.710) (-767.846) (-766.096) -- 0:00:32
501000 -- [-765.739] (-766.865) (-766.115) (-769.024) * (-767.345) [-767.081] (-768.863) (-767.798) -- 0:00:32
501500 -- [-765.753] (-766.127) (-765.340) (-767.192) * (-767.093) (-765.346) [-767.143] (-774.699) -- 0:00:32
502000 -- (-765.464) [-764.128] (-766.298) (-769.553) * (-765.117) [-767.166] (-767.757) (-765.927) -- 0:00:32
502500 -- (-766.253) [-767.718] (-763.777) (-765.659) * [-766.680] (-768.541) (-766.771) (-766.093) -- 0:00:32
503000 -- (-768.705) (-767.444) (-767.537) [-765.932] * (-766.045) [-772.071] (-766.909) (-766.838) -- 0:00:32
503500 -- (-774.184) [-765.225] (-769.111) (-768.611) * (-769.123) [-768.580] (-769.398) (-773.823) -- 0:00:32
504000 -- [-767.491] (-770.588) (-765.771) (-765.599) * (-771.497) (-766.548) (-767.881) [-766.170] -- 0:00:32
504500 -- (-767.171) (-764.191) [-766.045] (-764.294) * (-766.023) (-767.401) [-768.256] (-765.998) -- 0:00:32
505000 -- (-763.580) [-767.330] (-766.893) (-768.162) * [-765.740] (-768.373) (-767.983) (-767.039) -- 0:00:32
Average standard deviation of split frequencies: 0.006521
505500 -- (-764.909) [-769.029] (-768.071) (-765.022) * (-766.037) (-766.963) (-769.866) [-766.246] -- 0:00:32
506000 -- [-767.499] (-770.781) (-775.100) (-766.153) * (-766.261) (-766.546) (-766.512) [-766.499] -- 0:00:32
506500 -- (-767.849) (-769.040) (-769.847) [-767.346] * (-770.826) (-768.966) [-764.585] (-765.874) -- 0:00:32
507000 -- (-766.286) [-766.429] (-767.282) (-773.540) * (-766.722) (-767.650) (-765.274) [-765.915] -- 0:00:32
507500 -- (-767.919) (-766.579) (-767.647) [-766.202] * [-766.216] (-769.549) (-766.331) (-766.721) -- 0:00:32
508000 -- (-768.536) [-765.506] (-766.927) (-766.989) * (-765.614) (-767.270) (-768.317) [-767.475] -- 0:00:31
508500 -- (-766.001) (-766.334) [-766.221] (-767.891) * (-766.440) [-768.978] (-768.022) (-766.107) -- 0:00:31
509000 -- (-767.961) (-766.326) (-766.930) [-767.857] * (-773.125) [-770.646] (-766.988) (-768.158) -- 0:00:31
509500 -- [-766.330] (-767.426) (-771.054) (-766.450) * [-766.974] (-766.191) (-769.802) (-768.386) -- 0:00:31
510000 -- (-766.484) (-767.679) [-765.427] (-765.945) * (-766.078) (-768.306) (-766.174) [-766.621] -- 0:00:31
Average standard deviation of split frequencies: 0.007439
510500 -- [-765.215] (-768.373) (-766.757) (-766.828) * [-765.009] (-770.842) (-766.850) (-766.364) -- 0:00:31
511000 -- (-765.018) (-767.713) [-768.328] (-767.665) * (-766.036) (-770.039) (-766.442) [-771.537] -- 0:00:31
511500 -- (-767.089) (-768.054) (-766.562) [-767.266] * (-767.416) [-768.448] (-769.818) (-777.816) -- 0:00:31
512000 -- (-768.440) (-767.841) (-767.463) [-766.271] * [-764.987] (-767.247) (-768.577) (-771.837) -- 0:00:31
512500 -- [-768.152] (-765.773) (-771.239) (-770.867) * [-766.932] (-764.546) (-766.868) (-772.605) -- 0:00:31
513000 -- (-766.120) [-767.074] (-765.736) (-766.447) * [-767.773] (-767.709) (-766.119) (-770.902) -- 0:00:32
513500 -- (-765.442) (-766.783) [-768.245] (-767.401) * (-766.388) [-766.910] (-768.648) (-765.523) -- 0:00:32
514000 -- [-767.069] (-769.390) (-766.270) (-766.900) * [-766.351] (-767.746) (-766.289) (-767.276) -- 0:00:32
514500 -- (-764.203) [-767.447] (-766.503) (-767.661) * (-765.317) (-769.476) [-767.773] (-768.984) -- 0:00:32
515000 -- [-764.444] (-764.255) (-766.607) (-764.688) * (-769.935) [-767.988] (-766.069) (-768.934) -- 0:00:32
Average standard deviation of split frequencies: 0.006932
515500 -- (-767.345) (-767.528) (-766.314) [-768.973] * (-768.901) [-765.021] (-766.494) (-767.661) -- 0:00:31
516000 -- (-766.994) (-766.741) [-766.158] (-765.145) * (-768.219) (-764.536) [-764.831] (-769.257) -- 0:00:31
516500 -- (-767.481) (-766.706) [-767.893] (-766.600) * (-764.240) [-767.626] (-765.492) (-767.002) -- 0:00:31
517000 -- (-768.212) (-767.710) (-766.371) [-763.913] * (-767.353) (-768.514) (-768.302) [-765.801] -- 0:00:31
517500 -- [-765.378] (-771.889) (-767.939) (-765.656) * (-766.149) (-770.746) [-765.703] (-765.735) -- 0:00:31
518000 -- [-769.102] (-767.971) (-767.308) (-769.158) * (-766.448) (-767.152) (-769.195) [-765.345] -- 0:00:31
518500 -- (-768.342) [-767.837] (-769.642) (-767.956) * (-767.055) (-767.958) [-767.232] (-764.250) -- 0:00:31
519000 -- (-769.109) (-767.652) (-766.454) [-765.376] * (-766.244) [-767.389] (-766.405) (-768.357) -- 0:00:31
519500 -- (-768.066) [-765.964] (-767.050) (-764.179) * (-769.279) (-767.010) [-767.496] (-764.624) -- 0:00:31
520000 -- [-765.707] (-767.027) (-765.060) (-767.115) * (-767.538) [-766.303] (-764.717) (-767.439) -- 0:00:31
Average standard deviation of split frequencies: 0.007243
520500 -- [-764.500] (-767.705) (-769.201) (-774.814) * (-768.104) [-766.128] (-768.331) (-765.112) -- 0:00:31
521000 -- (-766.418) [-764.292] (-766.910) (-767.344) * (-763.988) (-766.457) [-765.203] (-765.521) -- 0:00:31
521500 -- (-774.307) [-768.900] (-768.604) (-765.285) * (-769.200) (-766.302) [-766.162] (-768.788) -- 0:00:31
522000 -- (-768.087) (-766.400) (-764.399) [-765.496] * (-770.266) (-766.470) (-764.714) [-771.549] -- 0:00:31
522500 -- (-766.720) [-766.401] (-767.767) (-769.705) * (-767.588) (-764.076) [-765.202] (-766.712) -- 0:00:31
523000 -- (-769.602) (-765.784) [-770.026] (-769.044) * (-768.547) (-770.195) (-766.289) [-766.853] -- 0:00:31
523500 -- (-768.643) (-764.285) [-771.428] (-766.636) * (-775.198) (-765.435) (-766.417) [-765.020] -- 0:00:30
524000 -- (-767.187) (-765.568) [-765.094] (-765.884) * [-769.311] (-764.099) (-763.405) (-765.106) -- 0:00:30
524500 -- (-765.449) (-766.505) (-764.975) [-763.855] * (-766.714) (-766.981) [-766.327] (-768.547) -- 0:00:30
525000 -- [-767.020] (-769.275) (-766.557) (-767.704) * (-768.027) (-766.972) (-766.581) [-764.967] -- 0:00:30
Average standard deviation of split frequencies: 0.006748
525500 -- [-764.331] (-765.228) (-768.114) (-767.374) * (-766.610) (-768.871) [-766.099] (-766.644) -- 0:00:30
526000 -- (-765.796) (-765.411) [-770.603] (-768.329) * [-768.254] (-771.176) (-766.436) (-769.662) -- 0:00:30
526500 -- (-768.395) (-763.549) (-772.223) [-766.807] * (-773.681) (-770.569) (-765.281) [-766.446] -- 0:00:30
527000 -- (-765.401) (-763.939) (-765.584) [-767.950] * (-766.377) (-766.542) [-766.292] (-772.125) -- 0:00:30
527500 -- (-766.436) [-766.044] (-766.606) (-766.251) * (-766.344) [-764.334] (-766.074) (-770.807) -- 0:00:30
528000 -- (-766.168) (-767.811) [-766.550] (-768.806) * (-766.231) [-766.578] (-764.907) (-770.784) -- 0:00:30
528500 -- (-767.891) [-768.282] (-766.903) (-766.098) * (-767.718) (-767.431) (-767.936) [-770.011] -- 0:00:31
529000 -- (-764.757) (-769.238) [-764.755] (-769.211) * (-765.994) [-763.879] (-764.264) (-769.874) -- 0:00:31
529500 -- [-769.489] (-769.058) (-765.667) (-766.996) * (-764.758) (-765.676) (-766.878) [-768.431] -- 0:00:31
530000 -- [-766.259] (-766.126) (-765.272) (-772.609) * (-766.645) [-766.612] (-771.076) (-769.796) -- 0:00:31
Average standard deviation of split frequencies: 0.007316
530500 -- (-768.558) [-765.124] (-767.466) (-772.496) * (-766.930) (-769.764) [-768.131] (-766.346) -- 0:00:30
531000 -- (-768.016) (-766.055) [-766.766] (-766.477) * (-767.138) (-765.093) (-766.732) [-768.947] -- 0:00:30
531500 -- (-767.201) (-768.279) [-766.517] (-765.929) * (-765.118) [-762.943] (-765.813) (-766.707) -- 0:00:30
532000 -- (-765.947) (-766.877) (-768.764) [-765.963] * (-772.112) [-766.031] (-764.976) (-768.783) -- 0:00:30
532500 -- (-766.021) (-766.632) [-765.435] (-767.220) * (-768.357) (-766.823) (-767.772) [-765.567] -- 0:00:30
533000 -- [-766.627] (-768.252) (-766.141) (-768.236) * [-767.393] (-766.683) (-763.972) (-768.288) -- 0:00:30
533500 -- [-766.112] (-767.481) (-765.631) (-768.855) * (-773.729) [-767.762] (-767.795) (-767.844) -- 0:00:30
534000 -- (-770.556) (-766.688) [-766.137] (-768.233) * (-766.914) (-768.642) [-765.693] (-767.028) -- 0:00:30
534500 -- (-768.910) (-768.513) (-766.803) [-766.483] * (-765.021) (-767.153) (-765.269) [-765.712] -- 0:00:30
535000 -- (-766.606) (-769.064) [-764.028] (-767.452) * (-768.694) (-765.642) [-766.397] (-765.704) -- 0:00:30
Average standard deviation of split frequencies: 0.007243
535500 -- (-767.911) [-766.741] (-766.112) (-767.037) * (-768.444) (-766.024) [-765.937] (-765.540) -- 0:00:30
536000 -- (-769.909) [-765.581] (-765.420) (-766.962) * (-766.908) (-766.900) [-767.501] (-770.510) -- 0:00:30
536500 -- (-765.306) (-768.386) (-766.323) [-763.720] * (-766.613) (-767.526) [-765.321] (-766.435) -- 0:00:30
537000 -- (-764.410) (-765.787) (-767.020) [-766.642] * [-764.895] (-765.816) (-769.321) (-766.261) -- 0:00:30
537500 -- (-763.619) (-766.055) (-769.239) [-767.706] * (-765.546) [-766.282] (-766.355) (-772.526) -- 0:00:30
538000 -- (-767.718) (-766.437) [-767.122] (-772.315) * (-768.458) (-767.697) (-763.921) [-764.200] -- 0:00:30
538500 -- (-766.568) (-768.310) [-766.685] (-770.437) * (-769.153) (-766.902) [-768.689] (-765.351) -- 0:00:29
539000 -- (-767.462) (-767.144) [-769.125] (-769.583) * (-768.762) (-768.511) [-767.747] (-765.253) -- 0:00:29
539500 -- (-765.730) (-769.936) [-766.987] (-769.189) * (-770.062) (-766.729) [-765.205] (-769.064) -- 0:00:29
540000 -- [-765.012] (-770.780) (-765.714) (-772.007) * [-766.243] (-765.889) (-764.512) (-771.409) -- 0:00:29
Average standard deviation of split frequencies: 0.007283
540500 -- [-764.509] (-767.907) (-766.639) (-771.590) * (-768.345) [-767.025] (-765.919) (-770.917) -- 0:00:29
541000 -- (-766.884) (-768.457) (-768.514) [-770.694] * (-766.156) [-766.280] (-766.665) (-764.444) -- 0:00:29
541500 -- (-768.890) (-766.497) (-766.825) [-767.850] * (-766.271) (-764.841) [-763.081] (-765.202) -- 0:00:29
542000 -- [-766.492] (-765.432) (-768.143) (-767.322) * [-767.653] (-769.234) (-766.479) (-765.960) -- 0:00:29
542500 -- (-767.965) [-766.799] (-767.104) (-769.072) * (-766.543) (-767.783) [-765.685] (-765.658) -- 0:00:29
543000 -- (-767.924) (-766.135) [-767.034] (-772.199) * (-775.594) [-768.004] (-766.291) (-765.348) -- 0:00:29
543500 -- (-766.582) (-764.931) (-768.230) [-766.114] * [-768.856] (-768.431) (-767.391) (-764.047) -- 0:00:29
544000 -- [-768.630] (-764.851) (-768.528) (-767.844) * (-765.377) (-765.919) (-766.346) [-765.420] -- 0:00:30
544500 -- [-764.654] (-764.767) (-766.565) (-769.702) * (-764.431) [-765.902] (-764.613) (-766.592) -- 0:00:30
545000 -- (-765.037) [-765.791] (-768.495) (-768.917) * (-766.296) (-770.348) [-764.437] (-768.486) -- 0:00:30
Average standard deviation of split frequencies: 0.006653
545500 -- (-766.211) [-767.344] (-765.709) (-769.042) * (-763.795) (-767.310) (-764.939) [-766.847] -- 0:00:29
546000 -- (-768.551) (-766.190) [-765.474] (-767.830) * (-766.142) (-768.303) [-767.721] (-766.657) -- 0:00:29
546500 -- [-765.373] (-766.407) (-768.531) (-769.298) * [-764.259] (-766.896) (-764.740) (-767.143) -- 0:00:29
547000 -- [-765.825] (-766.908) (-766.638) (-771.017) * (-764.458) (-768.220) (-766.523) [-765.660] -- 0:00:29
547500 -- (-767.902) (-767.750) [-767.070] (-769.518) * (-764.835) (-765.521) (-767.356) [-768.979] -- 0:00:29
548000 -- [-764.480] (-765.817) (-766.717) (-767.375) * [-769.361] (-767.764) (-766.209) (-765.448) -- 0:00:29
548500 -- (-765.435) (-768.549) (-768.456) [-764.722] * (-770.287) [-764.278] (-767.094) (-764.615) -- 0:00:29
549000 -- (-764.617) (-768.199) [-770.353] (-768.906) * (-766.608) [-764.020] (-766.771) (-767.322) -- 0:00:29
549500 -- [-763.643] (-766.090) (-768.489) (-766.204) * [-765.976] (-765.433) (-766.074) (-768.774) -- 0:00:29
550000 -- (-767.447) (-770.212) [-766.003] (-765.400) * [-765.822] (-765.744) (-767.849) (-767.822) -- 0:00:29
Average standard deviation of split frequencies: 0.006748
550500 -- (-767.879) (-765.862) [-767.417] (-766.835) * (-767.602) (-766.972) [-766.209] (-765.291) -- 0:00:29
551000 -- (-767.743) (-769.442) [-767.149] (-767.054) * (-769.925) [-765.713] (-766.167) (-767.585) -- 0:00:29
551500 -- (-769.191) (-766.409) [-771.245] (-766.140) * (-768.476) (-766.079) [-765.514] (-765.290) -- 0:00:29
552000 -- [-766.480] (-766.448) (-767.487) (-771.241) * (-770.203) [-768.584] (-767.949) (-765.420) -- 0:00:29
552500 -- (-770.047) (-767.326) (-766.868) [-765.934] * [-765.380] (-767.503) (-770.062) (-767.831) -- 0:00:29
553000 -- (-767.979) (-766.358) [-767.200] (-770.494) * (-766.774) (-765.490) (-766.710) [-766.181] -- 0:00:29
553500 -- [-764.829] (-768.156) (-765.900) (-765.588) * [-768.668] (-763.835) (-768.237) (-765.956) -- 0:00:29
554000 -- (-768.758) (-766.858) [-764.832] (-766.056) * [-768.206] (-763.265) (-767.733) (-766.906) -- 0:00:28
554500 -- [-766.129] (-773.766) (-767.273) (-766.626) * (-767.630) [-764.925] (-765.305) (-774.308) -- 0:00:28
555000 -- (-766.062) [-767.044] (-766.256) (-769.470) * (-764.648) (-767.284) [-764.697] (-766.109) -- 0:00:28
Average standard deviation of split frequencies: 0.006583
555500 -- [-765.602] (-765.935) (-769.230) (-766.367) * (-768.712) [-766.653] (-767.395) (-769.977) -- 0:00:28
556000 -- [-767.667] (-766.267) (-768.630) (-766.563) * (-769.347) (-766.275) [-769.025] (-766.718) -- 0:00:28
556500 -- (-766.439) (-769.410) [-765.799] (-766.080) * (-766.175) (-765.234) [-765.841] (-766.088) -- 0:00:28
557000 -- [-766.977] (-769.046) (-768.497) (-764.766) * (-766.053) (-765.600) (-766.641) [-766.943] -- 0:00:28
557500 -- (-770.642) [-767.746] (-767.990) (-769.011) * (-767.965) (-766.915) (-766.213) [-765.680] -- 0:00:28
558000 -- (-766.111) (-766.584) [-766.649] (-766.115) * (-768.579) (-766.551) [-766.002] (-766.710) -- 0:00:28
558500 -- (-765.079) (-770.290) (-772.607) [-766.638] * (-765.624) (-764.542) (-767.417) [-765.531] -- 0:00:28
559000 -- (-772.148) (-769.082) [-766.768] (-767.107) * [-766.855] (-765.191) (-771.250) (-765.818) -- 0:00:28
559500 -- (-767.803) (-769.708) [-766.761] (-766.271) * (-766.908) (-765.050) (-768.431) [-767.287] -- 0:00:29
560000 -- (-768.008) [-767.552] (-768.151) (-766.038) * (-767.940) (-767.450) (-770.117) [-765.671] -- 0:00:29
Average standard deviation of split frequencies: 0.006380
560500 -- (-767.949) (-766.862) (-767.073) [-770.554] * (-765.616) (-766.924) [-766.644] (-765.023) -- 0:00:29
561000 -- (-767.841) (-764.291) (-764.946) [-766.434] * (-767.435) (-765.594) (-767.103) [-766.854] -- 0:00:28
561500 -- (-766.525) (-767.939) [-766.768] (-766.752) * [-765.034] (-766.830) (-772.434) (-764.839) -- 0:00:28
562000 -- (-767.122) [-766.305] (-765.634) (-767.226) * (-768.643) (-766.595) [-768.345] (-766.165) -- 0:00:28
562500 -- [-769.414] (-768.167) (-767.500) (-767.999) * (-768.017) (-764.403) [-765.047] (-767.359) -- 0:00:28
563000 -- (-766.412) (-765.696) [-766.375] (-768.788) * [-767.617] (-766.453) (-763.614) (-768.855) -- 0:00:28
563500 -- (-765.835) (-764.180) [-765.337] (-768.066) * (-767.795) (-768.930) [-769.865] (-768.304) -- 0:00:28
564000 -- (-767.471) (-765.401) [-767.260] (-767.174) * [-767.856] (-766.938) (-766.884) (-766.330) -- 0:00:28
564500 -- [-765.544] (-765.606) (-766.654) (-768.632) * (-766.382) (-771.967) [-764.194] (-766.418) -- 0:00:28
565000 -- (-767.525) (-771.312) [-765.157] (-765.453) * (-767.959) (-765.734) [-766.033] (-768.512) -- 0:00:28
Average standard deviation of split frequencies: 0.006124
565500 -- (-772.833) [-764.949] (-764.357) (-766.192) * (-769.698) (-767.701) (-766.790) [-768.785] -- 0:00:28
566000 -- (-769.102) [-769.194] (-768.197) (-767.938) * (-771.155) (-767.196) [-766.651] (-765.414) -- 0:00:28
566500 -- (-766.361) (-765.254) [-769.302] (-767.038) * (-767.126) [-766.331] (-762.989) (-766.703) -- 0:00:28
567000 -- (-766.872) [-763.172] (-769.478) (-765.307) * (-770.747) [-765.995] (-765.812) (-766.196) -- 0:00:28
567500 -- (-768.460) [-765.632] (-764.730) (-767.062) * [-764.690] (-769.700) (-767.952) (-767.942) -- 0:00:28
568000 -- (-766.926) [-763.635] (-767.906) (-767.353) * (-765.127) (-770.895) [-767.238] (-768.796) -- 0:00:28
568500 -- (-766.444) [-770.941] (-769.432) (-771.611) * [-766.465] (-768.423) (-767.087) (-766.603) -- 0:00:28
569000 -- (-765.023) [-766.696] (-766.068) (-767.149) * (-766.056) (-768.178) (-767.219) [-767.208] -- 0:00:28
569500 -- (-766.774) (-764.886) [-763.553] (-770.886) * [-766.008] (-767.248) (-765.351) (-767.171) -- 0:00:27
570000 -- (-765.429) [-764.562] (-766.583) (-765.471) * [-767.517] (-766.899) (-767.580) (-767.146) -- 0:00:27
Average standard deviation of split frequencies: 0.006074
570500 -- (-766.395) [-767.253] (-766.651) (-767.786) * (-767.101) [-768.055] (-768.497) (-765.432) -- 0:00:27
571000 -- [-766.260] (-766.666) (-772.764) (-769.358) * (-768.247) [-766.981] (-765.009) (-767.627) -- 0:00:27
571500 -- [-766.158] (-764.491) (-767.183) (-769.624) * (-766.618) [-766.322] (-766.570) (-771.745) -- 0:00:27
572000 -- (-766.343) (-765.682) (-765.756) [-767.968] * (-769.405) (-766.633) [-764.636] (-770.311) -- 0:00:27
572500 -- (-768.704) (-766.362) [-765.249] (-768.740) * (-765.386) (-768.403) (-764.557) [-766.080] -- 0:00:27
573000 -- (-767.320) [-767.709] (-768.711) (-771.008) * (-766.823) (-768.381) [-767.823] (-769.658) -- 0:00:27
573500 -- (-764.869) [-766.143] (-767.707) (-771.218) * [-767.465] (-765.717) (-769.268) (-768.409) -- 0:00:27
574000 -- (-767.501) [-764.301] (-770.430) (-767.669) * (-766.940) (-767.085) [-764.462] (-766.877) -- 0:00:27
574500 -- [-767.105] (-767.530) (-770.507) (-767.065) * (-768.839) (-766.626) (-767.868) [-769.081] -- 0:00:27
575000 -- (-765.276) [-767.303] (-772.017) (-767.318) * [-764.057] (-767.240) (-768.058) (-766.220) -- 0:00:28
Average standard deviation of split frequencies: 0.006258
575500 -- (-765.928) (-770.308) (-766.227) [-765.027] * (-765.503) [-766.631] (-771.291) (-765.527) -- 0:00:28
576000 -- (-766.646) (-766.029) (-769.563) [-763.827] * (-767.442) (-767.053) (-777.355) [-768.432] -- 0:00:27
576500 -- (-766.652) [-770.114] (-769.251) (-765.942) * (-765.807) (-767.137) (-765.321) [-769.516] -- 0:00:27
577000 -- [-767.158] (-766.850) (-767.741) (-763.770) * [-765.388] (-767.160) (-765.975) (-768.455) -- 0:00:27
577500 -- (-765.393) (-766.861) (-767.328) [-765.983] * [-767.469] (-764.350) (-766.997) (-771.168) -- 0:00:27
578000 -- (-766.892) [-764.441] (-767.840) (-764.121) * (-765.556) (-772.023) [-764.193] (-766.272) -- 0:00:27
578500 -- (-767.012) (-766.968) [-771.352] (-764.385) * (-764.691) [-768.752] (-768.682) (-767.638) -- 0:00:27
579000 -- (-768.367) (-764.880) [-766.714] (-767.555) * (-769.557) (-768.366) (-770.440) [-766.522] -- 0:00:27
579500 -- [-764.184] (-766.901) (-769.611) (-767.135) * [-766.953] (-768.981) (-767.754) (-765.847) -- 0:00:27
580000 -- (-768.017) (-767.146) [-767.160] (-765.997) * [-771.483] (-767.155) (-766.312) (-765.625) -- 0:00:27
Average standard deviation of split frequencies: 0.005731
580500 -- [-765.832] (-769.255) (-766.932) (-766.930) * (-767.004) (-766.219) [-766.097] (-766.155) -- 0:00:27
581000 -- (-766.727) [-765.468] (-764.906) (-766.307) * (-767.005) (-770.075) [-766.466] (-767.100) -- 0:00:27
581500 -- [-765.944] (-769.646) (-767.180) (-764.046) * (-765.859) (-764.788) (-766.318) [-765.272] -- 0:00:27
582000 -- [-767.035] (-767.481) (-766.748) (-766.905) * (-765.913) (-765.188) (-768.056) [-766.356] -- 0:00:27
582500 -- (-768.499) (-772.166) (-768.757) [-767.555] * (-766.798) [-765.586] (-767.613) (-767.379) -- 0:00:27
583000 -- (-766.182) [-766.813] (-767.723) (-764.649) * [-767.843] (-766.017) (-767.765) (-766.302) -- 0:00:27
583500 -- (-768.049) (-767.288) (-772.467) [-765.181] * (-764.082) (-766.623) (-767.336) [-766.703] -- 0:00:27
584000 -- (-765.589) (-763.744) [-767.838] (-766.272) * (-766.347) (-770.122) (-766.416) [-766.466] -- 0:00:27
584500 -- (-765.147) (-767.598) [-766.981] (-765.462) * [-768.375] (-766.146) (-768.089) (-771.447) -- 0:00:27
585000 -- (-766.114) (-769.843) (-767.341) [-776.642] * [-768.317] (-765.632) (-767.815) (-772.754) -- 0:00:26
Average standard deviation of split frequencies: 0.005868
585500 -- (-765.207) [-766.116] (-766.485) (-775.837) * (-769.512) (-766.451) (-768.788) [-770.562] -- 0:00:26
586000 -- (-765.932) [-764.334] (-766.708) (-769.954) * [-765.840] (-766.173) (-766.311) (-769.097) -- 0:00:26
586500 -- (-767.596) (-768.874) (-767.555) [-765.657] * (-766.123) [-764.611] (-766.752) (-775.268) -- 0:00:26
587000 -- [-768.141] (-768.165) (-766.359) (-765.191) * (-767.104) (-766.827) [-767.352] (-767.700) -- 0:00:26
587500 -- (-767.130) (-766.573) [-766.170] (-768.480) * [-767.116] (-766.409) (-768.876) (-766.335) -- 0:00:26
588000 -- (-765.583) [-765.399] (-768.047) (-765.644) * [-769.880] (-765.480) (-766.850) (-767.245) -- 0:00:26
588500 -- (-767.983) (-765.912) (-772.085) [-765.298] * [-767.396] (-766.249) (-766.734) (-765.045) -- 0:00:26
589000 -- (-766.004) [-765.966] (-768.339) (-767.005) * (-770.097) (-769.862) (-768.072) [-765.898] -- 0:00:26
589500 -- [-765.796] (-767.576) (-768.175) (-765.305) * (-767.362) [-766.496] (-766.058) (-769.979) -- 0:00:26
590000 -- (-767.066) (-767.750) (-766.972) [-766.284] * (-766.905) [-769.056] (-768.434) (-763.907) -- 0:00:26
Average standard deviation of split frequencies: 0.006197
590500 -- (-766.053) [-766.621] (-768.002) (-769.609) * (-764.206) (-765.895) (-768.189) [-765.718] -- 0:00:27
591000 -- (-766.237) (-765.052) (-768.030) [-767.062] * (-767.844) (-765.635) (-773.116) [-766.605] -- 0:00:26
591500 -- (-767.456) (-770.945) (-767.872) [-763.560] * (-768.148) (-772.833) [-767.061] (-766.460) -- 0:00:26
592000 -- [-766.113] (-769.405) (-768.094) (-764.509) * (-766.386) (-767.899) (-768.344) [-763.966] -- 0:00:26
592500 -- (-766.669) [-769.337] (-768.117) (-765.663) * (-765.302) (-771.558) (-767.396) [-766.869] -- 0:00:26
593000 -- [-765.374] (-767.244) (-764.925) (-766.710) * (-766.760) (-767.780) [-765.852] (-766.866) -- 0:00:26
593500 -- [-766.737] (-769.480) (-767.179) (-764.869) * [-765.816] (-765.647) (-767.633) (-766.480) -- 0:00:26
594000 -- (-765.607) [-770.356] (-767.428) (-765.072) * (-770.754) (-769.123) [-765.258] (-764.093) -- 0:00:26
594500 -- (-766.065) (-768.025) [-767.094] (-764.514) * (-769.741) [-765.031] (-768.682) (-770.292) -- 0:00:26
595000 -- (-766.008) (-769.941) [-765.617] (-764.697) * (-768.040) [-766.161] (-766.936) (-768.095) -- 0:00:26
Average standard deviation of split frequencies: 0.006048
595500 -- (-765.281) (-770.212) [-763.745] (-765.335) * (-769.422) [-765.469] (-767.739) (-767.464) -- 0:00:26
596000 -- (-767.146) (-771.458) [-767.267] (-767.270) * (-766.995) (-766.275) [-765.233] (-775.878) -- 0:00:26
596500 -- [-765.067] (-769.402) (-765.839) (-767.946) * (-768.437) [-767.172] (-766.426) (-767.030) -- 0:00:26
597000 -- [-766.149] (-764.561) (-766.946) (-765.419) * (-769.210) [-764.334] (-768.661) (-765.938) -- 0:00:26
597500 -- [-765.722] (-768.480) (-766.236) (-765.476) * [-769.739] (-766.940) (-769.935) (-768.827) -- 0:00:26
598000 -- (-767.169) (-769.641) (-768.796) [-764.865] * (-764.378) (-766.318) [-769.561] (-771.067) -- 0:00:26
598500 -- [-766.935] (-775.487) (-768.014) (-768.996) * (-766.800) (-766.268) (-764.691) [-766.647] -- 0:00:26
599000 -- (-768.169) [-766.512] (-766.654) (-766.253) * (-767.313) [-765.626] (-767.319) (-766.126) -- 0:00:26
599500 -- (-766.897) (-769.711) [-767.902] (-768.217) * (-764.974) (-768.616) (-769.119) [-765.736] -- 0:00:26
600000 -- (-769.732) [-772.494] (-768.480) (-765.030) * (-765.188) (-766.837) (-767.836) [-768.411] -- 0:00:25
Average standard deviation of split frequencies: 0.005909
600500 -- [-766.236] (-767.255) (-767.528) (-769.750) * (-766.752) (-766.465) (-765.170) [-767.647] -- 0:00:25
601000 -- (-768.130) (-767.755) [-769.924] (-768.575) * (-765.904) (-765.574) [-765.707] (-768.804) -- 0:00:25
601500 -- (-767.500) (-766.843) (-767.243) [-766.600] * [-766.131] (-767.396) (-765.799) (-767.506) -- 0:00:25
602000 -- (-766.981) (-768.959) (-766.872) [-765.545] * [-766.279] (-767.948) (-766.288) (-768.973) -- 0:00:25
602500 -- (-766.401) (-764.575) (-768.152) [-766.290] * [-767.690] (-768.177) (-766.841) (-770.327) -- 0:00:25
603000 -- (-769.491) (-766.573) (-768.135) [-765.344] * (-771.419) [-766.025] (-768.619) (-770.418) -- 0:00:25
603500 -- [-768.618] (-766.580) (-767.429) (-767.641) * (-769.013) [-765.771] (-768.976) (-773.921) -- 0:00:25
604000 -- (-767.853) [-765.672] (-767.320) (-768.240) * (-767.522) (-766.267) [-766.362] (-773.360) -- 0:00:25
604500 -- [-765.842] (-765.418) (-769.673) (-766.985) * (-764.469) (-766.380) [-766.356] (-767.420) -- 0:00:25
605000 -- (-767.302) (-768.446) (-766.534) [-767.392] * (-766.361) (-770.236) [-768.624] (-767.391) -- 0:00:25
Average standard deviation of split frequencies: 0.006132
605500 -- [-765.156] (-769.156) (-768.070) (-768.582) * [-765.810] (-768.869) (-765.861) (-766.241) -- 0:00:25
606000 -- (-765.185) (-768.202) [-767.923] (-769.265) * (-767.429) [-768.098] (-766.626) (-769.297) -- 0:00:26
606500 -- (-764.415) [-766.415] (-775.156) (-766.073) * (-765.983) (-771.224) [-766.816] (-766.499) -- 0:00:25
607000 -- (-765.853) (-768.296) [-770.865] (-767.300) * (-773.091) (-772.651) (-765.843) [-764.360] -- 0:00:25
607500 -- [-766.286] (-765.572) (-766.347) (-767.231) * (-770.090) (-766.994) (-770.131) [-765.382] -- 0:00:25
608000 -- (-768.027) [-766.898] (-767.453) (-766.402) * (-766.544) [-764.565] (-770.089) (-764.780) -- 0:00:25
608500 -- (-765.213) [-766.427] (-768.641) (-769.321) * (-767.365) (-771.499) [-769.140] (-769.797) -- 0:00:25
609000 -- (-765.142) (-765.163) [-768.641] (-767.609) * [-768.115] (-768.810) (-766.816) (-765.514) -- 0:00:25
609500 -- (-768.668) (-768.549) [-769.106] (-774.074) * [-764.911] (-765.926) (-769.867) (-766.395) -- 0:00:25
610000 -- [-766.331] (-765.790) (-767.891) (-765.946) * [-766.435] (-765.845) (-772.721) (-765.846) -- 0:00:25
Average standard deviation of split frequencies: 0.006357
610500 -- (-764.661) (-767.257) (-768.108) [-765.632] * (-766.820) [-764.924] (-769.838) (-765.915) -- 0:00:25
611000 -- [-765.352] (-771.174) (-767.435) (-765.599) * (-766.676) [-767.221] (-765.686) (-766.839) -- 0:00:25
611500 -- (-765.859) [-767.773] (-767.727) (-767.580) * (-765.706) (-767.417) [-766.945] (-766.292) -- 0:00:25
612000 -- [-766.569] (-771.711) (-766.933) (-767.395) * (-768.225) (-768.384) (-767.677) [-766.486] -- 0:00:25
612500 -- [-763.839] (-772.697) (-766.424) (-767.736) * (-770.243) [-766.428] (-766.390) (-766.609) -- 0:00:25
613000 -- [-766.214] (-769.002) (-766.371) (-767.230) * (-771.987) (-767.021) (-766.658) [-763.920] -- 0:00:25
613500 -- (-770.653) (-765.918) (-766.757) [-764.251] * (-767.524) (-766.589) (-766.595) [-765.554] -- 0:00:25
614000 -- (-765.288) (-765.555) (-770.041) [-767.481] * (-770.322) (-765.575) (-766.970) [-769.655] -- 0:00:25
614500 -- [-766.567] (-767.555) (-770.674) (-766.830) * (-771.214) (-764.978) (-774.662) [-767.930] -- 0:00:25
615000 -- (-767.752) [-768.213] (-771.212) (-768.106) * [-771.252] (-767.626) (-766.913) (-767.556) -- 0:00:25
Average standard deviation of split frequencies: 0.006302
615500 -- [-768.909] (-766.249) (-766.792) (-768.817) * (-766.862) [-766.557] (-766.255) (-766.739) -- 0:00:24
616000 -- (-764.941) [-766.055] (-765.681) (-770.390) * (-765.729) (-770.589) (-768.804) [-766.017] -- 0:00:24
616500 -- (-767.586) [-765.812] (-768.730) (-770.998) * (-766.242) (-767.142) [-769.767] (-767.614) -- 0:00:24
617000 -- (-768.824) (-766.201) (-766.251) [-768.311] * (-764.825) (-768.302) [-768.455] (-769.486) -- 0:00:24
617500 -- (-765.220) (-765.512) (-770.399) [-769.475] * (-764.783) (-767.841) [-764.631] (-765.672) -- 0:00:24
618000 -- (-765.911) (-766.399) [-769.233] (-768.650) * [-764.175] (-766.750) (-767.965) (-764.635) -- 0:00:24
618500 -- (-766.311) (-763.850) (-768.798) [-764.235] * (-768.477) (-768.389) (-768.706) [-766.564] -- 0:00:24
619000 -- (-767.796) (-764.020) [-770.771] (-765.148) * [-765.688] (-766.851) (-767.454) (-766.754) -- 0:00:24
619500 -- (-766.461) (-768.294) (-773.534) [-767.276] * (-770.751) (-768.932) [-765.998] (-768.403) -- 0:00:24
620000 -- (-766.680) (-767.121) [-767.021] (-766.736) * (-765.242) (-767.840) (-766.305) [-764.582] -- 0:00:24
Average standard deviation of split frequencies: 0.005719
620500 -- (-766.047) [-764.307] (-770.673) (-767.886) * (-766.069) (-767.424) (-765.646) [-764.176] -- 0:00:24
621000 -- (-769.396) (-766.051) [-769.084] (-765.962) * [-766.483] (-771.292) (-768.545) (-766.253) -- 0:00:24
621500 -- (-766.162) (-774.858) (-770.809) [-769.643] * (-764.917) [-766.019] (-768.709) (-766.986) -- 0:00:24
622000 -- [-767.309] (-764.673) (-768.145) (-768.633) * (-765.807) [-767.569] (-769.181) (-766.852) -- 0:00:24
622500 -- [-766.159] (-767.821) (-767.071) (-766.139) * (-766.464) [-770.507] (-768.322) (-766.134) -- 0:00:24
623000 -- (-769.034) (-765.770) (-768.102) [-767.588] * (-769.828) (-766.178) (-772.492) [-764.758] -- 0:00:24
623500 -- (-766.420) (-764.352) (-768.005) [-766.554] * (-769.324) [-765.633] (-766.529) (-766.419) -- 0:00:24
624000 -- (-768.007) [-767.207] (-769.031) (-766.639) * (-773.076) (-769.292) (-768.700) [-766.706] -- 0:00:24
624500 -- (-766.940) (-772.944) [-765.962] (-765.909) * (-767.626) (-765.493) (-770.012) [-766.904] -- 0:00:24
625000 -- (-765.545) (-771.140) [-767.924] (-768.711) * (-769.228) (-766.766) [-766.881] (-769.009) -- 0:00:24
Average standard deviation of split frequencies: 0.005847
625500 -- (-765.354) [-766.679] (-767.257) (-767.717) * [-766.926] (-767.618) (-766.389) (-767.585) -- 0:00:24
626000 -- (-767.549) (-766.834) (-767.784) [-766.441] * (-769.731) [-766.210] (-768.009) (-769.019) -- 0:00:24
626500 -- (-766.973) (-766.264) (-768.017) [-765.645] * (-768.986) [-766.633] (-766.439) (-768.541) -- 0:00:24
627000 -- [-766.588] (-767.842) (-766.940) (-765.316) * (-766.694) [-766.443] (-765.912) (-770.187) -- 0:00:24
627500 -- [-768.968] (-763.674) (-767.585) (-768.062) * (-767.531) [-764.336] (-766.758) (-769.224) -- 0:00:24
628000 -- (-767.356) [-766.318] (-768.416) (-766.484) * (-767.223) [-764.716] (-767.403) (-766.984) -- 0:00:24
628500 -- (-767.291) (-772.544) (-766.593) [-768.206] * (-767.229) (-767.495) (-766.943) [-769.154] -- 0:00:24
629000 -- [-771.658] (-767.743) (-766.701) (-771.433) * [-765.539] (-769.096) (-769.264) (-770.320) -- 0:00:24
629500 -- [-765.233] (-767.811) (-769.464) (-765.153) * [-766.476] (-768.038) (-766.062) (-767.095) -- 0:00:24
630000 -- (-765.783) (-765.825) (-767.312) [-765.505] * (-767.284) [-765.195] (-765.031) (-773.709) -- 0:00:24
Average standard deviation of split frequencies: 0.005628
630500 -- (-766.647) [-766.184] (-765.785) (-766.191) * (-767.736) (-767.635) (-765.481) [-767.836] -- 0:00:24
631000 -- (-767.337) [-765.430] (-767.068) (-766.797) * (-766.849) (-769.650) (-765.318) [-766.251] -- 0:00:23
631500 -- (-764.943) [-765.363] (-766.721) (-767.552) * (-767.607) (-766.980) (-766.796) [-767.979] -- 0:00:23
632000 -- [-765.539] (-764.796) (-769.167) (-766.414) * (-767.725) (-769.803) [-767.148] (-764.994) -- 0:00:23
632500 -- (-765.889) (-767.160) (-770.937) [-767.959] * [-765.647] (-766.977) (-764.459) (-769.114) -- 0:00:23
633000 -- (-767.945) (-764.781) [-767.742] (-769.285) * (-767.723) [-766.109] (-767.072) (-765.813) -- 0:00:23
633500 -- (-764.941) [-766.813] (-767.691) (-768.079) * (-766.786) (-765.893) (-765.685) [-766.188] -- 0:00:23
634000 -- (-767.014) [-768.217] (-767.137) (-767.731) * [-767.483] (-767.403) (-767.379) (-765.668) -- 0:00:23
634500 -- [-764.203] (-767.119) (-768.182) (-763.103) * (-768.673) [-767.147] (-765.884) (-767.912) -- 0:00:23
635000 -- [-767.213] (-765.346) (-771.295) (-765.342) * (-769.512) [-766.388] (-767.852) (-767.570) -- 0:00:23
Average standard deviation of split frequencies: 0.005712
635500 -- (-766.740) (-771.786) (-768.392) [-765.656] * (-769.401) (-765.601) (-765.977) [-766.647] -- 0:00:23
636000 -- [-766.794] (-765.937) (-765.462) (-765.837) * (-768.650) [-766.533] (-766.910) (-770.557) -- 0:00:23
636500 -- (-766.231) [-768.398] (-770.512) (-766.554) * [-768.207] (-766.312) (-767.439) (-773.823) -- 0:00:23
637000 -- (-765.946) (-768.985) (-769.252) [-766.706] * (-769.138) (-767.627) (-771.686) [-767.336] -- 0:00:23
637500 -- (-766.961) (-767.116) (-766.298) [-766.057] * (-768.930) [-767.870] (-773.885) (-771.152) -- 0:00:23
638000 -- (-766.646) (-766.837) [-768.205] (-766.061) * (-768.648) (-767.640) [-768.298] (-767.372) -- 0:00:23
638500 -- (-766.710) (-768.455) [-765.877] (-767.165) * (-766.671) (-768.416) [-769.902] (-767.071) -- 0:00:23
639000 -- [-764.924] (-766.186) (-766.474) (-768.924) * (-770.093) (-769.604) (-766.780) [-769.405] -- 0:00:23
639500 -- [-767.207] (-768.817) (-768.153) (-768.417) * (-766.526) [-766.772] (-769.066) (-765.829) -- 0:00:23
640000 -- (-768.852) [-764.727] (-768.702) (-766.844) * (-767.540) (-769.628) [-764.623] (-767.653) -- 0:00:23
Average standard deviation of split frequencies: 0.005757
640500 -- (-767.319) [-768.005] (-769.478) (-767.892) * (-769.799) [-768.167] (-766.623) (-766.945) -- 0:00:23
641000 -- (-768.166) [-768.279] (-767.743) (-769.042) * [-768.612] (-767.056) (-766.939) (-767.284) -- 0:00:23
641500 -- (-766.416) (-767.506) (-767.583) [-766.041] * (-768.398) [-764.144] (-766.514) (-766.693) -- 0:00:23
642000 -- (-766.391) (-766.745) [-767.072] (-767.296) * [-766.367] (-770.533) (-767.068) (-767.081) -- 0:00:23
642500 -- [-766.568] (-767.915) (-769.872) (-768.590) * (-766.994) (-764.647) [-767.786] (-767.946) -- 0:00:23
643000 -- [-766.064] (-770.443) (-768.136) (-767.208) * (-766.733) (-766.130) (-769.460) [-772.981] -- 0:00:23
643500 -- [-769.673] (-768.421) (-771.191) (-768.879) * [-769.407] (-767.580) (-765.518) (-765.803) -- 0:00:23
644000 -- [-768.284] (-768.731) (-773.133) (-764.073) * [-765.375] (-768.016) (-765.160) (-769.963) -- 0:00:23
644500 -- (-766.932) (-766.113) [-767.344] (-766.780) * (-765.507) (-767.058) [-767.066] (-769.762) -- 0:00:23
645000 -- [-768.292] (-766.275) (-766.414) (-766.179) * (-771.226) (-765.918) (-772.465) [-767.959] -- 0:00:23
Average standard deviation of split frequencies: 0.005409
645500 -- (-768.936) [-766.288] (-767.533) (-768.521) * (-778.321) (-766.284) [-771.381] (-767.624) -- 0:00:23
646000 -- (-767.086) (-765.622) (-765.343) [-764.792] * (-766.443) [-765.551] (-769.450) (-769.593) -- 0:00:23
646500 -- [-768.138] (-766.353) (-766.138) (-767.234) * [-767.745] (-767.691) (-773.132) (-766.001) -- 0:00:22
647000 -- [-765.896] (-767.503) (-766.495) (-766.267) * (-766.743) [-765.539] (-767.749) (-770.229) -- 0:00:22
647500 -- [-765.908] (-768.475) (-767.927) (-766.719) * (-765.550) (-763.783) [-767.610] (-767.657) -- 0:00:22
648000 -- (-766.942) (-765.505) (-766.971) [-766.167] * (-767.648) [-766.248] (-765.841) (-766.583) -- 0:00:22
648500 -- (-771.340) [-765.652] (-767.155) (-766.606) * [-765.945] (-767.384) (-766.326) (-767.021) -- 0:00:22
649000 -- (-767.333) (-765.522) [-766.327] (-767.009) * (-766.832) (-767.988) (-769.504) [-765.957] -- 0:00:22
649500 -- [-767.742] (-769.125) (-770.035) (-766.781) * (-765.749) (-767.489) (-766.297) [-771.064] -- 0:00:22
650000 -- (-765.342) [-771.769] (-770.680) (-765.989) * (-767.230) (-764.588) (-769.792) [-767.294] -- 0:00:22
Average standard deviation of split frequencies: 0.005114
650500 -- (-769.533) (-771.301) (-766.820) [-765.820] * (-771.635) (-768.044) (-767.221) [-766.306] -- 0:00:22
651000 -- (-765.342) (-765.305) (-767.356) [-766.183] * (-772.829) (-767.039) (-764.577) [-766.408] -- 0:00:22
651500 -- (-766.907) [-766.532] (-766.006) (-766.314) * (-767.585) (-765.420) [-767.122] (-769.754) -- 0:00:22
652000 -- [-767.260] (-764.691) (-768.309) (-771.748) * (-765.300) [-768.767] (-766.576) (-766.904) -- 0:00:22
652500 -- (-768.957) (-766.133) [-765.929] (-766.261) * (-766.821) (-765.086) (-768.910) [-767.168] -- 0:00:22
653000 -- (-768.691) (-768.825) [-764.258] (-767.375) * (-773.660) [-763.962] (-766.598) (-766.279) -- 0:00:22
653500 -- (-769.806) (-767.332) [-766.269] (-765.924) * [-768.555] (-766.109) (-766.138) (-768.684) -- 0:00:22
654000 -- [-765.097] (-766.176) (-766.271) (-768.009) * (-767.285) [-766.842] (-765.862) (-768.569) -- 0:00:22
654500 -- (-766.332) [-766.131] (-763.242) (-768.451) * (-765.635) (-768.363) (-767.367) [-766.886] -- 0:00:22
655000 -- [-765.835] (-763.693) (-768.221) (-767.072) * (-766.847) [-764.718] (-770.010) (-768.864) -- 0:00:22
Average standard deviation of split frequencies: 0.004985
655500 -- (-769.738) [-764.768] (-765.964) (-768.358) * (-765.576) (-768.575) (-768.104) [-767.974] -- 0:00:22
656000 -- (-766.801) [-766.039] (-765.619) (-769.149) * (-766.078) [-769.126] (-766.431) (-767.407) -- 0:00:22
656500 -- [-763.853] (-766.095) (-768.005) (-768.726) * (-767.452) [-768.596] (-767.658) (-770.775) -- 0:00:22
657000 -- (-769.137) (-769.020) (-766.589) [-767.509] * (-767.449) (-767.563) [-765.020] (-765.471) -- 0:00:22
657500 -- (-770.649) [-764.917] (-766.664) (-768.821) * (-765.309) (-769.481) (-764.264) [-770.220] -- 0:00:22
658000 -- [-772.331] (-766.487) (-767.739) (-766.461) * (-768.273) (-769.188) [-764.384] (-767.881) -- 0:00:22
658500 -- (-766.319) (-765.610) (-766.671) [-768.625] * (-770.945) (-767.935) [-766.189] (-767.481) -- 0:00:22
659000 -- (-765.873) (-766.244) (-770.133) [-764.023] * (-770.407) (-768.516) [-767.343] (-767.265) -- 0:00:22
659500 -- [-766.475] (-764.922) (-772.005) (-766.115) * (-770.774) (-765.126) (-765.725) [-767.372] -- 0:00:22
660000 -- (-767.494) (-768.736) [-764.248] (-769.769) * (-765.986) [-765.200] (-766.718) (-766.607) -- 0:00:22
Average standard deviation of split frequencies: 0.005233
660500 -- (-768.199) (-765.235) (-765.152) [-765.833] * (-765.615) (-764.404) (-768.257) [-769.242] -- 0:00:22
661000 -- (-768.856) (-770.129) [-766.146] (-765.130) * (-767.403) (-765.170) [-766.214] (-768.130) -- 0:00:22
661500 -- (-772.258) (-766.720) (-765.539) [-768.353] * [-766.622] (-767.052) (-766.993) (-769.670) -- 0:00:22
662000 -- (-767.379) [-769.135] (-768.410) (-765.369) * [-765.835] (-768.102) (-767.306) (-771.118) -- 0:00:21
662500 -- (-767.518) (-767.532) [-763.617] (-767.029) * (-766.159) [-765.002] (-766.581) (-770.214) -- 0:00:21
663000 -- (-766.427) (-768.690) [-764.900] (-770.427) * (-768.122) [-768.726] (-767.752) (-767.615) -- 0:00:21
663500 -- (-768.983) (-767.040) [-766.595] (-766.883) * (-769.635) [-767.518] (-766.187) (-769.282) -- 0:00:21
664000 -- (-766.108) [-767.503] (-764.882) (-768.101) * (-767.626) [-766.721] (-770.331) (-768.664) -- 0:00:21
664500 -- (-766.060) (-765.108) (-766.130) [-765.068] * (-766.482) (-767.060) (-767.590) [-765.498] -- 0:00:21
665000 -- (-767.608) (-765.733) (-766.347) [-764.913] * [-763.237] (-765.008) (-768.442) (-770.166) -- 0:00:21
Average standard deviation of split frequencies: 0.005176
665500 -- (-768.803) (-765.981) (-766.404) [-765.709] * (-766.142) (-765.170) (-767.312) [-765.745] -- 0:00:21
666000 -- (-767.053) (-766.986) (-766.195) [-766.940] * (-766.994) (-768.859) [-763.319] (-766.469) -- 0:00:21
666500 -- [-766.362] (-765.579) (-767.148) (-768.085) * (-768.985) (-768.008) [-764.417] (-766.701) -- 0:00:21
667000 -- [-766.068] (-766.141) (-765.971) (-767.167) * (-766.856) (-766.445) (-765.808) [-765.824] -- 0:00:21
667500 -- (-769.775) [-769.627] (-769.530) (-767.079) * (-768.671) (-767.084) (-768.217) [-764.847] -- 0:00:21
668000 -- [-768.427] (-765.561) (-763.789) (-767.042) * (-765.841) (-765.744) (-766.863) [-765.437] -- 0:00:21
668500 -- (-768.371) (-766.965) (-766.323) [-767.341] * (-769.312) (-766.392) [-768.687] (-767.150) -- 0:00:21
669000 -- (-768.031) (-768.240) (-763.957) [-769.536] * (-768.915) (-767.659) (-764.822) [-765.777] -- 0:00:21
669500 -- (-766.574) (-764.787) (-766.272) [-767.497] * (-772.132) (-766.437) [-763.974] (-770.389) -- 0:00:21
670000 -- [-767.709] (-766.624) (-767.133) (-768.083) * (-773.451) [-765.140] (-767.046) (-767.274) -- 0:00:21
Average standard deviation of split frequencies: 0.005403
670500 -- (-770.914) (-768.343) [-768.754] (-766.703) * (-763.851) [-771.634] (-766.120) (-768.445) -- 0:00:21
671000 -- (-768.924) [-767.621] (-766.976) (-766.778) * (-767.302) [-766.402] (-765.300) (-765.632) -- 0:00:21
671500 -- (-765.297) (-769.301) (-767.422) [-768.929] * (-775.928) (-766.338) [-767.302] (-765.701) -- 0:00:21
672000 -- (-766.928) (-766.993) (-768.604) [-765.102] * [-767.483] (-764.189) (-767.774) (-764.939) -- 0:00:21
672500 -- (-767.413) (-764.574) [-766.604] (-767.255) * (-764.454) [-765.158] (-767.393) (-765.283) -- 0:00:21
673000 -- (-767.125) [-768.840] (-767.790) (-770.640) * (-763.462) [-767.729] (-771.537) (-767.542) -- 0:00:21
673500 -- [-767.166] (-768.304) (-765.610) (-769.884) * [-764.730] (-771.137) (-765.879) (-765.172) -- 0:00:21
674000 -- (-769.462) [-767.384] (-769.331) (-768.888) * (-767.194) [-768.340] (-766.594) (-766.441) -- 0:00:21
674500 -- [-765.547] (-766.611) (-765.622) (-766.402) * (-765.552) [-768.215] (-769.154) (-764.917) -- 0:00:21
675000 -- [-765.884] (-765.333) (-767.740) (-772.362) * [-766.753] (-767.576) (-768.684) (-769.760) -- 0:00:21
Average standard deviation of split frequencies: 0.005927
675500 -- (-765.788) (-772.296) (-767.888) [-768.631] * [-766.883] (-766.457) (-768.013) (-765.472) -- 0:00:21
676000 -- (-766.424) (-770.123) [-768.794] (-767.588) * (-766.435) (-765.171) (-765.927) [-767.163] -- 0:00:21
676500 -- (-764.782) [-766.517] (-767.252) (-765.825) * (-763.657) (-767.251) [-766.517] (-765.682) -- 0:00:21
677000 -- (-765.418) (-767.012) [-765.157] (-767.316) * (-765.533) (-768.313) (-768.493) [-764.489] -- 0:00:20
677500 -- (-767.464) (-765.688) (-766.972) [-765.775] * [-765.296] (-765.056) (-764.901) (-763.859) -- 0:00:20
678000 -- (-767.677) (-769.790) (-769.723) [-769.871] * (-769.574) (-767.426) (-768.090) [-766.559] -- 0:00:20
678500 -- [-766.560] (-770.809) (-764.298) (-767.045) * (-767.298) [-767.829] (-768.253) (-767.561) -- 0:00:20
679000 -- (-769.220) [-766.068] (-767.589) (-766.303) * [-767.633] (-765.745) (-769.252) (-767.223) -- 0:00:20
679500 -- [-766.710] (-766.900) (-770.647) (-767.228) * (-768.830) (-766.709) (-768.520) [-765.681] -- 0:00:20
680000 -- (-767.263) [-766.064] (-771.288) (-766.110) * (-768.477) (-766.431) [-765.731] (-768.776) -- 0:00:20
Average standard deviation of split frequencies: 0.006363
680500 -- (-766.217) (-769.644) [-767.531] (-765.738) * (-766.707) (-767.437) [-767.186] (-772.517) -- 0:00:20
681000 -- (-770.156) (-765.414) [-768.065] (-764.281) * (-765.012) (-765.692) [-766.995] (-770.569) -- 0:00:20
681500 -- (-768.998) (-771.339) [-769.806] (-766.408) * (-767.585) (-766.694) [-765.805] (-767.957) -- 0:00:20
682000 -- (-767.226) (-765.705) (-770.601) [-765.103] * (-767.779) (-767.231) [-767.815] (-765.380) -- 0:00:20
682500 -- (-768.990) (-764.788) [-768.255] (-767.508) * (-766.921) [-766.541] (-771.688) (-765.527) -- 0:00:20
683000 -- (-767.969) (-768.099) [-766.531] (-764.971) * (-766.540) (-765.367) (-767.087) [-765.731] -- 0:00:20
683500 -- [-766.959] (-766.168) (-765.963) (-765.390) * (-768.118) [-763.742] (-765.954) (-766.939) -- 0:00:20
684000 -- (-766.094) [-765.530] (-766.572) (-765.765) * [-765.933] (-765.329) (-767.832) (-765.400) -- 0:00:20
684500 -- (-767.412) [-769.364] (-772.041) (-765.934) * [-768.737] (-767.081) (-767.920) (-768.427) -- 0:00:20
685000 -- (-765.887) (-765.980) [-765.785] (-766.002) * (-766.296) (-769.327) [-765.416] (-766.154) -- 0:00:20
Average standard deviation of split frequencies: 0.006700
685500 -- (-767.835) (-765.582) (-767.644) [-765.022] * (-767.336) [-766.003] (-771.705) (-766.535) -- 0:00:20
686000 -- [-768.942] (-766.190) (-766.050) (-768.446) * (-770.213) [-767.144] (-770.632) (-767.384) -- 0:00:20
686500 -- (-768.720) (-766.019) [-766.601] (-768.746) * (-768.215) (-773.842) [-766.452] (-767.678) -- 0:00:20
687000 -- (-769.424) [-766.153] (-765.917) (-771.885) * (-766.275) [-766.297] (-770.545) (-765.620) -- 0:00:20
687500 -- (-769.712) (-766.634) [-767.220] (-771.847) * (-767.338) (-767.717) (-766.564) [-764.790] -- 0:00:20
688000 -- [-769.378] (-768.079) (-769.023) (-769.067) * [-767.229] (-767.306) (-767.611) (-767.749) -- 0:00:20
688500 -- (-768.749) [-765.751] (-765.466) (-764.823) * (-766.035) (-767.519) [-766.416] (-768.587) -- 0:00:20
689000 -- (-768.913) (-766.794) (-768.962) [-765.113] * (-767.048) (-766.906) [-765.074] (-767.916) -- 0:00:20
689500 -- (-768.148) [-766.536] (-769.378) (-768.937) * (-770.345) [-766.991] (-768.887) (-766.495) -- 0:00:20
690000 -- (-775.498) (-768.176) (-770.978) [-767.220] * (-769.584) (-767.171) [-766.562] (-767.010) -- 0:00:20
Average standard deviation of split frequencies: 0.006745
690500 -- (-765.793) (-765.604) (-768.930) [-767.314] * (-767.112) [-768.604] (-766.292) (-764.695) -- 0:00:20
691000 -- [-766.822] (-767.936) (-765.122) (-766.973) * [-767.252] (-769.406) (-767.056) (-766.327) -- 0:00:20
691500 -- (-767.565) (-766.734) (-769.071) [-767.011] * (-771.266) [-767.690] (-766.445) (-766.137) -- 0:00:20
692000 -- (-766.878) (-765.896) (-768.511) [-767.049] * (-773.173) (-773.092) [-767.537] (-767.103) -- 0:00:20
692500 -- (-772.555) (-765.145) (-768.734) [-767.284] * (-771.375) (-770.421) [-766.198] (-767.381) -- 0:00:19
693000 -- (-766.054) (-768.711) (-766.075) [-766.194] * (-771.015) (-768.301) [-766.971] (-767.135) -- 0:00:19
693500 -- (-767.809) [-768.492] (-770.812) (-765.883) * [-766.700] (-768.294) (-768.240) (-764.409) -- 0:00:19
694000 -- (-768.160) (-766.609) [-768.206] (-768.022) * (-767.017) [-769.599] (-768.533) (-766.464) -- 0:00:19
694500 -- (-763.752) (-769.887) [-766.010] (-766.092) * (-769.172) [-769.993] (-767.061) (-768.112) -- 0:00:19
695000 -- (-766.060) [-766.622] (-770.617) (-766.179) * (-769.113) (-767.539) (-768.243) [-768.368] -- 0:00:19
Average standard deviation of split frequencies: 0.006972
695500 -- [-766.152] (-767.646) (-772.832) (-766.645) * (-766.828) (-767.237) [-766.971] (-768.168) -- 0:00:19
696000 -- [-763.804] (-772.312) (-766.559) (-767.494) * (-770.175) (-767.085) [-768.024] (-765.229) -- 0:00:19
696500 -- [-768.426] (-769.234) (-764.013) (-765.396) * (-769.792) (-766.313) (-767.887) [-766.219] -- 0:00:19
697000 -- (-768.036) [-764.090] (-769.113) (-768.720) * (-771.625) (-765.664) (-766.024) [-767.151] -- 0:00:19
697500 -- (-773.752) (-764.118) (-766.231) [-766.390] * (-769.882) (-764.698) [-766.923] (-768.445) -- 0:00:19
698000 -- [-766.193] (-768.173) (-773.231) (-769.594) * (-767.177) (-764.642) (-767.969) [-766.141] -- 0:00:19
698500 -- (-765.190) (-768.913) (-769.199) [-769.324] * (-766.298) (-767.533) (-767.393) [-769.202] -- 0:00:19
699000 -- (-769.682) [-768.582] (-767.103) (-766.379) * (-769.013) (-767.032) [-767.317] (-767.881) -- 0:00:19
699500 -- (-767.444) (-766.219) (-768.021) [-769.061] * (-767.691) (-767.639) (-767.379) [-765.723] -- 0:00:19
700000 -- (-769.037) (-765.048) (-769.091) [-768.612] * (-768.574) [-765.758] (-766.688) (-766.621) -- 0:00:19
Average standard deviation of split frequencies: 0.006644
700500 -- (-765.533) (-765.045) (-766.191) [-765.204] * (-770.541) (-766.527) (-767.208) [-765.707] -- 0:00:19
701000 -- (-767.503) (-768.057) [-768.980] (-768.154) * (-772.351) [-764.755] (-766.049) (-769.160) -- 0:00:19
701500 -- [-769.397] (-767.213) (-766.930) (-767.004) * (-764.396) (-768.497) [-768.978] (-766.463) -- 0:00:19
702000 -- (-765.420) (-767.820) [-764.578] (-766.946) * (-765.515) [-764.336] (-766.427) (-768.434) -- 0:00:19
702500 -- (-766.723) (-767.165) [-765.239] (-766.652) * [-766.489] (-767.211) (-766.827) (-767.455) -- 0:00:19
703000 -- [-766.151] (-766.235) (-768.025) (-769.271) * (-767.802) (-767.795) (-764.982) [-765.892] -- 0:00:19
703500 -- (-764.992) [-765.047] (-767.652) (-767.814) * (-769.035) (-766.828) (-768.774) [-764.431] -- 0:00:19
704000 -- (-765.179) [-767.304] (-766.565) (-765.867) * (-765.059) (-768.883) (-777.077) [-769.660] -- 0:00:19
704500 -- (-765.972) (-769.451) (-767.111) [-767.799] * (-768.438) [-766.301] (-767.069) (-765.559) -- 0:00:19
705000 -- (-767.197) (-767.383) [-769.965] (-766.367) * [-766.780] (-768.002) (-766.158) (-766.307) -- 0:00:19
Average standard deviation of split frequencies: 0.006343
705500 -- (-766.086) (-770.649) [-767.885] (-765.442) * (-764.854) [-766.553] (-766.601) (-766.855) -- 0:00:19
706000 -- (-766.735) (-766.801) [-766.255] (-766.185) * [-766.870] (-772.356) (-768.399) (-767.972) -- 0:00:19
706500 -- (-766.587) (-766.266) [-766.091] (-765.988) * (-765.374) (-767.080) (-769.514) [-769.085] -- 0:00:19
707000 -- (-766.761) (-768.206) [-764.612] (-766.034) * (-771.391) (-767.253) [-767.312] (-767.599) -- 0:00:19
707500 -- (-767.256) (-771.213) (-766.006) [-765.041] * (-767.837) (-766.460) (-768.878) [-767.572] -- 0:00:19
708000 -- [-767.156] (-764.722) (-766.564) (-765.887) * (-771.155) (-766.372) [-766.201] (-770.415) -- 0:00:18
708500 -- (-769.111) [-763.754] (-768.325) (-771.342) * (-765.176) [-765.074] (-766.790) (-764.941) -- 0:00:18
709000 -- (-768.715) (-766.273) (-766.790) [-772.803] * (-770.989) (-765.594) (-766.217) [-766.397] -- 0:00:18
709500 -- (-769.028) (-766.641) [-769.333] (-769.837) * [-768.815] (-771.868) (-766.786) (-766.897) -- 0:00:18
710000 -- [-769.691] (-768.857) (-767.249) (-766.503) * [-766.300] (-768.748) (-768.942) (-765.590) -- 0:00:18
Average standard deviation of split frequencies: 0.006343
710500 -- (-766.334) [-765.361] (-768.323) (-767.550) * [-765.748] (-769.479) (-766.131) (-767.352) -- 0:00:18
711000 -- (-769.396) (-768.236) (-767.470) [-764.515] * [-766.050] (-766.914) (-767.274) (-768.184) -- 0:00:18
711500 -- (-768.114) (-767.305) (-768.444) [-765.711] * (-771.177) (-765.955) [-767.956] (-768.188) -- 0:00:18
712000 -- [-766.343] (-764.735) (-767.597) (-768.567) * [-767.271] (-768.988) (-768.759) (-768.959) -- 0:00:18
712500 -- (-766.878) (-764.165) [-765.445] (-767.724) * (-767.684) (-769.610) [-769.165] (-768.426) -- 0:00:18
713000 -- (-767.510) [-765.055] (-768.640) (-769.721) * (-769.088) (-768.700) [-766.562] (-766.291) -- 0:00:18
713500 -- (-769.260) [-768.493] (-768.144) (-767.606) * (-765.472) (-768.741) (-767.332) [-766.821] -- 0:00:18
714000 -- (-772.075) (-768.131) (-767.260) [-768.715] * (-764.579) [-767.840] (-765.908) (-769.675) -- 0:00:18
714500 -- (-768.291) [-766.175] (-769.033) (-767.523) * (-769.106) (-768.463) (-766.606) [-766.611] -- 0:00:18
715000 -- (-766.281) (-771.471) (-764.757) [-766.491] * (-769.972) [-767.653] (-767.427) (-764.442) -- 0:00:18
Average standard deviation of split frequencies: 0.006277
715500 -- (-768.361) (-766.459) [-765.465] (-765.709) * [-767.767] (-766.813) (-770.197) (-769.587) -- 0:00:18
716000 -- (-769.202) (-767.602) (-766.275) [-766.220] * (-767.197) (-769.711) (-770.123) [-767.146] -- 0:00:18
716500 -- (-767.294) (-768.473) [-765.314] (-768.294) * (-769.309) (-774.791) [-767.600] (-765.836) -- 0:00:18
717000 -- (-767.971) [-765.690] (-763.960) (-765.406) * (-768.233) (-770.822) (-766.820) [-767.625] -- 0:00:18
717500 -- (-767.203) (-766.738) [-766.953] (-764.381) * (-763.612) (-766.694) (-768.233) [-766.895] -- 0:00:18
718000 -- (-768.518) (-765.526) [-767.361] (-764.741) * (-765.231) [-765.542] (-768.566) (-767.275) -- 0:00:18
718500 -- [-765.918] (-766.001) (-764.467) (-766.365) * (-767.739) [-766.909] (-768.184) (-767.201) -- 0:00:18
719000 -- [-766.533] (-766.945) (-765.374) (-768.110) * [-767.435] (-768.578) (-766.450) (-766.287) -- 0:00:18
719500 -- (-766.942) [-767.883] (-775.723) (-766.708) * (-768.112) (-767.302) [-766.809] (-768.960) -- 0:00:18
720000 -- (-766.960) (-769.705) [-771.839] (-766.361) * (-764.875) (-767.548) [-766.538] (-767.774) -- 0:00:18
Average standard deviation of split frequencies: 0.006618
720500 -- (-771.991) (-766.903) (-767.728) [-766.172] * (-765.703) (-767.784) (-768.695) [-766.426] -- 0:00:18
721000 -- (-770.297) (-768.413) [-763.976] (-768.458) * (-766.909) [-768.348] (-766.855) (-770.207) -- 0:00:18
721500 -- (-764.917) [-763.446] (-767.267) (-766.755) * (-766.995) (-767.249) (-766.711) [-771.328] -- 0:00:18
722000 -- (-769.265) [-767.638] (-767.497) (-765.833) * (-765.586) [-764.104] (-766.573) (-767.688) -- 0:00:18
722500 -- [-766.588] (-766.987) (-764.828) (-767.715) * (-765.378) (-764.482) (-769.703) [-767.729] -- 0:00:18
723000 -- (-767.599) [-767.496] (-766.120) (-765.759) * (-767.667) [-766.751] (-768.319) (-769.673) -- 0:00:18
723500 -- (-766.160) [-767.029] (-765.490) (-769.302) * [-764.296] (-764.609) (-768.297) (-768.890) -- 0:00:17
724000 -- (-766.244) [-765.989] (-766.893) (-770.501) * (-768.601) (-767.808) (-768.470) [-768.403] -- 0:00:17
724500 -- [-766.230] (-765.447) (-766.478) (-769.333) * (-767.289) (-765.896) [-765.753] (-764.209) -- 0:00:17
725000 -- (-767.055) [-764.293] (-764.184) (-768.912) * (-766.347) [-771.800] (-767.542) (-766.441) -- 0:00:17
Average standard deviation of split frequencies: 0.005997
725500 -- (-769.834) (-766.152) [-766.474] (-767.310) * (-775.728) (-766.668) [-766.707] (-764.071) -- 0:00:17
726000 -- (-767.814) [-765.398] (-772.443) (-769.282) * (-767.191) [-766.561] (-769.597) (-770.090) -- 0:00:17
726500 -- (-767.384) [-763.632] (-766.731) (-767.880) * [-764.519] (-767.736) (-771.029) (-767.908) -- 0:00:17
727000 -- (-766.038) (-766.874) [-770.056] (-766.399) * [-765.333] (-770.725) (-771.679) (-768.121) -- 0:00:17
727500 -- (-768.291) (-765.803) (-769.542) [-765.573] * (-767.906) (-766.068) (-766.382) [-764.903] -- 0:00:17
728000 -- (-771.722) (-766.742) (-767.359) [-765.369] * [-766.152] (-765.414) (-767.831) (-769.885) -- 0:00:17
728500 -- (-766.426) (-769.242) [-766.895] (-764.739) * (-766.712) (-766.189) [-766.683] (-766.694) -- 0:00:17
729000 -- (-767.492) (-766.222) (-767.521) [-767.043] * [-764.932] (-766.113) (-764.512) (-769.548) -- 0:00:17
729500 -- (-767.612) (-766.159) [-768.057] (-765.620) * (-765.620) [-768.093] (-766.779) (-768.964) -- 0:00:17
730000 -- (-766.938) (-764.714) (-766.608) [-765.737] * (-766.773) [-765.374] (-765.196) (-768.263) -- 0:00:17
Average standard deviation of split frequencies: 0.005605
730500 -- [-766.943] (-769.437) (-766.948) (-767.530) * (-768.478) [-765.812] (-770.988) (-765.368) -- 0:00:17
731000 -- (-765.435) (-767.827) [-771.114] (-771.815) * (-765.129) (-764.309) (-763.465) [-767.177] -- 0:00:17
731500 -- (-767.202) [-766.853] (-768.812) (-766.987) * (-768.029) (-769.069) [-766.132] (-768.540) -- 0:00:17
732000 -- (-766.188) [-768.176] (-765.911) (-772.001) * (-768.592) [-768.521] (-767.608) (-768.649) -- 0:00:17
732500 -- (-767.140) [-767.730] (-765.953) (-772.323) * (-767.892) (-767.768) (-766.936) [-771.650] -- 0:00:17
733000 -- (-769.134) (-766.449) (-768.704) [-767.056] * [-765.086] (-769.035) (-767.485) (-767.341) -- 0:00:17
733500 -- (-769.102) [-766.775] (-768.967) (-767.027) * (-768.373) (-764.976) [-767.249] (-764.369) -- 0:00:17
734000 -- (-765.664) [-768.122] (-767.029) (-767.378) * (-766.701) (-764.437) (-765.873) [-767.833] -- 0:00:17
734500 -- (-767.525) (-767.239) [-768.019] (-768.008) * (-764.921) [-764.229] (-765.387) (-766.221) -- 0:00:17
735000 -- (-766.889) (-770.225) [-767.302] (-766.667) * (-767.960) (-770.675) (-766.120) [-765.943] -- 0:00:17
Average standard deviation of split frequencies: 0.005651
735500 -- (-767.881) (-765.237) (-768.625) [-766.503] * (-767.334) [-767.865] (-767.732) (-765.662) -- 0:00:17
736000 -- [-765.455] (-766.973) (-770.313) (-767.068) * (-768.601) (-767.928) (-768.472) [-767.181] -- 0:00:17
736500 -- [-768.480] (-769.323) (-767.500) (-772.543) * [-766.722] (-767.695) (-768.242) (-767.202) -- 0:00:17
737000 -- (-764.785) [-764.015] (-766.503) (-767.787) * (-766.937) (-770.242) (-767.539) [-765.606] -- 0:00:17
737500 -- (-765.032) [-764.798] (-767.565) (-769.180) * (-768.096) (-769.679) (-765.652) [-766.014] -- 0:00:17
738000 -- (-768.464) (-766.418) (-767.010) [-767.026] * (-771.382) [-768.128] (-765.917) (-767.622) -- 0:00:17
738500 -- (-767.521) (-769.033) [-768.575] (-766.661) * [-766.651] (-766.942) (-764.683) (-765.893) -- 0:00:16
739000 -- (-767.482) (-769.355) [-769.086] (-767.495) * [-765.552] (-768.453) (-763.893) (-766.047) -- 0:00:16
739500 -- (-770.015) [-767.243] (-772.532) (-766.546) * [-768.807] (-767.349) (-764.295) (-765.836) -- 0:00:16
740000 -- (-768.214) [-767.757] (-769.618) (-768.102) * (-765.364) [-767.640] (-770.445) (-767.350) -- 0:00:16
Average standard deviation of split frequencies: 0.005316
740500 -- [-768.234] (-766.975) (-770.608) (-767.991) * [-764.254] (-767.485) (-769.530) (-766.245) -- 0:00:16
741000 -- (-767.542) (-767.871) (-767.387) [-768.295] * [-765.752] (-766.829) (-766.947) (-766.865) -- 0:00:16
741500 -- (-771.049) [-766.775] (-768.114) (-765.649) * (-766.985) [-767.240] (-764.706) (-766.252) -- 0:00:16
742000 -- (-766.887) [-768.487] (-769.757) (-767.272) * (-765.786) (-766.604) [-767.701] (-766.624) -- 0:00:16
742500 -- [-768.884] (-770.069) (-768.841) (-767.226) * (-768.231) (-764.061) [-764.712] (-765.662) -- 0:00:16
743000 -- (-768.461) (-765.681) (-769.177) [-764.581] * [-769.623] (-765.047) (-767.323) (-768.828) -- 0:00:16
743500 -- (-768.820) [-765.912] (-769.314) (-766.002) * [-768.655] (-769.687) (-764.415) (-766.357) -- 0:00:16
744000 -- (-765.528) (-770.588) (-767.406) [-767.360] * (-765.963) (-768.372) [-768.692] (-767.887) -- 0:00:16
744500 -- [-766.493] (-764.698) (-767.218) (-768.397) * [-766.611] (-765.771) (-767.570) (-766.319) -- 0:00:16
745000 -- [-766.583] (-767.173) (-764.767) (-770.102) * [-767.749] (-766.321) (-764.871) (-767.104) -- 0:00:16
Average standard deviation of split frequencies: 0.005464
745500 -- (-764.827) (-764.389) [-764.474] (-767.084) * [-767.316] (-767.186) (-765.739) (-769.737) -- 0:00:16
746000 -- (-765.335) (-770.545) (-767.609) [-764.937] * (-769.539) (-768.593) [-767.237] (-769.831) -- 0:00:16
746500 -- [-766.047] (-767.802) (-768.793) (-764.489) * [-766.537] (-767.165) (-765.459) (-766.747) -- 0:00:16
747000 -- (-765.231) [-765.644] (-766.758) (-766.100) * (-768.233) [-766.511] (-764.577) (-764.497) -- 0:00:16
747500 -- [-765.896] (-766.515) (-765.980) (-770.023) * (-766.623) [-767.681] (-765.904) (-766.234) -- 0:00:16
748000 -- (-766.173) (-768.009) (-765.411) [-767.499] * (-768.109) (-766.063) [-767.187] (-765.911) -- 0:00:16
748500 -- [-766.238] (-768.007) (-765.988) (-770.394) * (-766.431) (-767.429) (-767.261) [-765.888] -- 0:00:16
749000 -- (-767.982) [-765.536] (-766.674) (-768.286) * (-768.009) (-764.790) (-765.620) [-765.568] -- 0:00:16
749500 -- (-767.534) [-766.368] (-766.616) (-766.787) * (-765.849) (-768.557) (-767.400) [-768.414] -- 0:00:16
750000 -- (-766.095) (-767.840) [-767.903] (-771.043) * [-767.204] (-766.623) (-766.572) (-766.836) -- 0:00:16
Average standard deviation of split frequencies: 0.005245
750500 -- [-766.913] (-766.709) (-767.028) (-767.959) * (-765.137) [-767.258] (-766.912) (-766.182) -- 0:00:16
751000 -- (-765.973) (-768.181) (-768.019) [-768.520] * (-767.985) (-767.340) [-765.896] (-765.857) -- 0:00:16
751500 -- (-766.859) (-767.183) (-769.676) [-766.756] * (-768.109) (-766.231) [-766.522] (-764.633) -- 0:00:16
752000 -- (-765.278) (-768.925) [-767.500] (-766.991) * [-765.706] (-764.184) (-766.421) (-768.083) -- 0:00:16
752500 -- (-765.614) (-769.020) (-766.411) [-767.131] * (-766.691) (-764.757) (-766.064) [-766.032] -- 0:00:16
753000 -- (-767.287) [-766.618] (-768.471) (-770.652) * (-768.445) [-767.381] (-767.597) (-767.123) -- 0:00:16
753500 -- (-768.282) (-768.148) [-766.775] (-766.770) * (-768.926) (-768.785) [-766.788] (-768.512) -- 0:00:16
754000 -- [-765.718] (-766.741) (-766.778) (-765.989) * [-765.071] (-766.177) (-767.486) (-764.684) -- 0:00:15
754500 -- [-766.498] (-767.926) (-768.278) (-771.263) * (-770.059) (-768.309) [-763.830] (-764.947) -- 0:00:15
755000 -- (-765.514) (-767.770) [-765.517] (-768.253) * (-767.250) [-766.890] (-767.963) (-764.864) -- 0:00:15
Average standard deviation of split frequencies: 0.005245
755500 -- (-766.017) (-767.207) (-766.120) [-770.109] * (-766.194) [-767.132] (-766.164) (-766.875) -- 0:00:15
756000 -- (-765.400) [-764.482] (-768.483) (-768.538) * (-765.385) (-768.901) (-766.127) [-765.733] -- 0:00:15
756500 -- (-766.380) (-765.657) [-763.685] (-767.450) * [-765.794] (-768.036) (-766.175) (-764.483) -- 0:00:15
757000 -- (-768.997) (-767.270) (-766.558) [-765.648] * (-765.332) (-767.251) (-767.071) [-766.497] -- 0:00:15
757500 -- (-773.760) [-770.989] (-769.784) (-765.829) * (-764.692) (-767.886) [-766.477] (-764.064) -- 0:00:15
758000 -- (-764.973) (-766.171) [-764.585] (-766.133) * [-767.049] (-769.646) (-768.479) (-765.569) -- 0:00:15
758500 -- (-765.379) (-779.358) (-766.262) [-767.014] * (-766.937) [-766.078] (-765.267) (-766.787) -- 0:00:15
759000 -- [-765.284] (-772.901) (-765.741) (-765.880) * [-766.686] (-766.882) (-764.490) (-766.994) -- 0:00:15
759500 -- [-767.598] (-765.282) (-766.601) (-765.477) * [-768.442] (-766.198) (-764.325) (-768.639) -- 0:00:15
760000 -- (-767.311) [-763.705] (-771.640) (-764.540) * (-769.008) [-767.654] (-766.275) (-765.489) -- 0:00:15
Average standard deviation of split frequencies: 0.005213
760500 -- (-766.822) (-766.920) [-765.840] (-765.933) * (-766.462) (-770.433) [-766.728] (-768.162) -- 0:00:15
761000 -- [-766.880] (-769.184) (-767.215) (-769.247) * (-769.913) [-768.882] (-764.813) (-769.841) -- 0:00:15
761500 -- (-772.567) (-770.430) (-766.544) [-767.362] * (-767.444) (-765.371) (-769.633) [-767.644] -- 0:00:15
762000 -- [-766.277] (-767.339) (-768.457) (-766.937) * (-769.768) (-770.283) (-773.043) [-769.464] -- 0:00:15
762500 -- (-764.445) [-766.428] (-770.496) (-765.960) * [-765.746] (-765.767) (-769.075) (-770.558) -- 0:00:15
763000 -- (-765.227) [-764.634] (-768.107) (-764.456) * (-774.112) (-764.080) [-765.241] (-769.150) -- 0:00:15
763500 -- [-765.617] (-772.827) (-767.441) (-765.204) * (-768.776) (-769.414) [-765.082] (-770.770) -- 0:00:15
764000 -- (-767.930) (-766.640) (-765.216) [-769.161] * (-766.959) [-768.419] (-769.135) (-766.877) -- 0:00:15
764500 -- [-764.598] (-767.943) (-771.728) (-767.060) * (-767.674) [-766.208] (-764.670) (-765.693) -- 0:00:15
765000 -- [-765.143] (-766.640) (-771.434) (-766.409) * (-769.190) [-765.893] (-771.222) (-766.145) -- 0:00:15
Average standard deviation of split frequencies: 0.005249
765500 -- (-765.864) (-768.217) [-767.000] (-765.761) * (-768.145) [-768.793] (-768.660) (-768.841) -- 0:00:15
766000 -- (-765.771) [-766.177] (-766.517) (-766.909) * (-767.640) (-769.391) [-766.659] (-764.909) -- 0:00:15
766500 -- (-769.267) (-772.570) (-765.000) [-768.158] * (-765.482) [-768.694] (-766.987) (-766.681) -- 0:00:15
767000 -- (-763.899) [-768.602] (-766.857) (-767.026) * (-769.765) (-770.837) [-767.713] (-766.773) -- 0:00:15
767500 -- (-764.795) (-766.971) [-767.810] (-768.601) * (-766.976) (-768.467) (-763.070) [-764.848] -- 0:00:15
768000 -- [-765.859] (-764.734) (-767.027) (-766.357) * (-767.946) (-767.411) [-766.640] (-765.688) -- 0:00:15
768500 -- (-763.721) (-768.876) (-766.814) [-766.091] * (-767.523) [-767.686] (-765.091) (-766.204) -- 0:00:15
769000 -- (-765.799) [-765.974] (-765.639) (-766.085) * [-766.845] (-767.176) (-764.082) (-765.117) -- 0:00:15
769500 -- (-764.702) (-767.419) [-764.995] (-766.810) * (-768.222) [-764.669] (-768.842) (-765.131) -- 0:00:14
770000 -- (-764.075) (-767.719) (-767.476) [-768.136] * (-765.429) (-772.141) [-769.474] (-768.064) -- 0:00:14
Average standard deviation of split frequencies: 0.005469
770500 -- (-764.967) [-765.089] (-768.451) (-766.622) * (-767.404) (-766.147) [-766.062] (-766.464) -- 0:00:14
771000 -- (-768.423) (-765.865) (-766.540) [-766.627] * (-766.117) (-765.400) (-767.792) [-766.520] -- 0:00:14
771500 -- (-767.929) (-768.153) (-772.164) [-766.012] * (-768.505) (-766.391) [-768.561] (-767.869) -- 0:00:14
772000 -- (-769.258) (-769.765) (-768.775) [-767.099] * (-767.689) [-767.183] (-766.769) (-770.432) -- 0:00:14
772500 -- [-766.481] (-770.023) (-765.482) (-765.022) * [-765.965] (-767.281) (-767.014) (-768.839) -- 0:00:14
773000 -- (-767.885) (-768.185) (-770.160) [-767.588] * (-768.570) [-771.227] (-767.524) (-768.150) -- 0:00:14
773500 -- (-767.811) (-765.673) (-767.606) [-767.339] * (-769.353) (-769.308) [-770.347] (-771.990) -- 0:00:14
774000 -- [-764.437] (-765.321) (-766.317) (-767.256) * (-764.420) (-771.633) (-773.351) [-766.711] -- 0:00:14
774500 -- (-768.799) (-765.525) [-770.083] (-769.846) * (-766.110) (-769.367) [-773.195] (-765.479) -- 0:00:14
775000 -- [-767.486] (-766.967) (-767.570) (-765.489) * (-767.603) (-766.493) [-766.943] (-764.819) -- 0:00:14
Average standard deviation of split frequencies: 0.005646
775500 -- [-766.483] (-767.994) (-766.287) (-770.852) * [-765.751] (-768.137) (-766.207) (-764.931) -- 0:00:14
776000 -- [-765.672] (-767.679) (-767.711) (-765.101) * [-765.025] (-769.461) (-767.296) (-766.114) -- 0:00:14
776500 -- [-769.344] (-765.940) (-769.121) (-766.471) * (-766.795) (-767.746) (-765.872) [-765.746] -- 0:00:14
777000 -- (-766.003) (-766.393) [-769.409] (-766.975) * (-767.500) [-764.638] (-767.278) (-767.908) -- 0:00:14
777500 -- (-765.263) (-768.080) (-768.192) [-766.533] * (-765.870) (-766.492) [-765.408] (-766.417) -- 0:00:14
778000 -- (-767.126) (-768.143) [-768.310] (-764.305) * (-767.667) (-767.886) [-765.599] (-766.428) -- 0:00:14
778500 -- (-768.569) (-767.280) [-764.966] (-764.314) * (-768.088) [-770.577] (-767.665) (-765.940) -- 0:00:14
779000 -- (-768.847) [-764.001] (-766.765) (-767.561) * [-766.620] (-769.007) (-767.050) (-764.333) -- 0:00:14
779500 -- [-766.973] (-766.353) (-771.273) (-764.894) * (-767.174) [-769.792] (-769.889) (-767.973) -- 0:00:14
780000 -- (-765.440) (-766.723) (-766.246) [-766.029] * (-766.692) (-767.320) (-767.943) [-765.333] -- 0:00:14
Average standard deviation of split frequencies: 0.005719
780500 -- (-767.722) (-764.456) (-768.063) [-765.938] * (-766.682) (-767.241) (-767.377) [-767.086] -- 0:00:14
781000 -- (-767.056) (-765.770) (-766.702) [-765.879] * (-766.984) (-768.318) (-767.268) [-765.747] -- 0:00:14
781500 -- [-765.801] (-767.091) (-767.753) (-766.921) * (-767.461) [-767.049] (-765.075) (-768.338) -- 0:00:14
782000 -- (-765.138) (-764.587) [-766.123] (-766.050) * (-766.020) [-765.563] (-767.074) (-769.202) -- 0:00:14
782500 -- [-765.473] (-767.038) (-766.319) (-769.470) * [-766.124] (-767.514) (-766.517) (-767.358) -- 0:00:14
783000 -- (-765.374) (-764.374) (-764.863) [-766.329] * (-772.970) (-771.707) [-766.692] (-765.206) -- 0:00:14
783500 -- (-766.204) (-764.528) [-767.221] (-769.155) * (-766.837) (-769.448) [-766.494] (-768.094) -- 0:00:14
784000 -- (-768.393) [-766.108] (-766.350) (-770.954) * (-766.263) (-766.113) [-764.772] (-765.762) -- 0:00:14
784500 -- (-772.786) (-768.063) (-768.646) [-767.031] * (-768.744) (-770.145) (-770.597) [-765.510] -- 0:00:14
785000 -- [-767.719] (-764.752) (-768.652) (-766.247) * (-768.882) (-767.884) [-767.944] (-767.457) -- 0:00:13
Average standard deviation of split frequencies: 0.005680
785500 -- [-764.186] (-770.070) (-766.736) (-767.394) * (-765.203) [-767.457] (-766.605) (-765.136) -- 0:00:13
786000 -- (-765.047) (-766.455) (-767.704) [-766.556] * (-774.392) (-769.795) (-767.588) [-764.889] -- 0:00:13
786500 -- (-771.289) (-766.267) [-764.984] (-766.893) * [-772.244] (-766.425) (-771.519) (-769.333) -- 0:00:13
787000 -- (-767.279) (-768.412) (-766.175) [-767.222] * (-770.802) (-768.184) (-766.304) [-770.431] -- 0:00:13
787500 -- (-765.253) (-769.380) [-765.755] (-767.372) * (-767.551) (-766.533) [-765.859] (-765.783) -- 0:00:13
788000 -- (-766.345) [-767.597] (-768.441) (-767.678) * (-767.516) (-769.341) [-771.539] (-766.610) -- 0:00:13
788500 -- (-765.837) (-769.025) (-765.505) [-767.344] * (-767.735) (-769.727) (-766.859) [-768.291] -- 0:00:13
789000 -- [-764.810] (-767.164) (-766.198) (-771.497) * (-767.222) (-766.511) (-771.416) [-768.729] -- 0:00:13
789500 -- (-764.545) (-764.966) (-767.686) [-769.648] * (-764.067) [-767.261] (-769.166) (-767.233) -- 0:00:13
790000 -- [-764.990] (-765.230) (-765.952) (-767.152) * (-765.359) (-771.604) (-768.992) [-764.767] -- 0:00:13
Average standard deviation of split frequencies: 0.005927
790500 -- (-765.238) (-766.781) [-764.485] (-764.372) * (-766.595) [-765.840] (-768.311) (-766.347) -- 0:00:13
791000 -- (-767.407) [-767.796] (-765.918) (-763.457) * [-765.475] (-766.110) (-765.622) (-767.121) -- 0:00:13
791500 -- [-767.188] (-769.551) (-767.010) (-766.891) * [-769.274] (-766.801) (-771.521) (-767.757) -- 0:00:13
792000 -- (-767.304) (-765.778) (-766.522) [-763.376] * (-769.115) [-768.529] (-767.345) (-765.858) -- 0:00:13
792500 -- (-765.515) [-766.069] (-766.631) (-765.746) * [-764.627] (-769.535) (-766.826) (-768.475) -- 0:00:13
793000 -- (-766.615) [-763.965] (-765.683) (-770.891) * (-767.377) [-771.294] (-767.942) (-767.040) -- 0:00:13
793500 -- (-767.631) [-764.166] (-766.193) (-768.763) * (-766.917) (-766.986) (-766.722) [-764.899] -- 0:00:13
794000 -- (-767.918) (-765.537) (-766.571) [-766.707] * [-770.840] (-768.295) (-770.328) (-766.960) -- 0:00:13
794500 -- (-769.141) (-765.959) [-766.759] (-767.421) * (-769.863) (-770.205) (-767.430) [-767.748] -- 0:00:13
795000 -- (-771.598) (-768.394) (-765.139) [-766.734] * [-768.153] (-770.096) (-765.646) (-765.018) -- 0:00:13
Average standard deviation of split frequencies: 0.005996
795500 -- (-767.770) (-767.043) [-766.043] (-766.840) * (-768.667) [-767.580] (-766.551) (-767.238) -- 0:00:13
796000 -- (-767.752) (-766.922) [-767.989] (-765.537) * [-767.363] (-767.751) (-766.681) (-767.009) -- 0:00:13
796500 -- (-766.482) (-766.143) (-767.503) [-764.857] * (-768.390) (-769.307) [-769.450] (-773.386) -- 0:00:13
797000 -- (-769.907) (-766.269) (-768.470) [-765.860] * [-767.004] (-767.223) (-767.448) (-763.779) -- 0:00:13
797500 -- (-769.452) (-766.022) (-768.736) [-765.196] * (-772.696) (-769.933) (-764.447) [-765.562] -- 0:00:13
798000 -- (-766.889) (-769.214) [-766.748] (-767.098) * [-766.301] (-768.132) (-767.851) (-766.723) -- 0:00:13
798500 -- [-764.443] (-766.722) (-767.254) (-764.090) * (-765.435) (-767.846) [-767.976] (-765.222) -- 0:00:13
799000 -- (-764.491) (-765.313) [-765.377] (-765.121) * (-765.140) (-767.430) [-765.420] (-765.681) -- 0:00:13
799500 -- (-765.158) [-767.794] (-768.813) (-766.415) * (-764.154) (-768.788) (-771.721) [-767.327] -- 0:00:13
800000 -- [-765.814] (-767.939) (-767.870) (-765.833) * (-765.653) [-765.166] (-766.951) (-766.967) -- 0:00:12
Average standard deviation of split frequencies: 0.006366
800500 -- [-764.457] (-767.472) (-763.992) (-769.091) * (-767.067) [-765.306] (-765.526) (-768.048) -- 0:00:12
801000 -- [-768.084] (-769.690) (-765.587) (-766.877) * [-771.176] (-768.375) (-765.700) (-766.404) -- 0:00:12
801500 -- (-766.076) (-769.440) (-764.159) [-766.809] * [-765.289] (-766.386) (-765.561) (-765.451) -- 0:00:12
802000 -- [-767.366] (-767.834) (-766.236) (-769.456) * [-765.144] (-767.958) (-769.483) (-766.631) -- 0:00:12
802500 -- (-767.546) (-768.499) (-767.640) [-770.778] * (-763.978) (-767.504) (-769.873) [-766.167] -- 0:00:12
803000 -- (-766.374) (-769.511) [-765.420] (-767.916) * (-766.525) [-765.689] (-766.887) (-768.033) -- 0:00:12
803500 -- (-767.076) [-766.314] (-765.368) (-766.235) * (-766.236) (-766.539) [-766.690] (-767.133) -- 0:00:12
804000 -- (-766.311) (-765.475) (-769.141) [-767.708] * (-769.619) [-764.142] (-767.855) (-766.165) -- 0:00:12
804500 -- (-767.030) [-764.904] (-769.815) (-768.898) * (-766.171) [-764.538] (-766.553) (-769.748) -- 0:00:12
805000 -- (-767.351) [-765.185] (-770.978) (-765.451) * [-765.209] (-767.267) (-768.109) (-767.460) -- 0:00:12
Average standard deviation of split frequencies: 0.006434
805500 -- [-766.219] (-766.292) (-769.271) (-766.843) * (-771.205) (-768.051) (-766.103) [-766.382] -- 0:00:12
806000 -- (-767.611) (-767.822) (-766.417) [-766.773] * (-767.045) (-768.679) (-766.119) [-765.407] -- 0:00:12
806500 -- (-767.071) (-764.391) (-766.466) [-766.385] * (-766.305) (-765.114) (-769.815) [-768.469] -- 0:00:12
807000 -- (-764.906) (-766.181) (-766.464) [-766.721] * (-763.933) (-765.277) [-767.049] (-766.611) -- 0:00:12
807500 -- [-764.887] (-765.846) (-768.583) (-765.641) * (-765.785) (-770.116) [-767.951] (-770.574) -- 0:00:12
808000 -- [-767.361] (-765.789) (-766.165) (-766.278) * (-767.191) (-767.726) [-769.448] (-767.878) -- 0:00:12
808500 -- (-766.184) (-766.752) (-766.096) [-766.301] * (-767.901) (-767.786) (-767.063) [-767.830] -- 0:00:12
809000 -- (-766.287) [-765.811] (-765.815) (-766.680) * (-766.967) [-764.158] (-767.998) (-768.457) -- 0:00:12
809500 -- (-766.248) (-767.339) [-763.558] (-768.656) * (-767.025) (-768.880) (-766.900) [-768.005] -- 0:00:12
810000 -- [-765.422] (-769.295) (-763.732) (-764.529) * [-769.430] (-767.259) (-765.255) (-772.317) -- 0:00:12
Average standard deviation of split frequencies: 0.006469
810500 -- (-767.286) [-765.158] (-763.642) (-767.456) * (-766.700) (-774.443) (-766.247) [-770.947] -- 0:00:12
811000 -- [-766.727] (-766.692) (-765.022) (-764.320) * [-766.350] (-775.175) (-768.798) (-770.015) -- 0:00:12
811500 -- [-767.149] (-766.966) (-766.896) (-767.849) * (-772.743) [-768.911] (-767.834) (-767.826) -- 0:00:12
812000 -- (-769.326) (-766.751) (-767.029) [-765.545] * (-766.510) [-767.131] (-769.774) (-766.928) -- 0:00:12
812500 -- (-767.649) (-768.991) [-765.750] (-766.127) * (-768.985) (-765.567) [-769.715] (-766.908) -- 0:00:12
813000 -- (-770.056) (-768.505) (-767.085) [-764.778] * (-764.911) [-766.111] (-770.067) (-770.273) -- 0:00:12
813500 -- (-768.500) (-765.689) (-771.544) [-764.259] * (-770.280) (-766.769) (-767.121) [-765.517] -- 0:00:12
814000 -- (-772.199) [-767.405] (-771.276) (-765.617) * [-767.076] (-766.065) (-766.906) (-767.145) -- 0:00:12
814500 -- (-770.264) (-767.691) [-769.616] (-767.763) * (-767.418) (-767.941) (-767.762) [-767.491] -- 0:00:12
815000 -- [-769.662] (-766.624) (-765.562) (-775.011) * (-767.000) (-765.057) [-768.089] (-768.386) -- 0:00:12
Average standard deviation of split frequencies: 0.006463
815500 -- (-765.517) (-765.204) (-765.950) [-767.074] * (-766.604) [-766.783] (-766.287) (-771.030) -- 0:00:11
816000 -- (-766.788) (-766.377) [-764.621] (-767.880) * (-772.181) (-769.070) [-766.098] (-768.504) -- 0:00:11
816500 -- (-770.197) [-770.377] (-771.709) (-766.960) * [-770.946] (-767.390) (-766.468) (-768.020) -- 0:00:11
817000 -- [-768.370] (-764.744) (-764.710) (-765.081) * (-770.672) (-767.291) (-768.406) [-767.290] -- 0:00:11
817500 -- (-768.337) (-766.818) (-764.882) [-768.539] * [-768.547] (-770.721) (-766.611) (-765.957) -- 0:00:11
818000 -- [-767.725] (-765.652) (-766.054) (-766.853) * (-765.194) [-767.207] (-765.988) (-772.253) -- 0:00:11
818500 -- [-769.316] (-764.224) (-765.141) (-765.204) * (-766.102) [-766.508] (-768.353) (-769.675) -- 0:00:11
819000 -- (-769.802) (-765.564) [-765.664] (-767.306) * (-766.735) [-766.147] (-771.111) (-765.983) -- 0:00:11
819500 -- (-767.044) (-768.099) (-766.242) [-764.431] * (-765.853) [-766.779] (-768.520) (-767.566) -- 0:00:11
820000 -- (-771.602) (-770.305) [-765.259] (-765.788) * (-767.238) [-768.428] (-767.881) (-772.016) -- 0:00:11
Average standard deviation of split frequencies: 0.006606
820500 -- (-766.628) [-763.362] (-765.575) (-766.219) * (-768.816) (-774.556) [-766.494] (-765.599) -- 0:00:11
821000 -- (-767.416) [-765.197] (-767.548) (-768.655) * (-766.405) (-771.181) (-770.019) [-767.334] -- 0:00:11
821500 -- [-765.878] (-767.380) (-767.243) (-765.023) * (-767.072) (-766.840) [-766.716] (-767.459) -- 0:00:11
822000 -- [-766.970] (-769.067) (-767.879) (-765.416) * [-765.897] (-766.757) (-767.465) (-769.748) -- 0:00:11
822500 -- (-767.849) (-766.677) [-767.100] (-764.891) * (-769.510) (-766.088) (-768.265) [-766.301] -- 0:00:11
823000 -- [-768.113] (-766.908) (-765.910) (-765.656) * [-767.645] (-769.953) (-767.214) (-768.424) -- 0:00:11
823500 -- [-767.119] (-764.303) (-772.003) (-766.532) * (-765.491) (-767.162) [-765.729] (-766.003) -- 0:00:11
824000 -- (-770.091) (-768.085) (-767.510) [-765.037] * (-765.338) (-772.923) [-769.442] (-766.780) -- 0:00:11
824500 -- [-767.340] (-767.796) (-764.570) (-764.285) * (-765.916) (-765.391) [-766.484] (-767.797) -- 0:00:11
825000 -- (-765.731) (-769.361) (-768.510) [-764.029] * (-769.315) (-767.617) [-766.670] (-768.642) -- 0:00:11
Average standard deviation of split frequencies: 0.007050
825500 -- (-766.322) [-763.804] (-766.563) (-766.027) * (-766.636) (-769.612) (-766.988) [-764.377] -- 0:00:11
826000 -- (-766.638) (-769.776) (-766.552) [-766.531] * (-766.866) (-770.069) [-764.951] (-765.878) -- 0:00:11
826500 -- (-766.675) (-769.094) (-766.265) [-767.881] * [-765.418] (-768.083) (-766.597) (-765.715) -- 0:00:11
827000 -- (-768.235) (-765.791) [-766.839] (-767.569) * [-764.573] (-768.822) (-766.816) (-766.766) -- 0:00:11
827500 -- [-767.089] (-768.943) (-768.589) (-765.755) * [-765.768] (-768.002) (-766.170) (-767.402) -- 0:00:11
828000 -- (-767.121) (-764.795) (-766.549) [-766.040] * [-765.337] (-767.579) (-767.521) (-768.274) -- 0:00:11
828500 -- (-767.887) (-769.249) [-766.904] (-770.775) * (-766.782) (-769.166) (-769.726) [-768.051] -- 0:00:11
829000 -- (-766.975) [-765.719] (-768.405) (-768.361) * [-766.778] (-769.732) (-774.715) (-764.937) -- 0:00:11
829500 -- (-767.793) [-765.861] (-769.189) (-763.713) * (-766.982) [-768.139] (-766.906) (-765.729) -- 0:00:11
830000 -- (-765.655) (-764.474) (-769.107) [-767.519] * [-767.593] (-766.777) (-767.026) (-767.618) -- 0:00:11
Average standard deviation of split frequencies: 0.006845
830500 -- [-767.741] (-766.151) (-768.218) (-763.982) * (-767.307) (-771.204) [-764.232] (-769.091) -- 0:00:11
831000 -- (-766.633) (-766.744) (-765.855) [-766.549] * (-767.412) [-769.111] (-767.408) (-770.350) -- 0:00:10
831500 -- [-766.768] (-767.623) (-766.537) (-765.633) * [-766.943] (-770.065) (-767.626) (-764.432) -- 0:00:10
832000 -- (-766.733) (-768.754) [-767.248] (-767.400) * [-766.350] (-767.980) (-767.338) (-767.325) -- 0:00:10
832500 -- [-769.530] (-768.093) (-771.237) (-765.410) * (-765.930) (-767.322) [-767.592] (-772.996) -- 0:00:10
833000 -- [-765.635] (-765.749) (-766.053) (-764.140) * (-768.497) (-765.215) [-765.118] (-768.513) -- 0:00:10
833500 -- (-769.189) (-767.316) (-766.209) [-765.814] * (-765.701) (-769.817) [-766.527] (-766.040) -- 0:00:10
834000 -- (-767.724) [-767.842] (-766.853) (-766.848) * [-767.435] (-769.922) (-764.488) (-765.870) -- 0:00:10
834500 -- [-766.040] (-770.189) (-769.226) (-768.041) * (-766.891) (-768.990) (-764.596) [-766.180] -- 0:00:10
835000 -- (-764.745) (-770.115) (-767.042) [-767.282] * (-765.004) (-767.935) [-765.006] (-767.943) -- 0:00:10
Average standard deviation of split frequencies: 0.006802
835500 -- (-764.422) [-767.453] (-771.486) (-765.042) * [-764.115] (-766.324) (-764.824) (-765.043) -- 0:00:10
836000 -- (-765.152) [-767.069] (-771.580) (-765.590) * (-765.192) (-767.541) (-766.133) [-766.513] -- 0:00:10
836500 -- (-768.138) [-766.600] (-767.434) (-765.351) * [-766.541] (-773.936) (-766.880) (-765.998) -- 0:00:10
837000 -- [-765.896] (-767.036) (-767.654) (-767.427) * (-766.434) (-771.347) [-766.436] (-768.207) -- 0:00:10
837500 -- (-767.931) (-766.156) [-767.012] (-766.600) * (-764.562) (-770.184) (-764.836) [-765.685] -- 0:00:10
838000 -- [-769.085] (-767.780) (-768.248) (-771.510) * (-764.987) [-770.260] (-768.082) (-766.058) -- 0:00:10
838500 -- (-766.711) (-764.622) (-768.204) [-770.858] * (-765.097) (-772.646) (-764.419) [-766.592] -- 0:00:10
839000 -- (-769.328) (-769.493) (-765.552) [-767.134] * (-765.457) (-766.945) [-764.908] (-766.192) -- 0:00:10
839500 -- (-769.161) (-766.321) [-766.577] (-767.797) * (-765.067) (-765.813) [-764.580] (-769.765) -- 0:00:10
840000 -- (-766.984) [-764.802] (-766.893) (-767.226) * [-768.318] (-770.230) (-773.582) (-765.631) -- 0:00:10
Average standard deviation of split frequencies: 0.006904
840500 -- (-765.843) (-765.297) (-767.069) [-767.014] * (-769.354) [-769.073] (-768.527) (-770.976) -- 0:00:10
841000 -- [-769.278] (-769.042) (-771.568) (-767.439) * (-769.569) [-766.896] (-765.576) (-769.475) -- 0:00:10
841500 -- [-766.739] (-766.999) (-766.050) (-766.963) * (-766.097) (-764.316) (-765.386) [-767.774] -- 0:00:10
842000 -- (-770.130) [-767.700] (-767.104) (-765.737) * (-767.397) (-768.086) (-764.258) [-765.925] -- 0:00:10
842500 -- (-771.512) (-771.718) (-764.469) [-764.732] * [-764.323] (-768.257) (-765.360) (-767.566) -- 0:00:10
843000 -- (-766.826) (-771.271) [-764.798] (-768.348) * [-765.271] (-768.392) (-766.106) (-766.147) -- 0:00:10
843500 -- [-768.241] (-769.343) (-767.958) (-765.854) * [-765.886] (-763.692) (-765.606) (-769.560) -- 0:00:10
844000 -- [-766.565] (-768.499) (-764.690) (-768.080) * (-767.317) (-764.194) [-767.089] (-765.317) -- 0:00:10
844500 -- (-767.654) [-769.718] (-765.403) (-771.159) * [-770.360] (-769.108) (-765.090) (-768.577) -- 0:00:10
845000 -- [-764.438] (-765.938) (-764.707) (-767.670) * [-764.484] (-765.001) (-768.262) (-766.192) -- 0:00:10
Average standard deviation of split frequencies: 0.007244
845500 -- (-768.088) (-771.041) (-766.979) [-768.076] * [-764.467] (-767.521) (-770.244) (-767.639) -- 0:00:10
846000 -- (-770.734) (-767.161) [-767.626] (-770.661) * [-766.331] (-769.787) (-769.319) (-767.572) -- 0:00:10
846500 -- [-769.926] (-765.899) (-770.940) (-766.020) * [-765.677] (-769.019) (-765.618) (-771.375) -- 0:00:09
847000 -- [-767.668] (-764.068) (-767.563) (-765.697) * [-768.178] (-767.104) (-767.631) (-764.578) -- 0:00:09
847500 -- (-769.534) [-766.505] (-766.959) (-766.079) * (-766.088) (-766.653) (-769.141) [-766.075] -- 0:00:09
848000 -- (-768.544) (-766.932) [-768.050] (-767.092) * (-767.041) (-766.484) [-765.579] (-765.156) -- 0:00:09
848500 -- (-769.608) (-766.167) (-766.676) [-765.487] * (-767.499) (-767.339) [-766.935] (-766.678) -- 0:00:09
849000 -- (-767.407) (-767.544) (-765.749) [-767.035] * (-767.564) [-766.239] (-766.481) (-770.738) -- 0:00:09
849500 -- (-765.695) (-767.003) [-765.213] (-767.250) * [-765.248] (-769.135) (-769.299) (-767.784) -- 0:00:09
850000 -- (-769.031) (-765.159) [-767.145] (-767.161) * (-764.869) (-766.241) (-767.831) [-767.370] -- 0:00:09
Average standard deviation of split frequencies: 0.006719
850500 -- (-765.952) [-768.515] (-767.936) (-768.503) * (-764.618) (-768.607) (-768.940) [-767.711] -- 0:00:09
851000 -- (-766.775) [-766.046] (-766.477) (-766.481) * (-766.994) (-764.535) (-767.027) [-766.487] -- 0:00:09
851500 -- (-766.674) (-767.575) [-766.977] (-767.553) * (-768.946) [-765.467] (-765.095) (-766.340) -- 0:00:09
852000 -- [-765.847] (-764.991) (-768.271) (-767.730) * [-764.453] (-765.803) (-765.617) (-766.783) -- 0:00:09
852500 -- (-765.486) [-766.174] (-767.780) (-765.795) * (-768.292) (-765.578) (-772.259) [-765.846] -- 0:00:09
853000 -- (-765.460) [-767.593] (-767.117) (-767.383) * (-768.094) (-765.255) [-766.719] (-766.264) -- 0:00:09
853500 -- [-765.262] (-766.301) (-767.467) (-767.480) * [-765.748] (-770.472) (-766.377) (-765.825) -- 0:00:09
854000 -- (-766.147) (-767.917) [-767.400] (-767.273) * (-765.193) (-770.761) (-769.176) [-769.383] -- 0:00:09
854500 -- [-765.328] (-766.688) (-767.811) (-770.754) * (-765.980) (-767.507) [-764.963] (-769.154) -- 0:00:09
855000 -- (-764.809) (-766.129) [-768.321] (-771.730) * (-764.527) (-767.080) (-765.628) [-764.534] -- 0:00:09
Average standard deviation of split frequencies: 0.006976
855500 -- (-768.787) (-768.956) [-766.513] (-765.423) * [-765.950] (-767.608) (-767.508) (-767.173) -- 0:00:09
856000 -- [-772.048] (-766.705) (-766.972) (-766.536) * (-765.921) (-767.149) [-764.249] (-766.480) -- 0:00:09
856500 -- (-767.252) (-764.551) [-768.219] (-766.399) * (-766.968) [-766.973] (-766.021) (-764.530) -- 0:00:09
857000 -- (-767.270) [-765.959] (-766.721) (-765.953) * (-768.809) (-767.896) [-764.216] (-768.054) -- 0:00:09
857500 -- (-768.273) (-768.515) (-765.660) [-765.591] * (-765.315) (-766.164) (-765.128) [-764.367] -- 0:00:09
858000 -- (-766.570) [-766.134] (-768.298) (-766.687) * [-765.302] (-765.471) (-767.291) (-766.723) -- 0:00:09
858500 -- (-766.233) (-770.038) (-767.313) [-765.539] * [-767.742] (-766.219) (-766.427) (-768.858) -- 0:00:09
859000 -- [-765.709] (-766.933) (-766.553) (-765.237) * [-765.938] (-767.018) (-766.708) (-765.896) -- 0:00:09
859500 -- (-768.812) (-766.555) (-771.161) [-767.231] * (-766.790) (-770.300) [-766.239] (-767.997) -- 0:00:09
860000 -- [-768.466] (-765.846) (-768.882) (-764.382) * (-766.641) (-766.063) [-766.522] (-765.090) -- 0:00:09
Average standard deviation of split frequencies: 0.007634
860500 -- (-768.585) (-766.327) (-771.473) [-766.122] * (-769.173) [-768.447] (-767.310) (-765.938) -- 0:00:09
861000 -- (-766.441) [-767.356] (-766.719) (-766.731) * (-768.769) (-767.867) (-768.191) [-766.159] -- 0:00:09
861500 -- [-767.584] (-767.250) (-767.906) (-765.458) * (-767.976) (-769.840) (-768.653) [-765.770] -- 0:00:09
862000 -- (-768.734) (-767.864) [-768.390] (-765.729) * [-765.486] (-767.721) (-767.398) (-766.108) -- 0:00:08
862500 -- (-768.339) (-765.420) (-766.504) [-767.367] * [-765.098] (-765.416) (-767.535) (-766.667) -- 0:00:08
863000 -- (-767.505) [-770.728] (-766.481) (-767.022) * (-767.132) (-764.828) [-765.987] (-765.892) -- 0:00:08
863500 -- (-770.402) (-765.345) [-764.496] (-766.149) * (-766.038) (-767.168) [-763.819] (-767.464) -- 0:00:08
864000 -- [-768.796] (-766.779) (-767.201) (-765.673) * (-767.661) (-768.445) (-768.468) [-767.605] -- 0:00:08
864500 -- (-766.914) (-768.561) (-767.733) [-765.820] * (-769.653) (-768.077) (-767.951) [-768.877] -- 0:00:08
865000 -- (-765.655) (-767.487) (-766.888) [-765.163] * (-773.218) [-766.209] (-765.724) (-766.503) -- 0:00:08
Average standard deviation of split frequencies: 0.007893
865500 -- (-764.876) (-767.921) (-766.638) [-764.267] * (-764.325) (-768.387) [-764.426] (-766.520) -- 0:00:08
866000 -- (-768.712) (-765.786) [-767.149] (-765.393) * (-763.547) (-766.953) [-766.804] (-768.055) -- 0:00:08
866500 -- (-764.382) [-766.920] (-768.151) (-764.803) * (-771.791) [-765.008] (-769.688) (-767.679) -- 0:00:08
867000 -- [-764.652] (-767.767) (-767.259) (-764.984) * (-765.916) (-765.144) (-765.157) [-771.640] -- 0:00:08
867500 -- (-768.219) (-768.310) [-765.467] (-765.670) * (-764.194) [-764.803] (-770.529) (-769.613) -- 0:00:08
868000 -- [-768.090] (-770.388) (-770.687) (-767.243) * (-766.732) [-765.719] (-764.811) (-766.537) -- 0:00:08
868500 -- (-767.974) [-766.985] (-764.557) (-766.349) * [-766.296] (-765.021) (-766.230) (-765.804) -- 0:00:08
869000 -- [-764.894] (-769.181) (-775.868) (-766.439) * (-766.710) (-767.448) (-766.771) [-768.047] -- 0:00:08
869500 -- (-765.267) (-765.952) [-768.228] (-768.441) * (-766.780) (-764.998) (-765.697) [-764.722] -- 0:00:08
870000 -- [-765.364] (-765.181) (-767.696) (-765.775) * (-766.069) (-768.227) (-766.409) [-766.834] -- 0:00:08
Average standard deviation of split frequencies: 0.007930
870500 -- (-765.419) (-768.084) (-766.781) [-768.406] * [-768.695] (-766.759) (-766.987) (-768.883) -- 0:00:08
871000 -- (-772.849) [-767.789] (-768.558) (-766.684) * (-766.847) [-766.523] (-766.467) (-768.003) -- 0:00:08
871500 -- (-771.298) (-763.874) [-766.752] (-768.820) * [-765.576] (-765.975) (-770.172) (-766.606) -- 0:00:08
872000 -- (-764.461) (-766.701) (-772.761) [-765.394] * (-766.532) (-765.973) (-770.736) [-764.575] -- 0:00:08
872500 -- (-764.203) [-767.703] (-770.204) (-765.362) * (-766.256) [-767.421] (-767.230) (-766.934) -- 0:00:08
873000 -- (-766.946) [-769.323] (-768.996) (-766.298) * (-766.304) [-763.971] (-769.302) (-766.944) -- 0:00:08
873500 -- (-766.349) [-767.453] (-767.701) (-773.102) * (-763.940) (-766.402) (-765.840) [-765.994] -- 0:00:08
874000 -- [-768.330] (-769.421) (-767.158) (-767.561) * [-764.924] (-769.334) (-766.267) (-769.027) -- 0:00:08
874500 -- [-767.591] (-766.720) (-766.589) (-763.711) * [-765.670] (-764.204) (-764.487) (-773.673) -- 0:00:08
875000 -- [-767.453] (-769.555) (-767.337) (-768.653) * (-766.166) [-766.473] (-767.055) (-767.221) -- 0:00:08
Average standard deviation of split frequencies: 0.007629
875500 -- (-763.393) (-765.336) [-770.260] (-767.575) * [-765.959] (-766.598) (-766.105) (-772.447) -- 0:00:08
876000 -- (-767.737) (-764.257) [-768.911] (-766.148) * (-765.151) (-765.359) [-765.988] (-773.143) -- 0:00:08
876500 -- (-765.587) (-767.542) (-768.512) [-765.178] * (-766.808) [-764.883] (-766.359) (-770.790) -- 0:00:08
877000 -- [-764.867] (-766.512) (-768.084) (-768.932) * (-766.677) (-765.756) [-768.966] (-766.184) -- 0:00:07
877500 -- [-765.113] (-765.654) (-767.473) (-767.204) * (-768.946) [-763.839] (-768.523) (-768.619) -- 0:00:07
878000 -- (-767.336) (-771.454) (-765.888) [-768.191] * (-766.758) (-764.649) (-766.844) [-766.757] -- 0:00:07
878500 -- [-767.835] (-773.467) (-768.963) (-766.993) * [-766.989] (-764.462) (-767.346) (-766.152) -- 0:00:07
879000 -- [-766.267] (-766.963) (-766.694) (-765.764) * (-768.677) (-766.004) [-766.919] (-769.253) -- 0:00:07
879500 -- (-766.446) [-765.880] (-769.264) (-767.478) * (-765.278) [-765.903] (-769.958) (-767.700) -- 0:00:07
880000 -- [-773.018] (-764.933) (-767.743) (-766.170) * [-765.663] (-764.460) (-770.062) (-766.440) -- 0:00:07
Average standard deviation of split frequencies: 0.007494
880500 -- [-766.938] (-765.995) (-770.186) (-765.675) * (-767.461) (-766.345) [-766.513] (-765.174) -- 0:00:07
881000 -- [-763.396] (-765.867) (-768.130) (-767.475) * (-773.164) [-765.190] (-766.702) (-768.376) -- 0:00:07
881500 -- (-763.605) [-770.199] (-766.885) (-766.649) * [-767.162] (-764.849) (-766.423) (-768.693) -- 0:00:07
882000 -- (-767.520) [-765.482] (-766.518) (-767.131) * (-765.339) (-766.455) [-765.868] (-766.654) -- 0:00:07
882500 -- [-767.858] (-766.197) (-768.384) (-767.952) * (-765.019) (-766.168) (-765.844) [-766.558] -- 0:00:07
883000 -- (-767.355) (-766.188) (-766.998) [-766.079] * [-768.476] (-768.610) (-767.137) (-766.802) -- 0:00:07
883500 -- (-764.468) (-764.781) (-766.361) [-769.640] * (-766.910) (-765.631) [-767.800] (-766.867) -- 0:00:07
884000 -- (-768.751) (-773.178) (-766.802) [-764.395] * (-769.911) [-768.229] (-768.837) (-766.868) -- 0:00:07
884500 -- (-767.353) (-767.942) [-766.220] (-770.734) * (-768.543) (-766.041) (-767.061) [-766.115] -- 0:00:07
885000 -- (-767.102) [-764.823] (-770.357) (-771.201) * (-766.676) (-765.770) (-766.505) [-766.916] -- 0:00:07
Average standard deviation of split frequencies: 0.007605
885500 -- (-772.229) [-766.150] (-768.376) (-767.590) * [-768.478] (-765.833) (-767.114) (-766.982) -- 0:00:07
886000 -- (-768.236) (-769.520) [-766.254] (-772.018) * [-766.516] (-768.084) (-765.275) (-765.748) -- 0:00:07
886500 -- (-772.550) (-767.329) (-766.178) [-767.342] * [-764.362] (-768.058) (-765.363) (-765.787) -- 0:00:07
887000 -- (-771.111) (-767.283) [-765.098] (-763.671) * [-765.981] (-766.565) (-765.303) (-769.404) -- 0:00:07
887500 -- (-768.720) (-763.431) (-767.806) [-765.257] * (-765.884) (-766.415) [-765.538] (-765.603) -- 0:00:07
888000 -- (-770.826) [-766.055] (-767.869) (-767.324) * [-768.327] (-766.047) (-769.343) (-765.613) -- 0:00:07
888500 -- (-763.607) (-765.705) (-766.963) [-768.826] * [-765.193] (-769.022) (-768.191) (-767.695) -- 0:00:07
889000 -- (-764.807) [-765.909] (-768.176) (-766.925) * (-765.216) (-767.417) (-766.902) [-765.754] -- 0:00:07
889500 -- [-765.420] (-765.686) (-769.182) (-765.321) * (-767.541) (-768.537) (-766.876) [-766.779] -- 0:00:07
890000 -- [-770.197] (-768.404) (-768.850) (-765.676) * [-766.417] (-769.754) (-766.973) (-771.285) -- 0:00:07
Average standard deviation of split frequencies: 0.007211
890500 -- (-770.376) [-766.853] (-764.745) (-765.898) * (-768.326) (-767.737) (-768.757) [-766.926] -- 0:00:07
891000 -- (-769.722) (-770.051) [-764.999] (-767.199) * (-766.348) (-768.570) [-766.072] (-764.958) -- 0:00:07
891500 -- [-766.146] (-769.128) (-766.921) (-765.338) * (-764.969) (-769.681) (-768.436) [-765.807] -- 0:00:07
892000 -- (-768.486) (-767.417) (-767.463) [-765.083] * (-766.511) (-769.848) [-765.514] (-766.058) -- 0:00:07
892500 -- [-765.313] (-765.873) (-768.306) (-765.408) * [-766.497] (-770.502) (-766.752) (-765.553) -- 0:00:06
893000 -- [-765.164] (-765.328) (-767.466) (-765.554) * (-765.764) (-765.967) (-768.447) [-765.871] -- 0:00:06
893500 -- (-765.969) (-765.811) (-765.387) [-767.709] * (-765.296) (-766.351) [-767.110] (-767.016) -- 0:00:06
894000 -- [-765.502] (-766.281) (-767.620) (-764.690) * (-765.627) (-765.993) (-767.168) [-770.281] -- 0:00:06
894500 -- [-765.254] (-766.833) (-766.025) (-764.680) * (-766.556) [-772.990] (-765.293) (-767.712) -- 0:00:06
895000 -- (-768.748) (-766.290) [-765.964] (-766.817) * (-765.059) (-766.031) (-764.858) [-764.421] -- 0:00:06
Average standard deviation of split frequencies: 0.007267
895500 -- [-766.781] (-764.634) (-765.662) (-770.450) * (-767.112) (-768.942) (-767.963) [-765.630] -- 0:00:06
896000 -- [-765.650] (-772.095) (-767.315) (-767.604) * (-766.143) (-768.532) (-767.139) [-764.196] -- 0:00:06
896500 -- (-768.192) [-765.541] (-764.002) (-771.592) * [-766.683] (-767.755) (-764.973) (-762.634) -- 0:00:06
897000 -- [-766.465] (-764.778) (-765.617) (-766.404) * (-766.480) (-767.631) (-769.200) [-769.921] -- 0:00:06
897500 -- (-767.141) [-764.887] (-768.510) (-766.017) * (-770.174) [-769.536] (-766.227) (-768.620) -- 0:00:06
898000 -- (-767.274) (-766.394) [-768.583] (-765.526) * (-770.893) (-765.551) [-766.213] (-772.768) -- 0:00:06
898500 -- (-766.909) (-766.064) [-767.303] (-769.308) * (-767.860) (-767.138) [-766.825] (-769.863) -- 0:00:06
899000 -- (-769.444) (-765.959) [-766.811] (-769.808) * (-767.997) (-766.140) [-766.698] (-768.361) -- 0:00:06
899500 -- [-769.551] (-766.335) (-770.288) (-773.437) * (-768.398) (-769.034) [-766.481] (-767.321) -- 0:00:06
900000 -- (-766.883) (-770.002) [-766.192] (-770.166) * (-770.299) (-766.032) [-766.700] (-763.468) -- 0:00:06
Average standard deviation of split frequencies: 0.007491
900500 -- (-766.674) [-765.204] (-769.562) (-767.051) * (-767.037) (-767.845) (-766.743) [-768.084] -- 0:00:06
901000 -- (-769.653) (-766.076) (-768.591) [-766.908] * (-767.760) (-767.014) [-766.344] (-767.517) -- 0:00:06
901500 -- (-764.693) (-765.940) (-766.480) [-766.610] * (-768.568) (-764.353) [-766.448] (-764.008) -- 0:00:06
902000 -- (-765.678) (-765.679) (-771.360) [-765.833] * (-766.868) [-765.362] (-767.573) (-765.066) -- 0:00:06
902500 -- (-768.603) [-766.081] (-769.869) (-767.002) * (-767.752) (-767.504) [-766.937] (-766.153) -- 0:00:06
903000 -- (-767.465) [-765.009] (-769.450) (-768.193) * (-767.010) (-765.326) (-767.248) [-766.214] -- 0:00:06
903500 -- (-767.622) (-766.676) [-766.666] (-764.856) * (-764.993) [-768.233] (-764.917) (-768.010) -- 0:00:06
904000 -- (-771.798) (-770.084) (-769.587) [-766.441] * (-770.624) (-763.286) [-769.988] (-764.782) -- 0:00:06
904500 -- (-767.121) (-769.337) [-765.728] (-767.155) * [-767.265] (-764.409) (-774.993) (-766.844) -- 0:00:06
905000 -- (-765.595) (-764.527) (-765.342) [-765.517] * (-768.487) (-764.893) [-773.856] (-765.939) -- 0:00:06
Average standard deviation of split frequencies: 0.007988
905500 -- (-767.662) (-767.449) (-771.288) [-766.891] * (-765.415) (-766.049) [-769.587] (-768.946) -- 0:00:06
906000 -- (-765.855) (-767.180) [-767.435] (-766.839) * (-768.787) (-766.594) (-769.367) [-763.558] -- 0:00:06
906500 -- (-767.832) (-765.832) [-769.462] (-765.523) * (-768.712) [-767.384] (-770.883) (-764.570) -- 0:00:06
907000 -- [-767.214] (-766.646) (-767.133) (-764.149) * (-769.837) (-767.325) (-765.588) [-763.442] -- 0:00:06
907500 -- (-770.278) (-766.938) (-765.508) [-767.131] * (-763.168) [-764.516] (-766.808) (-767.327) -- 0:00:06
908000 -- (-772.256) (-767.037) [-766.821] (-767.716) * [-769.452] (-767.701) (-767.605) (-768.913) -- 0:00:05
908500 -- (-764.952) [-770.234] (-766.164) (-771.176) * (-769.930) (-766.931) [-765.838] (-766.872) -- 0:00:05
909000 -- (-770.157) (-769.763) (-767.303) [-765.949] * [-765.461] (-764.787) (-766.286) (-766.017) -- 0:00:05
909500 -- (-774.418) (-766.921) [-767.208] (-766.271) * [-766.452] (-767.583) (-766.856) (-764.622) -- 0:00:05
910000 -- (-768.275) (-770.271) [-768.974] (-763.064) * (-769.394) (-765.140) [-765.325] (-766.850) -- 0:00:05
Average standard deviation of split frequencies: 0.007829
910500 -- [-765.698] (-767.677) (-766.594) (-766.313) * (-771.290) (-767.886) (-764.186) [-765.279] -- 0:00:05
911000 -- [-765.572] (-765.733) (-772.396) (-764.778) * (-773.229) (-768.533) [-766.624] (-764.161) -- 0:00:05
911500 -- [-765.840] (-767.166) (-767.064) (-766.059) * [-765.392] (-768.691) (-766.023) (-765.099) -- 0:00:05
912000 -- [-766.523] (-764.024) (-766.789) (-766.871) * (-768.016) (-764.368) (-766.594) [-764.480] -- 0:00:05
912500 -- [-767.230] (-767.903) (-768.185) (-767.208) * (-767.207) [-768.764] (-768.418) (-766.036) -- 0:00:05
913000 -- [-766.341] (-767.515) (-766.820) (-766.778) * (-764.468) (-769.102) (-767.604) [-764.367] -- 0:00:05
913500 -- (-768.216) [-767.180] (-767.146) (-769.506) * [-766.403] (-765.191) (-765.572) (-765.624) -- 0:00:05
914000 -- [-765.204] (-767.189) (-767.555) (-770.270) * (-764.982) (-766.196) [-765.431] (-766.338) -- 0:00:05
914500 -- [-765.802] (-769.698) (-766.218) (-766.209) * (-771.331) (-766.232) [-766.335] (-768.590) -- 0:00:05
915000 -- (-766.487) [-768.249] (-766.616) (-764.538) * (-767.600) [-766.569] (-764.268) (-773.030) -- 0:00:05
Average standard deviation of split frequencies: 0.007880
915500 -- (-770.591) (-766.426) [-766.405] (-764.709) * [-769.040] (-766.694) (-765.854) (-769.000) -- 0:00:05
916000 -- (-767.518) (-766.508) (-764.531) [-765.915] * (-766.137) (-767.754) (-768.235) [-768.734] -- 0:00:05
916500 -- (-767.968) (-768.824) [-763.857] (-769.445) * [-764.533] (-767.535) (-768.131) (-768.162) -- 0:00:05
917000 -- [-765.042] (-767.162) (-765.727) (-769.161) * [-764.024] (-768.993) (-768.062) (-766.045) -- 0:00:05
917500 -- (-766.238) (-766.599) (-764.339) [-767.573] * [-766.882] (-769.933) (-767.754) (-767.829) -- 0:00:05
918000 -- (-765.111) (-767.331) [-763.788] (-767.069) * [-766.945] (-767.253) (-764.424) (-767.082) -- 0:00:05
918500 -- (-765.209) [-766.186] (-764.921) (-768.010) * (-766.631) (-769.064) [-770.737] (-767.459) -- 0:00:05
919000 -- (-768.245) [-766.920] (-765.748) (-770.182) * (-767.884) [-768.385] (-768.745) (-767.062) -- 0:00:05
919500 -- [-766.923] (-766.107) (-765.567) (-768.902) * (-770.184) [-769.479] (-767.939) (-766.730) -- 0:00:05
920000 -- (-765.794) (-767.681) [-768.428] (-770.930) * [-769.630] (-768.777) (-766.799) (-771.557) -- 0:00:05
Average standard deviation of split frequencies: 0.007520
920500 -- [-769.749] (-766.549) (-766.621) (-768.183) * [-765.639] (-766.802) (-767.320) (-770.417) -- 0:00:05
921000 -- (-765.584) [-768.721] (-765.833) (-767.988) * (-767.273) (-766.069) [-767.645] (-765.788) -- 0:00:05
921500 -- (-765.623) (-766.798) (-767.824) [-767.272] * (-771.839) (-767.255) [-764.626] (-768.795) -- 0:00:05
922000 -- (-767.637) [-769.185] (-766.927) (-767.690) * (-766.280) (-765.505) (-765.690) [-763.234] -- 0:00:05
922500 -- (-765.483) (-770.702) [-767.870] (-768.707) * [-767.708] (-766.898) (-768.787) (-765.959) -- 0:00:05
923000 -- [-766.268] (-771.250) (-766.519) (-768.117) * (-767.332) (-767.090) (-766.587) [-765.679] -- 0:00:05
923500 -- (-763.819) (-768.553) [-764.779] (-767.543) * (-769.042) [-766.740] (-767.651) (-770.673) -- 0:00:04
924000 -- (-766.180) (-765.593) [-765.371] (-770.730) * (-767.291) (-767.920) [-765.304] (-764.592) -- 0:00:04
924500 -- [-765.064] (-770.842) (-766.350) (-765.396) * (-768.587) (-766.149) [-766.919] (-766.475) -- 0:00:04
925000 -- [-767.494] (-770.326) (-769.574) (-766.049) * (-766.154) (-768.885) (-764.007) [-766.194] -- 0:00:04
Average standard deviation of split frequencies: 0.007786
925500 -- [-766.989] (-765.981) (-765.674) (-763.703) * (-765.900) [-764.539] (-765.383) (-765.425) -- 0:00:04
926000 -- (-766.725) (-769.021) [-769.769] (-763.989) * [-765.609] (-763.824) (-766.712) (-763.924) -- 0:00:04
926500 -- [-765.710] (-768.183) (-765.745) (-763.970) * (-769.177) (-763.216) [-765.699] (-764.531) -- 0:00:04
927000 -- (-765.652) [-766.146] (-768.690) (-766.554) * (-769.562) (-763.553) (-766.110) [-763.797] -- 0:00:04
927500 -- (-767.889) (-767.977) (-769.336) [-767.882] * [-767.343] (-766.585) (-766.160) (-766.534) -- 0:00:04
928000 -- (-764.174) [-767.040] (-769.010) (-767.773) * (-773.050) (-765.057) (-765.509) [-764.343] -- 0:00:04
928500 -- (-766.138) (-770.868) (-767.066) [-765.716] * (-768.464) (-766.224) [-765.768] (-764.948) -- 0:00:04
929000 -- (-766.036) (-766.062) (-770.546) [-763.945] * (-770.832) (-764.093) (-766.858) [-766.375] -- 0:00:04
929500 -- (-766.795) (-766.209) [-764.358] (-765.650) * [-765.081] (-766.308) (-765.383) (-768.047) -- 0:00:04
930000 -- (-767.224) (-766.377) [-765.619] (-767.202) * (-766.587) (-765.637) (-766.171) [-767.149] -- 0:00:04
Average standard deviation of split frequencies: 0.007281
930500 -- (-764.961) [-766.086] (-764.177) (-766.744) * (-769.432) (-766.445) [-767.570] (-765.947) -- 0:00:04
931000 -- (-767.836) (-765.640) [-766.780] (-768.118) * [-766.132] (-764.556) (-770.292) (-763.404) -- 0:00:04
931500 -- [-765.658] (-766.758) (-765.329) (-767.807) * (-765.789) (-767.069) (-764.706) [-766.090] -- 0:00:04
932000 -- (-764.791) (-767.438) [-767.655] (-767.011) * [-767.206] (-766.180) (-768.109) (-765.902) -- 0:00:04
932500 -- [-765.010] (-767.695) (-767.202) (-767.195) * (-768.897) (-763.681) (-766.160) [-765.778] -- 0:00:04
933000 -- (-766.982) (-768.277) (-768.153) [-766.866] * (-769.492) (-767.187) [-766.929] (-768.141) -- 0:00:04
933500 -- [-767.440] (-767.443) (-764.229) (-767.443) * (-767.813) (-765.640) (-768.435) [-767.068] -- 0:00:04
934000 -- [-766.139] (-767.275) (-767.575) (-767.147) * [-766.022] (-765.133) (-769.020) (-768.388) -- 0:00:04
934500 -- (-765.461) [-765.852] (-767.346) (-769.490) * (-765.822) (-763.498) (-768.907) [-767.217] -- 0:00:04
935000 -- [-766.218] (-765.646) (-765.121) (-770.519) * (-770.438) (-766.687) [-765.895] (-766.996) -- 0:00:04
Average standard deviation of split frequencies: 0.007145
935500 -- (-765.390) (-764.030) (-764.261) [-766.380] * (-771.600) [-766.710] (-769.792) (-766.598) -- 0:00:04
936000 -- (-768.676) (-768.380) [-765.210] (-766.030) * (-768.522) [-766.299] (-769.621) (-767.751) -- 0:00:04
936500 -- (-767.027) [-766.426] (-765.940) (-768.705) * (-765.170) (-766.992) (-766.600) [-771.027] -- 0:00:04
937000 -- (-768.858) (-768.503) [-768.951] (-769.208) * [-770.691] (-766.071) (-770.011) (-764.228) -- 0:00:04
937500 -- (-768.655) [-769.210] (-765.632) (-765.745) * (-768.271) (-766.967) (-765.923) [-766.438] -- 0:00:04
938000 -- (-767.532) [-765.501] (-767.153) (-767.523) * (-768.393) (-763.676) (-766.496) [-764.946] -- 0:00:04
938500 -- (-765.560) (-767.727) [-767.405] (-767.947) * (-766.692) [-766.389] (-767.282) (-767.225) -- 0:00:03
939000 -- (-765.080) (-768.328) (-766.541) [-766.432] * (-767.680) (-766.726) (-766.143) [-764.146] -- 0:00:03
939500 -- (-771.019) (-770.785) (-767.352) [-764.480] * (-765.947) (-766.980) (-765.571) [-765.631] -- 0:00:03
940000 -- (-769.272) (-765.779) (-767.522) [-765.506] * [-767.382] (-769.630) (-764.686) (-767.648) -- 0:00:03
Average standard deviation of split frequencies: 0.006734
940500 -- (-766.845) [-767.943] (-767.461) (-765.815) * (-766.889) (-768.356) (-768.585) [-769.069] -- 0:00:03
941000 -- (-769.727) (-767.611) [-766.218] (-766.429) * (-770.420) (-768.253) (-767.909) [-764.371] -- 0:00:03
941500 -- (-769.785) (-766.194) [-763.934] (-764.445) * [-765.875] (-769.891) (-764.791) (-765.733) -- 0:00:03
942000 -- (-765.818) [-768.781] (-767.808) (-765.614) * [-766.199] (-766.343) (-765.968) (-765.935) -- 0:00:03
942500 -- [-767.733] (-767.160) (-767.459) (-766.319) * [-764.644] (-766.170) (-764.961) (-766.073) -- 0:00:03
943000 -- [-768.888] (-766.381) (-764.592) (-768.391) * (-767.070) (-767.194) (-765.417) [-765.572] -- 0:00:03
943500 -- (-766.863) (-768.259) [-765.566] (-768.031) * (-768.065) (-766.909) [-767.761] (-765.922) -- 0:00:03
944000 -- (-767.068) [-767.011] (-767.285) (-766.609) * (-766.357) (-770.307) [-764.779] (-770.158) -- 0:00:03
944500 -- (-766.378) [-765.488] (-769.610) (-765.372) * [-767.854] (-770.824) (-763.913) (-768.053) -- 0:00:03
945000 -- [-769.007] (-764.108) (-774.751) (-765.260) * (-765.905) (-766.878) [-766.908] (-767.040) -- 0:00:03
Average standard deviation of split frequencies: 0.006758
945500 -- (-768.379) (-767.415) [-770.954] (-769.419) * (-765.009) [-767.352] (-767.495) (-765.008) -- 0:00:03
946000 -- [-763.421] (-767.350) (-770.168) (-765.606) * [-765.431] (-769.083) (-765.734) (-764.496) -- 0:00:03
946500 -- [-763.917] (-768.043) (-766.492) (-765.608) * (-770.076) [-766.331] (-767.059) (-764.925) -- 0:00:03
947000 -- (-763.516) (-770.385) [-763.692] (-766.860) * (-768.214) (-772.243) [-765.781] (-765.614) -- 0:00:03
947500 -- (-766.563) (-771.115) [-765.683] (-769.112) * (-767.817) (-765.561) [-768.358] (-766.989) -- 0:00:03
948000 -- (-767.894) (-769.128) [-766.759] (-773.691) * (-763.415) (-767.921) [-766.779] (-764.894) -- 0:00:03
948500 -- (-766.081) [-767.434] (-764.225) (-768.409) * [-765.787] (-766.422) (-765.887) (-768.519) -- 0:00:03
949000 -- (-767.504) [-766.639] (-769.215) (-767.285) * (-767.367) [-769.744] (-766.569) (-767.072) -- 0:00:03
949500 -- (-766.343) (-765.016) (-764.548) [-766.930] * [-765.551] (-766.028) (-766.484) (-765.504) -- 0:00:03
950000 -- (-766.265) (-767.182) [-765.495] (-771.121) * (-769.185) (-766.271) (-768.313) [-765.569] -- 0:00:03
Average standard deviation of split frequencies: 0.007041
950500 -- (-767.479) (-767.866) (-767.817) [-767.721] * (-770.844) [-767.604] (-766.019) (-765.451) -- 0:00:03
951000 -- (-769.153) (-766.560) (-766.628) [-767.415] * (-766.645) (-766.059) (-767.591) [-768.016] -- 0:00:03
951500 -- [-765.289] (-766.643) (-769.833) (-768.237) * (-764.677) (-767.847) (-768.015) [-771.839] -- 0:00:03
952000 -- (-767.151) (-766.445) (-770.058) [-765.827] * (-766.110) (-772.801) (-769.998) [-767.048] -- 0:00:03
952500 -- [-766.658] (-766.101) (-770.272) (-766.282) * (-767.681) (-766.840) [-766.072] (-765.811) -- 0:00:03
953000 -- (-765.907) (-767.855) (-770.575) [-766.542] * (-767.404) (-767.471) (-764.967) [-767.353] -- 0:00:03
953500 -- [-768.420] (-766.035) (-767.971) (-763.817) * (-770.277) (-766.341) (-766.583) [-765.731] -- 0:00:03
954000 -- [-766.570] (-765.005) (-766.088) (-765.514) * [-771.934] (-766.764) (-768.620) (-767.261) -- 0:00:02
954500 -- [-762.205] (-767.132) (-766.546) (-766.833) * [-769.988] (-766.687) (-767.301) (-767.589) -- 0:00:02
955000 -- [-767.234] (-764.955) (-764.794) (-768.337) * (-766.041) [-768.133] (-767.065) (-767.803) -- 0:00:02
Average standard deviation of split frequencies: 0.006838
955500 -- [-764.763] (-766.167) (-765.482) (-769.426) * [-765.431] (-771.935) (-765.879) (-767.996) -- 0:00:02
956000 -- (-766.980) [-765.144] (-766.844) (-765.079) * [-771.096] (-767.320) (-765.575) (-769.012) -- 0:00:02
956500 -- (-766.813) (-767.283) [-770.236] (-765.166) * (-765.650) (-769.880) [-765.566] (-765.289) -- 0:00:02
957000 -- (-770.930) (-765.203) (-771.407) [-767.353] * (-768.760) [-767.302] (-768.214) (-765.625) -- 0:00:02
957500 -- (-771.892) [-764.950] (-770.052) (-767.984) * (-765.554) [-771.050] (-765.245) (-766.641) -- 0:00:02
958000 -- (-765.359) (-766.201) (-767.783) [-765.453] * (-771.199) (-767.751) (-768.067) [-766.016] -- 0:00:02
958500 -- [-765.521] (-766.288) (-767.056) (-767.070) * (-768.642) (-766.283) (-769.078) [-767.171] -- 0:00:02
959000 -- (-766.483) [-766.152] (-766.961) (-768.258) * [-769.094] (-767.297) (-767.633) (-764.788) -- 0:00:02
959500 -- (-768.275) (-766.835) [-767.928] (-770.668) * (-772.944) [-767.547] (-769.972) (-766.350) -- 0:00:02
960000 -- (-766.494) (-766.608) (-767.477) [-765.323] * (-765.227) [-765.533] (-773.241) (-766.945) -- 0:00:02
Average standard deviation of split frequencies: 0.007099
960500 -- [-765.991] (-764.837) (-766.927) (-765.090) * (-765.617) (-768.625) [-768.823] (-766.173) -- 0:00:02
961000 -- [-765.103] (-765.868) (-771.465) (-768.681) * (-765.797) (-766.109) (-764.978) [-766.395] -- 0:00:02
961500 -- [-769.795] (-764.565) (-771.029) (-769.217) * (-767.547) [-766.974] (-765.798) (-764.360) -- 0:00:02
962000 -- (-769.861) (-768.603) (-768.566) [-766.388] * (-764.638) [-766.147] (-765.551) (-770.364) -- 0:00:02
962500 -- [-767.676] (-772.882) (-770.484) (-766.161) * (-763.900) [-769.676] (-766.779) (-767.682) -- 0:00:02
963000 -- (-769.169) (-767.069) [-765.976] (-766.240) * (-766.214) (-766.606) [-766.447] (-767.104) -- 0:00:02
963500 -- (-768.771) [-767.667] (-765.943) (-766.998) * (-763.699) (-766.713) [-764.934] (-765.468) -- 0:00:02
964000 -- (-769.255) (-768.371) [-765.371] (-766.859) * [-764.390] (-764.129) (-767.199) (-767.682) -- 0:00:02
964500 -- (-766.547) (-768.379) (-767.849) [-764.922] * (-766.210) (-771.422) (-766.811) [-765.932] -- 0:00:02
965000 -- (-765.217) (-767.773) (-768.275) [-766.449] * (-765.610) [-768.871] (-766.466) (-766.537) -- 0:00:02
Average standard deviation of split frequencies: 0.007125
965500 -- (-766.049) [-770.481] (-768.373) (-765.340) * [-766.684] (-767.282) (-765.672) (-764.585) -- 0:00:02
966000 -- (-765.477) (-764.645) [-767.914] (-768.085) * (-766.960) [-766.537] (-766.575) (-766.754) -- 0:00:02
966500 -- (-765.664) (-769.489) (-769.086) [-766.612] * (-768.163) (-769.673) [-765.797] (-766.700) -- 0:00:02
967000 -- (-764.980) [-763.253] (-771.270) (-767.694) * (-768.609) (-765.063) [-771.025] (-764.317) -- 0:00:02
967500 -- (-766.923) (-768.142) (-766.655) [-766.579] * (-766.738) [-768.350] (-768.914) (-764.459) -- 0:00:02
968000 -- (-767.392) [-770.967] (-769.620) (-769.964) * (-767.470) [-766.736] (-766.253) (-765.620) -- 0:00:02
968500 -- [-766.131] (-767.572) (-767.597) (-765.957) * (-769.923) (-766.636) (-767.514) [-765.815] -- 0:00:02
969000 -- [-766.076] (-766.003) (-765.871) (-773.820) * (-772.338) (-768.720) (-767.684) [-766.408] -- 0:00:02
969500 -- (-765.674) (-764.991) [-771.861] (-771.650) * (-769.328) (-768.065) (-767.682) [-765.802] -- 0:00:01
970000 -- [-766.314] (-774.526) (-766.259) (-767.001) * (-769.298) (-769.851) [-767.278] (-768.902) -- 0:00:01
Average standard deviation of split frequencies: 0.006929
970500 -- (-767.686) (-766.113) (-768.116) [-767.096] * (-765.437) (-767.058) (-769.021) [-767.940] -- 0:00:01
971000 -- (-769.222) [-765.161] (-766.874) (-767.702) * (-764.732) (-765.874) (-766.735) [-764.286] -- 0:00:01
971500 -- [-765.587] (-769.579) (-770.984) (-768.766) * (-766.049) (-765.897) (-767.432) [-768.393] -- 0:00:01
972000 -- (-767.654) [-767.351] (-767.050) (-765.046) * (-767.602) [-768.934] (-764.754) (-771.164) -- 0:00:01
972500 -- (-765.481) (-766.642) (-766.209) [-770.779] * (-771.497) [-765.870] (-768.359) (-769.693) -- 0:00:01
973000 -- (-764.915) (-775.227) [-764.850] (-765.382) * (-766.668) (-768.039) [-766.331] (-768.258) -- 0:00:01
973500 -- [-766.702] (-768.087) (-766.690) (-767.127) * [-763.799] (-766.589) (-766.042) (-764.733) -- 0:00:01
974000 -- (-768.950) (-766.920) (-766.423) [-765.215] * (-766.028) [-768.255] (-765.973) (-765.461) -- 0:00:01
974500 -- (-768.274) [-766.791] (-764.934) (-768.059) * (-766.818) (-765.324) [-772.478] (-773.257) -- 0:00:01
975000 -- (-768.747) [-765.690] (-765.555) (-770.575) * (-766.685) (-768.227) [-765.923] (-768.450) -- 0:00:01
Average standard deviation of split frequencies: 0.006891
975500 -- (-766.506) [-766.808] (-770.532) (-765.094) * (-765.824) (-767.248) (-765.556) [-766.139] -- 0:00:01
976000 -- (-766.038) [-766.807] (-764.711) (-767.126) * (-765.695) (-766.770) (-767.837) [-766.493] -- 0:00:01
976500 -- [-765.666] (-769.308) (-766.183) (-765.970) * (-766.746) [-766.890] (-765.062) (-768.739) -- 0:00:01
977000 -- [-764.928] (-767.194) (-771.516) (-766.808) * (-764.969) (-766.640) [-764.046] (-769.487) -- 0:00:01
977500 -- (-769.151) [-766.969] (-767.813) (-767.229) * [-767.621] (-767.212) (-764.943) (-768.783) -- 0:00:01
978000 -- (-770.086) [-769.826] (-765.950) (-768.877) * (-766.384) (-769.094) (-763.869) [-769.664] -- 0:00:01
978500 -- (-768.924) (-768.217) [-764.265] (-771.223) * (-765.797) [-767.267] (-770.835) (-766.544) -- 0:00:01
979000 -- (-768.599) [-767.170] (-764.363) (-766.000) * (-766.073) [-766.924] (-768.675) (-766.270) -- 0:00:01
979500 -- [-769.002] (-766.131) (-766.719) (-765.227) * [-765.398] (-768.136) (-765.122) (-766.572) -- 0:00:01
980000 -- (-768.914) [-766.609] (-768.886) (-766.488) * (-766.531) (-768.620) [-766.067] (-767.823) -- 0:00:01
Average standard deviation of split frequencies: 0.006858
980500 -- [-766.448] (-768.029) (-766.637) (-767.322) * (-772.330) [-769.518] (-766.410) (-766.681) -- 0:00:01
981000 -- (-764.739) [-767.312] (-766.639) (-766.840) * [-766.586] (-767.094) (-766.936) (-766.517) -- 0:00:01
981500 -- (-765.165) [-768.226] (-770.316) (-766.847) * (-769.697) (-767.462) [-766.290] (-767.404) -- 0:00:01
982000 -- [-766.913] (-769.118) (-770.967) (-767.396) * (-767.262) (-769.175) [-765.176] (-764.695) -- 0:00:01
982500 -- (-766.276) (-767.762) (-766.056) [-769.349] * [-765.379] (-766.586) (-764.322) (-766.130) -- 0:00:01
983000 -- (-767.492) (-764.847) [-765.842] (-770.895) * (-766.133) (-768.724) [-767.171] (-767.177) -- 0:00:01
983500 -- (-766.764) [-768.487] (-766.976) (-773.204) * [-764.596] (-769.424) (-768.029) (-766.744) -- 0:00:01
984000 -- (-769.373) (-766.955) (-765.671) [-765.991] * [-768.094] (-767.648) (-764.897) (-766.693) -- 0:00:01
984500 -- [-765.912] (-767.745) (-768.120) (-769.833) * (-764.163) (-772.479) (-765.601) [-764.779] -- 0:00:01
985000 -- (-765.791) (-768.327) [-768.822] (-768.822) * (-764.458) (-773.368) (-772.481) [-765.832] -- 0:00:00
Average standard deviation of split frequencies: 0.006661
985500 -- (-763.612) (-769.929) (-766.222) [-766.309] * (-768.366) (-773.743) [-770.243] (-765.587) -- 0:00:00
986000 -- [-764.601] (-768.190) (-765.358) (-770.084) * (-767.322) (-769.368) (-767.823) [-764.791] -- 0:00:00
986500 -- [-766.274] (-766.929) (-765.645) (-766.057) * (-765.247) (-768.197) (-770.916) [-766.567] -- 0:00:00
987000 -- (-765.460) (-767.149) (-766.890) [-766.906] * [-766.165] (-767.067) (-766.529) (-764.910) -- 0:00:00
987500 -- (-766.169) (-766.993) [-768.078] (-766.663) * (-765.201) (-767.327) [-768.141] (-766.902) -- 0:00:00
988000 -- [-765.231] (-768.498) (-766.043) (-768.457) * [-766.353] (-772.110) (-770.344) (-764.746) -- 0:00:00
988500 -- (-766.280) (-766.644) [-765.778] (-769.626) * (-766.997) [-766.957] (-770.787) (-767.468) -- 0:00:00
989000 -- (-767.921) [-767.538] (-768.373) (-767.510) * (-766.425) (-765.064) (-770.118) [-764.698] -- 0:00:00
989500 -- [-768.966] (-767.900) (-768.185) (-766.335) * (-768.834) (-766.712) [-767.250] (-767.356) -- 0:00:00
990000 -- (-771.264) [-766.029] (-772.011) (-766.585) * [-766.390] (-767.646) (-766.585) (-766.823) -- 0:00:00
Average standard deviation of split frequencies: 0.006154
990500 -- (-769.753) (-765.316) [-765.747] (-766.093) * (-765.906) [-767.357] (-767.167) (-769.254) -- 0:00:00
991000 -- [-766.329] (-767.265) (-766.604) (-768.592) * (-766.527) [-767.401] (-770.562) (-766.696) -- 0:00:00
991500 -- (-768.903) [-764.464] (-773.572) (-765.952) * (-766.904) [-770.048] (-768.688) (-767.217) -- 0:00:00
992000 -- (-765.077) [-767.521] (-766.710) (-765.911) * (-766.142) (-769.516) (-770.217) [-766.822] -- 0:00:00
992500 -- (-765.520) [-771.384] (-767.326) (-767.260) * [-768.253] (-770.950) (-768.553) (-765.397) -- 0:00:00
993000 -- (-768.523) (-769.901) (-767.850) [-765.919] * (-770.310) [-773.398] (-766.533) (-766.277) -- 0:00:00
993500 -- (-770.403) (-768.180) (-767.013) [-766.069] * (-768.903) (-767.669) [-764.696] (-766.261) -- 0:00:00
994000 -- (-767.299) (-767.001) [-766.109] (-767.628) * (-767.118) [-768.152] (-767.287) (-766.188) -- 0:00:00
994500 -- (-767.513) (-772.311) [-771.286] (-767.186) * (-768.513) (-766.559) [-768.488] (-765.012) -- 0:00:00
995000 -- [-766.169] (-769.512) (-769.792) (-768.082) * (-765.752) [-765.969] (-768.245) (-767.354) -- 0:00:00
Average standard deviation of split frequencies: 0.006121
995500 -- (-768.604) (-768.189) (-766.654) [-765.851] * (-766.167) [-767.292] (-766.452) (-764.085) -- 0:00:00
996000 -- (-767.253) (-766.657) [-765.453] (-765.295) * (-766.906) (-766.519) [-770.321] (-767.992) -- 0:00:00
996500 -- (-765.033) [-766.271] (-766.289) (-766.226) * (-770.246) (-767.133) (-765.656) [-768.650] -- 0:00:00
997000 -- (-765.503) [-766.632] (-768.505) (-767.438) * (-767.568) (-764.716) [-765.871] (-771.289) -- 0:00:00
997500 -- (-769.687) [-765.083] (-766.600) (-769.815) * (-768.013) (-766.812) [-767.755] (-766.748) -- 0:00:00
998000 -- (-764.964) (-768.779) [-767.524] (-770.513) * (-767.736) (-769.098) (-767.694) [-765.912] -- 0:00:00
998500 -- [-765.619] (-766.114) (-766.521) (-767.989) * (-766.777) (-769.487) (-767.851) [-766.809] -- 0:00:00
999000 -- [-767.766] (-768.802) (-765.609) (-766.358) * [-767.004] (-767.883) (-767.536) (-766.039) -- 0:00:00
999500 -- (-769.365) (-764.770) [-766.833] (-764.936) * [-767.899] (-768.706) (-770.009) (-766.499) -- 0:00:00
1000000 -- (-769.806) (-765.958) [-769.477] (-766.624) * (-767.712) (-766.135) (-765.956) [-764.248] -- 0:00:00
Average standard deviation of split frequencies: 0.006187
Analysis completed in 1 mins 5 seconds
Analysis used 63.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -761.87
Likelihood of best state for "cold" chain of run 2 was -761.86
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 71 %) Dirichlet(Revmat{all})
98.1 % ( 94 %) Slider(Revmat{all})
30.5 % ( 30 %) Dirichlet(Pi{all})
31.7 % ( 24 %) Slider(Pi{all})
68.1 % ( 56 %) Multiplier(Alpha{1,2})
79.4 % ( 53 %) Multiplier(Alpha{3})
26.9 % ( 30 %) Slider(Pinvar{all})
97.2 % ( 97 %) ExtSPR(Tau{all},V{all})
69.0 % ( 68 %) ExtTBR(Tau{all},V{all})
98.0 % ( 97 %) NNI(Tau{all},V{all})
88.0 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
95.0 % ( 96 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 65 %) Dirichlet(Revmat{all})
98.0 % ( 96 %) Slider(Revmat{all})
30.2 % ( 31 %) Dirichlet(Pi{all})
31.7 % ( 23 %) Slider(Pi{all})
69.0 % ( 34 %) Multiplier(Alpha{1,2})
79.1 % ( 49 %) Multiplier(Alpha{3})
26.9 % ( 23 %) Slider(Pinvar{all})
97.2 % ( 99 %) ExtSPR(Tau{all},V{all})
69.0 % ( 73 %) ExtTBR(Tau{all},V{all})
98.1 % (100 %) NNI(Tau{all},V{all})
87.8 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
95.1 % ( 98 %) Nodeslider(V{all})
30.1 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 167218 0.82 0.66
3 | 166192 166766 0.83
4 | 166191 167048 166585
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166855 0.81 0.66
3 | 167552 166435 0.83
4 | 166483 165917 166758
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -766.00
| 1 1 2 |
| 1 2 2 |
| 2 2 2 1 2 1 |
| 1 1 2 2 * 1 2 1 121 |
| 1 1 1 1 2 22 1 1 1 2 2 21 2 |
| 2 1 2 1 1 22 2 11 1 11 |
| 1 2 11 * 212 * 2 1 212 2 1 22 |
| 2 22 1 1 1 2 1 1 2 112 11|
|2 1 2 111 2 1 1 |
| 1 2 2 |
| 1 2 * 2 2 1 2 2 1 |
|1 1 2 2 2|
| 1 2 2 |
| |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -767.76
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -765.70 -769.99
2 -765.74 -769.30
--------------------------------------
TOTAL -765.72 -769.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883036 0.090199 0.368067 1.486511 0.845293 1501.00 1501.00 1.000
r(A<->C){all} 0.150130 0.017608 0.000006 0.423978 0.112863 173.96 242.20 1.000
r(A<->G){all} 0.180099 0.023202 0.000088 0.481754 0.138199 130.82 200.50 1.012
r(A<->T){all} 0.150158 0.016189 0.000069 0.402082 0.117084 249.00 274.13 1.002
r(C<->G){all} 0.150459 0.017880 0.000016 0.417932 0.113251 224.49 235.60 1.000
r(C<->T){all} 0.207208 0.024505 0.000606 0.517668 0.173692 218.12 249.15 1.002
r(G<->T){all} 0.161946 0.019084 0.000214 0.450698 0.124604 270.70 301.15 1.000
pi(A){all} 0.224166 0.000315 0.192079 0.260853 0.223866 1355.70 1379.46 1.000
pi(C){all} 0.298174 0.000374 0.258319 0.334109 0.298114 1036.86 1066.35 1.000
pi(G){all} 0.264194 0.000336 0.227610 0.299611 0.263546 1184.50 1258.32 1.000
pi(T){all} 0.213467 0.000293 0.181259 0.247553 0.213126 1401.42 1438.21 1.000
alpha{1,2} 0.331018 0.160755 0.000219 1.094400 0.200225 680.09 997.18 1.000
alpha{3} 0.415117 0.238101 0.000130 1.361331 0.242220 1098.05 1227.22 1.000
pinvar{all} 0.993718 0.000026 0.983385 0.999838 0.995067 1192.02 1337.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ...**.
9 -- ...*.*
10 -- .*..*.
11 -- ..****
12 -- ..*.*.
13 -- ..**..
14 -- .**.**
15 -- .*.***
16 -- .*...*
17 -- ....**
18 -- .*.*..
19 -- .**...
20 -- .***.*
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.003769 0.148568 0.153897 2
8 449 0.149567 0.002355 0.147901 0.151233 2
9 445 0.148235 0.002355 0.146569 0.149900 2
10 445 0.148235 0.001413 0.147235 0.149234 2
11 442 0.147235 0.020728 0.132578 0.161892 2
12 440 0.146569 0.014133 0.136576 0.156562 2
13 438 0.145903 0.007537 0.140573 0.151233 2
14 438 0.145903 0.000000 0.145903 0.145903 2
15 436 0.145237 0.008480 0.139241 0.151233 2
16 436 0.145237 0.008480 0.139241 0.151233 2
17 417 0.138907 0.006124 0.134577 0.143238 2
18 408 0.135909 0.012248 0.127249 0.144570 2
19 405 0.134910 0.003298 0.132578 0.137242 2
20 402 0.133911 0.001884 0.132578 0.135243 2
21 372 0.123917 0.000000 0.123917 0.123917 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.092849 0.009491 0.000006 0.277997 0.061527 1.000 2
length{all}[2] 0.093316 0.008544 0.000002 0.280670 0.065244 1.001 2
length{all}[3] 0.091870 0.009055 0.000014 0.273868 0.062654 1.000 2
length{all}[4] 0.092575 0.009026 0.000032 0.290253 0.062237 1.001 2
length{all}[5] 0.094488 0.009788 0.000019 0.285151 0.063943 1.000 2
length{all}[6] 0.138544 0.014192 0.000080 0.375637 0.107901 1.000 2
length{all}[7] 0.095716 0.008261 0.000274 0.273603 0.065725 0.998 2
length{all}[8] 0.094941 0.009139 0.000009 0.255622 0.069070 0.998 2
length{all}[9] 0.099163 0.011537 0.000297 0.310225 0.070115 0.998 2
length{all}[10] 0.086032 0.007450 0.000235 0.243733 0.060211 0.998 2
length{all}[11] 0.095255 0.009218 0.000338 0.284300 0.065325 0.999 2
length{all}[12] 0.084724 0.007840 0.000110 0.263929 0.056832 0.998 2
length{all}[13] 0.092787 0.008228 0.000150 0.255046 0.067988 1.004 2
length{all}[14] 0.090575 0.008123 0.000243 0.273818 0.064874 0.998 2
length{all}[15] 0.094973 0.009465 0.000087 0.258245 0.066405 1.005 2
length{all}[16] 0.095170 0.008797 0.000148 0.271636 0.067636 0.999 2
length{all}[17] 0.095205 0.009800 0.000040 0.274398 0.066009 0.999 2
length{all}[18] 0.090773 0.007940 0.000193 0.273374 0.060669 0.998 2
length{all}[19] 0.095847 0.009218 0.000425 0.284050 0.067140 0.999 2
length{all}[20] 0.094332 0.009501 0.000485 0.301324 0.068383 1.013 2
length{all}[21] 0.098679 0.010707 0.000039 0.293273 0.071176 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006187
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------- C1 (1)
|
|-------------------------------------------- C2 (2)
|
|------------------------------------------ C3 (3)
+
|------------------------------------------ C4 (4)
|
|------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 546
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 182 / 182 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 182 / 182 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.034312 0.021936 0.046882 0.108796 0.027817 0.016353 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -779.314976
Iterating by ming2
Initial: fx= 779.314976
x= 0.03431 0.02194 0.04688 0.10880 0.02782 0.01635 0.30000 1.30000
1 h-m-p 0.0000 0.0001 418.9100 ++ 759.191417 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3727.7205 ++ 754.966356 m 0.0000 24 | 2/8
3 h-m-p 0.0011 0.0055 6.2658 -----------.. | 2/8
4 h-m-p 0.0000 0.0000 460.7280 ++ 751.660850 m 0.0000 55 | 3/8
5 h-m-p 0.0000 0.0000 397.3223 ++ 747.133710 m 0.0000 66 | 4/8
6 h-m-p 0.0020 0.7409 6.3593 ------------.. | 4/8
7 h-m-p 0.0000 0.0001 209.8457 +CYYYYC 743.310762 5 0.0001 106 | 4/8
8 h-m-p 0.0000 0.0001 667.6275 ++ 735.643060 m 0.0001 117 | 5/8
9 h-m-p 0.0160 8.0000 3.0390 +++YYCYC 733.653213 4 1.5562 136 | 5/8
10 h-m-p 1.6000 8.0000 0.2168 ++ 733.440932 m 8.0000 147 | 5/8
11 h-m-p 1.6000 8.0000 0.3410 +YC 733.401912 1 4.4780 163 | 5/8
12 h-m-p 1.6000 8.0000 0.5412 ++ 733.241314 m 8.0000 177 | 5/8
13 h-m-p 1.6000 8.0000 2.4324 ++ 733.086629 m 8.0000 191 | 5/8
14 h-m-p 1.6000 8.0000 4.2574 YC 733.053067 1 3.4276 203 | 5/8
15 h-m-p 1.6000 8.0000 4.9676 +CCC 733.022247 2 5.6365 219 | 5/8
16 h-m-p 1.6000 8.0000 11.0346 YC 733.003388 1 3.0393 231 | 5/8
17 h-m-p 1.6000 8.0000 15.9829 +YC 732.990237 1 4.2304 244 | 5/8
18 h-m-p 1.6000 8.0000 25.2929 CC 732.982316 1 2.5654 257 | 5/8
19 h-m-p 1.6000 8.0000 35.0773 +YC 732.976031 1 4.8015 270 | 5/8
20 h-m-p 1.6000 8.0000 57.9950 CC 732.972673 1 2.3010 283 | 5/8
21 h-m-p 1.6000 8.0000 76.5532 +CC 732.969742 1 5.3907 297 | 5/8
22 h-m-p 0.5496 2.7480 134.3854 +C 732.968326 0 2.1778 309 | 5/8
23 h-m-p 0.0897 0.4484 170.9716 ++ 732.968099 m 0.4484 320 | 6/8
24 h-m-p 0.0666 0.3331 393.0032 ++ 732.967715 m 0.3331 331 | 7/8
25 h-m-p 0.5527 8.0000 0.0000 Y 732.967682 0 1.0204 342 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 ----N 732.967682 0 0.0008 358
Out..
lnL = -732.967682
359 lfun, 359 eigenQcodon, 2154 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.100878 0.050799 0.039332 0.058341 0.084162 0.036611 999.000000 0.761594 0.171187
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.032093
np = 9
lnL0 = -793.647037
Iterating by ming2
Initial: fx= 793.647037
x= 0.10088 0.05080 0.03933 0.05834 0.08416 0.03661 951.42857 0.76159 0.17119
1 h-m-p 0.0000 0.0002 384.9540 +++ 758.249739 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 3543.1687 ++ 750.729574 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0001 200.0323 ++ 746.783206 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0001 594.5572 ++ 738.030524 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0001 143.5670 ++ 735.257390 m 0.0001 63 | 5/9
6 h-m-p 0.0059 0.7202 1.4461 ++++ 734.851137 m 0.7202 77 | 6/9
7 h-m-p 0.4523 2.2614 0.0827 ++ 733.537117 m 2.2614 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0002 ++ 733.353508 m 8.0000 104 | 7/9
9 h-m-p 1.6000 8.0000 0.0004 CYC 733.341772 2 2.0141 121 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 733.341772 0 1.4613 135
Out..
lnL = -733.341772
136 lfun, 408 eigenQcodon, 1632 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.066196 0.024399 0.055192 0.106323 0.025312 0.094244 951.428624 1.552998 0.499831 0.430326 1032.161186
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000205
np = 11
lnL0 = -753.859934
Iterating by ming2
Initial: fx= 753.859934
x= 0.06620 0.02440 0.05519 0.10632 0.02531 0.09424 951.42862 1.55300 0.49983 0.43033 951.42857
1 h-m-p 0.0000 0.0010 52.6413 ++++ 750.355961 m 0.0010 18 | 1/11
2 h-m-p 0.0003 0.0016 16.7033 ++ 749.961289 m 0.0016 32 | 2/11
3 h-m-p 0.0001 0.0009 502.3508 +++ 743.860525 m 0.0009 47 | 3/11
4 h-m-p 0.0000 0.0000 8441.3967 ++ 741.436697 m 0.0000 61 | 4/11
5 h-m-p 0.0006 0.0028 381.8094 ++ 736.599934 m 0.0028 75 | 5/11
6 h-m-p 0.0530 0.2651 1.9777 ++ 734.736689 m 0.2651 89 | 6/11
7 h-m-p 0.1462 8.0000 2.4716 C
a 0.000000 0.146196 0.584783 0.140324
f 734.736689 734.730295 734.794542 734.740355
0.000000e+00 734.736689
2.923913e-02 734.796907
5.847827e-02 734.817449
8.771740e-02 734.807736
1.169565e-01 734.776221
1.461957e-01 734.730295
1.754348e-01 734.676296
2.046739e-01 734.619564
2.339131e-01 734.564505
2.631522e-01 734.514671
2.923913e-01 734.472860
3.216305e-01 734.441227
3.508696e-01 734.421406
3.801087e-01 734.414629
4.093479e-01 734.421837
4.385870e-01 734.443773
4.678262e-01 734.481059
4.970653e-01 734.534245
5.263044e-01 734.603862
5.555436e-01 734.690441
5.847827e-01 734.794542
Linesearch2 a4: multiple optima?
CCCC 734.414628 4 0.3799 132 | 6/11
8 h-m-p 1.5173 8.0000 0.6189 YC 734.395472 1 0.2054 147 | 6/11
9 h-m-p 1.6000 8.0000 0.0218 ----------------.. | 6/11
10 h-m-p 0.0000 0.0213 6.2967 ++++YYCYYYCYYY 733.068336 10 0.0200 215 | 6/11
11 h-m-p 0.1058 8.0000 1.1935 --------------.. | 6/11
12 h-m-p 0.0000 0.0009 8.6084 ++YCC 733.063896 2 0.0001 260 | 6/11
13 h-m-p 0.0160 8.0000 0.1344 +++++ 732.994509 m 8.0000 277 | 6/11
14 h-m-p 1.6000 8.0000 0.2911 YC 732.988852 1 0.7847 297 | 6/11
15 h-m-p 0.6172 8.0000 0.3701 +CC 732.977522 1 2.4250 319 | 6/11
16 h-m-p 1.6000 8.0000 0.3096 YYC 732.973067 2 2.4772 340 | 6/11
17 h-m-p 1.5595 8.0000 0.4919 C 732.970948 0 1.5857 359 | 6/11
18 h-m-p 1.6000 8.0000 0.3688 +Y 732.969500 0 6.4000 379 | 6/11
19 h-m-p 1.6000 8.0000 0.3797 YC 732.969307 1 1.2597 399 | 6/11
20 h-m-p 1.5617 8.0000 0.3063 ++ 732.969063 m 8.0000 418 | 6/11
21 h-m-p 1.1806 8.0000 2.0753 ++ 732.968439 m 8.0000 437 | 6/11
22 h-m-p 1.6000 8.0000 7.9850 YC 732.968030 1 2.7608 452 | 6/11
23 h-m-p 1.6000 8.0000 6.4810 C 732.967910 0 2.1456 466 | 6/11
24 h-m-p 1.3076 6.5379 6.3780 +Y 732.967848 0 3.9029 481 | 6/11
25 h-m-p 0.4842 2.4209 6.9424 +C 732.967831 0 1.7700 496 | 6/11
26 h-m-p 0.1356 0.6782 6.6626 ++ 732.967828 m 0.6782 510 | 6/11
27 h-m-p -0.0000 -0.0000 17.0480
h-m-p: -0.00000000e+00 -0.00000000e+00 1.70480456e+01 732.967828
.. | 6/11
28 h-m-p 0.0160 8.0000 0.1736 ---Y 732.967827 0 0.0000 538 | 6/11
29 h-m-p 0.5641 8.0000 0.0000 -Y 732.967827 0 0.0621 558
Out..
lnL = -732.967827
559 lfun, 2236 eigenQcodon, 10062 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -737.897828 S = -736.458927 -2.367429
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:03
did 20 / 54 patterns 0:03
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.061346 0.011137 0.046755 0.025957 0.013667 0.017728 951.434980 0.749630 1.406967
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.032986
np = 9
lnL0 = -762.606215
Iterating by ming2
Initial: fx= 762.606215
x= 0.06135 0.01114 0.04675 0.02596 0.01367 0.01773 951.43498 0.74963 1.40697
1 h-m-p 0.0000 0.0001 402.6751 ++ 752.302440 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 8606.6760 ++ 750.501977 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 36155.6735 ++ 743.917845 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 233.7118 ++ 736.491067 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 391.4328 ++ 733.860246 m 0.0000 62 | 5/9
6 h-m-p 0.0109 5.4723 0.5414 ++++
QuantileBeta(0.85, 3.35827, 0.00500) = 1.000000e+00 2000 rounds
YYYC 733.477557 3 2.9297 81 | 5/9
7 h-m-p 0.7286 3.6431 0.2201 +
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
+ 733.349740 m 3.6431 97
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.61317, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
8 h-m-p 1.6000 8.0000 0.1065
QuantileBeta(0.85, 2.44285, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52266, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.52454, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.56892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52784, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.54838, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
C 733.341773 3 0.8010 118
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52810, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.52799, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52804, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
Y 733.341773 0 3.6289 133
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
10 h-m-p 1.5227 8.0000 0.0000
QuantileBeta(0.85, 2.52797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52800, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
Y 733.341773 0 0.0238 150
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -733.341773
151 lfun, 1661 eigenQcodon, 9060 P(t)
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52801, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.089217 0.033122 0.108869 0.084985 0.036882 0.095445 951.435001 0.900000 1.109548 1.537264 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000278
np = 11
lnL0 = -750.549132
Iterating by ming2
Initial: fx= 750.549132
x= 0.08922 0.03312 0.10887 0.08498 0.03688 0.09544 951.43500 0.90000 1.10955 1.53726 951.42857
1 h-m-p 0.0000 0.0007 136.3761 +++YYYYYCCC 739.658203 7 0.0006 28 | 0/11
2 h-m-p 0.0005 0.0023 23.1918 ++ 738.529017 m 0.0023 42 | 1/11
3 h-m-p 0.0000 0.0000 430.9916 ++ 738.398112 m 0.0000 56 | 2/11
4 h-m-p 0.0000 0.0003 338.0089 +++ 736.254861 m 0.0003 71 | 3/11
5 h-m-p 0.0012 0.0058 6.1291 ++ 735.530413 m 0.0058 85 | 4/11
6 h-m-p 0.0001 0.0003 68.6928 ++ 734.565590 m 0.0003 99 | 5/11
7 h-m-p 0.0205 0.1339 0.6791 CYCCC 734.458288 4 0.0373 120 | 5/11
8 h-m-p 0.2554 8.0000 0.0993 ---------------.. | 5/11
9 h-m-p 0.0000 0.0007 21.6147 ++YYC 734.426662 2 0.0001 177 | 5/11
10 h-m-p 0.0002 0.0096 11.9536 ++YCYYYCYYYY 733.208733 10 0.0088 205 | 5/11
11 h-m-p 0.0019 0.0093 1.3860 YYYC 733.201300 3 0.0016 222 | 5/11
12 h-m-p 0.0489 8.0000 0.0455 ++++ 733.008469 m 8.0000 238 | 5/11
13 h-m-p 1.6000 8.0000 0.0191 YC 733.006999 1 1.1074 259 | 5/11
14 h-m-p 0.3779 8.0000 0.0561 ++C 732.990919 0 6.0743 281 | 5/11
15 h-m-p 1.0730 5.3652 0.1136 YCC 732.984892 2 1.6699 304 | 5/11
16 h-m-p 0.5035 2.5177 0.1667 +
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+ 732.979110 m 2.5177 324
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32666) = 1.113370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32641) = 1.113519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 5/11
17 h-m-p 0.0000 0.0000 0.3150
h-m-p: 3.39698994e-18 1.69849497e-17 3.14951879e-01 732.979110
..
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32666) = 1.113370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32641) = 1.113519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 5/11
18 h-m-p 0.0104 5.2032 3.3410
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113571e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113476e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113453e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
C 732.978902 0 0.0000 364
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152317e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
| 5/11
19 h-m-p 0.0112 5.6012 0.1642
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113689e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.114416e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.117330e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.178047e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.130097e-160 2000 rounds
C 732.972584 0 0.7169 381
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32666) = 1.129782e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32641) = 1.129933e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.129858e-160 2000 rounds
| 5/11
20 h-m-p 0.0546 0.2731 0.0129
QuantileBeta(0.15, 0.00500, 2.32653) = 1.126715e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.116550e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+ 732.971993 m 0.2731 401
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32666) = 1.113370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32641) = 1.113519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 5/11
21 h-m-p -0.0000 -0.0000 0.0297
h-m-p: -0.00000000e+00 -0.00000000e+00 2.96911121e-02 732.971993
..
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32666) = 1.113370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32641) = 1.113519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 5/11
22 h-m-p 0.0160 8.0000 5.9622
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113548e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113471e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113451e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
C 732.971430 1 0.0000 442
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152315e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113444e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 6/11
23 h-m-p 0.0160 8.0000 0.0232
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
+ 732.969301 m 8.0000 459
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152315e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32665) = 1.113371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32640) = 1.113520e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113445e-160 2000 rounds
| 6/11
24 h-m-p 1.6000 8.0000 0.0607
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
C 732.968598 1 3.5197 479
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152316e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32665) = 1.113371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32640) = 1.113520e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
| 6/11
25 h-m-p 0.8858 4.4290 0.0902
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
C 732.968076 1 2.2694 500
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152316e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32665) = 1.113372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32640) = 1.113521e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
| 6/11
26 h-m-p 0.3580 1.7902 0.1088
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
+ 732.967822 m 1.7902 519
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152316e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32665) = 1.113372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32640) = 1.113521e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113446e-160 2000 rounds
| 7/11
27 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
Y 732.967818 0 1.1977 538
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.152317e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32665) = 1.113372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32640) = 1.113521e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
| 7/11
28 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
N 732.967818 0 0.0001 562
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
Out..
lnL = -732.967818
563 lfun, 6756 eigenQcodon, 37158 P(t)
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -737.647465 S = -736.469701 -1.981234
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:16
did 20 / 54 patterns 0:16
did 30 / 54 patterns 0:16
did 40 / 54 patterns 0:16
did 50 / 54 patterns 0:16
did 54 / 54 patterns 0:16
QuantileBeta(0.15, 0.00500, 2.32653) = 1.113447e-160 2000 rounds
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
NC_011896_1_WP_010907463_1_10_MLBR_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
NC_002677_1_NP_301138_1_10_ppiA MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK
**************************************************
NC_011896_1_WP_010907463_1_10_MLBR_RS00060 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
NC_002677_1_NP_301138_1_10_ppiA EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE
**************************************************
NC_011896_1_WP_010907463_1_10_MLBR_RS00060 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
NC_002677_1_NP_301138_1_10_ppiA FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP
*********.****************************************
NC_011896_1_WP_010907463_1_10_MLBR_RS00060 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
NC_002677_1_NP_301138_1_10_ppiA DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
********************************
>NC_011896_1_WP_010907463_1_10_MLBR_RS00060 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT >NC_002677_1_NP_301138_1_10_ppiA ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT >NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT >NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT >NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAACCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT >NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 ATGGCACACTGTGATTTTGTGACCAACAGCCTTATTCAGAATGCCACTGC CACGTTACACACCAACCGCGGCGACATCAAAGTCGCCCTGTTCGGAAACC ACGTGCCCAAGACTGTCGCCAACTTCGTTGGGCTGGCGCAAGGCACCAAG GAGTACTCGACGCAAAACGCGTCAGGTGGTCCTTCCGGCCCGTTCTACGA TGGGGCGGTTTTTCATCGGGTGATTCAAGGCTTCATGATTCAGGGTGGGG ATCCAACCGGGACAGGTCGTGGCGGCCCAGGCTATAAGTTCGCCGATGAA TTCCACCCTGAGCTTCAGTTCGACAAATCCTACCTGCTAGCGATGGCCAA TGCGGGCCCGGGTACTAACGGTTCTCAGTTCTTCATCACCGTAGGCGAGA CTCCACACCTGAATCGGCGACACACGATCTTTGGCGAAGTGACCGACCCT GACTCGCAGAAGGTCGTCGATGCGATTTCGACGACAGCTACCGATGGCAA CGACCGGCCTACCGAACCGGTTGTGATTGACTCGATCACAATTTCT
>NC_011896_1_WP_010907463_1_10_MLBR_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS >NC_002677_1_NP_301138_1_10_ppiA MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS >NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS >NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS >NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKPYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS >NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060 MAHCDFVTNSLIQNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTK EYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADE FHPELQFDKSYLLAMANAGPGTNGSQFFITVGETPHLNRRHTIFGEVTDP DSQKVVDAISTTATDGNDRPTEPVVIDSITIS
#NEXUS
[ID: 9256654698]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907463_1_10_MLBR_RS00060
NC_002677_1_NP_301138_1_10_ppiA
NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020
NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880
NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060
NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907463_1_10_MLBR_RS00060,
2 NC_002677_1_NP_301138_1_10_ppiA,
3 NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020,
4 NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880,
5 NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060,
6 NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06152732,2:0.06524445,3:0.06265419,4:0.0622372,5:0.06394272,6:0.1079007);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06152732,2:0.06524445,3:0.06265419,4:0.0622372,5:0.06394272,6:0.1079007);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -765.70 -769.99
2 -765.74 -769.30
--------------------------------------
TOTAL -765.72 -769.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ppiA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883036 0.090199 0.368067 1.486511 0.845293 1501.00 1501.00 1.000
r(A<->C){all} 0.150130 0.017608 0.000006 0.423978 0.112863 173.96 242.20 1.000
r(A<->G){all} 0.180099 0.023202 0.000088 0.481754 0.138199 130.82 200.50 1.012
r(A<->T){all} 0.150158 0.016189 0.000069 0.402082 0.117084 249.00 274.13 1.002
r(C<->G){all} 0.150459 0.017880 0.000016 0.417932 0.113251 224.49 235.60 1.000
r(C<->T){all} 0.207208 0.024505 0.000606 0.517668 0.173692 218.12 249.15 1.002
r(G<->T){all} 0.161946 0.019084 0.000214 0.450698 0.124604 270.70 301.15 1.000
pi(A){all} 0.224166 0.000315 0.192079 0.260853 0.223866 1355.70 1379.46 1.000
pi(C){all} 0.298174 0.000374 0.258319 0.334109 0.298114 1036.86 1066.35 1.000
pi(G){all} 0.264194 0.000336 0.227610 0.299611 0.263546 1184.50 1258.32 1.000
pi(T){all} 0.213467 0.000293 0.181259 0.247553 0.213126 1401.42 1438.21 1.000
alpha{1,2} 0.331018 0.160755 0.000219 1.094400 0.200225 680.09 997.18 1.000
alpha{3} 0.415117 0.238101 0.000130 1.361331 0.242220 1098.05 1227.22 1.000
pinvar{all} 0.993718 0.000026 0.983385 0.999838 0.995067 1192.02 1337.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ppiA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 182
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 9 9 9 9 9 9 | TCC 1 1 1 1 1 2 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 1 | CAC 6 6 6 6 6 6 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 3 3 3 3 3 3 | CAG 5 5 5 5 5 5 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 8 8 8 8 8 8 | AAC 7 7 7 7 7 7 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 4 4 4 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 6 6 6 6 6 6
GTC 4 4 4 4 4 4 | GCC 6 6 6 6 6 6 | GAC 6 6 6 6 6 6 | GGC 11 11 11 11 11 11
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 5 5 5 5 5 5 | GCG 6 6 6 6 6 6 | GAG 3 3 3 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907463_1_10_MLBR_RS00060
position 1: T:0.14286 C:0.21978 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21245 C:0.29670 A:0.22527 G:0.26557
#2: NC_002677_1_NP_301138_1_10_ppiA
position 1: T:0.14286 C:0.21978 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21245 C:0.29670 A:0.22527 G:0.26557
#3: NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020
position 1: T:0.14286 C:0.21978 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21245 C:0.29670 A:0.22527 G:0.26557
#4: NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880
position 1: T:0.14286 C:0.21978 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21245 C:0.29670 A:0.22527 G:0.26557
#5: NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060
position 1: T:0.14286 C:0.21978 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21245 C:0.29670 A:0.22527 G:0.26557
#6: NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060
position 1: T:0.14835 C:0.21429 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21429 C:0.29487 A:0.22527 G:0.26557
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6
TTC 54 | TCC 7 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 24 | His H CAT 6 | Arg R CGT 6
CTC 0 | CCC 11 | CAC 36 | CGC 6
CTA 6 | CCA 18 | Gln Q CAA 18 | CGA 6
CTG 24 | CCG 18 | CAG 30 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 0
ATC 24 | ACC 48 | AAC 42 | AGC 6
ATA 0 | ACA 18 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 24 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 36
GTC 24 | GCC 36 | GAC 36 | GGC 66
GTA 6 | GCA 6 | Glu E GAA 18 | GGA 6
GTG 30 | GCG 36 | GAG 18 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14377 C:0.21886 A:0.26923 G:0.36813
position 2: T:0.25275 C:0.29121 A:0.29121 G:0.16484
position 3: T:0.24176 C:0.37912 A:0.11538 G:0.26374
Average T:0.21276 C:0.29640 A:0.22527 G:0.26557
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -732.967682 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005547 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005567
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005547);
(NC_011896_1_WP_010907463_1_10_MLBR_RS00060: 0.000004, NC_002677_1_NP_301138_1_10_ppiA: 0.000004, NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020: 0.000004, NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880: 0.000004, NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060: 0.000004, NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060: 0.005547);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 373.6 172.4 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 373.6 172.4 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 373.6 172.4 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 373.6 172.4 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 373.6 172.4 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 373.6 172.4 999.0000 0.0027 0.0000 1.0 0.0
tree length for dN: 0.0027
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -733.341772 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005572 951.428624 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005592
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005572);
(NC_011896_1_WP_010907463_1_10_MLBR_RS00060: 0.000004, NC_002677_1_NP_301138_1_10_ppiA: 0.000004, NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020: 0.000004, NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880: 0.000004, NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060: 0.000004, NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060: 0.005572);
Detailed output identifying parameters
kappa (ts/tv) = 951.42862
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 373.6 172.4 1.0000 0.0019 0.0019 0.7 0.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -732.967827 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005547 951.434980 0.000000 0.010735 0.000001 951.467436
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005567
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005547);
(NC_011896_1_WP_010907463_1_10_MLBR_RS00060: 0.000004, NC_002677_1_NP_301138_1_10_ppiA: 0.000004, NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020: 0.000004, NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880: 0.000004, NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060: 0.000004, NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060: 0.005547);
Detailed output identifying parameters
kappa (ts/tv) = 951.43498
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.01074 0.98926
w: 0.00000 1.00000 951.46744
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 373.6 172.4 941.2640 0.0000 0.0000 0.0 0.0
7..2 0.000 373.6 172.4 941.2640 0.0000 0.0000 0.0 0.0
7..3 0.000 373.6 172.4 941.2640 0.0000 0.0000 0.0 0.0
7..4 0.000 373.6 172.4 941.2640 0.0000 0.0000 0.0 0.0
7..5 0.000 373.6 172.4 941.2640 0.0000 0.0000 0.0 0.0
7..6 0.006 373.6 172.4 941.2640 0.0027 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907463_1_10_MLBR_RS00060)
Pr(w>1) post mean +- SE for w
1 M 0.989* 941.186
2 A 0.989* 941.235
3 H 0.989* 941.220
4 C 0.989* 941.236
5 D 0.989* 941.214
6 F 0.989* 941.229
7 V 0.989* 941.196
8 T 0.989* 941.166
9 N 0.989* 941.179
10 S 0.989* 941.186
11 L 0.989* 941.228
12 I 0.989* 941.203
13 Q 0.989* 941.250
14 N 0.989* 941.210
15 A 0.989* 941.168
16 T 0.989* 941.202
17 A 0.989* 941.168
18 T 0.989* 941.196
19 L 0.989* 941.257
20 H 0.989* 941.220
21 T 0.989* 941.166
22 N 0.989* 941.179
23 R 0.989* 941.215
24 G 0.989* 941.179
25 D 0.989* 941.186
26 I 0.989* 941.168
27 K 0.989* 941.238
28 V 0.989* 941.166
29 A 0.989* 941.168
30 L 0.989* 941.239
31 F 0.989* 941.210
32 G 0.989* 941.238
33 N 0.989* 941.179
34 H 0.989* 941.220
35 V 0.989* 941.196
36 P 0.989* 941.210
37 K 0.989* 941.205
38 T 0.989* 941.202
39 V 0.989* 941.166
40 A 0.989* 941.168
41 N 0.989* 941.179
42 F 0.989* 941.210
43 V 0.989* 941.202
44 G 0.989* 941.205
45 L 0.989* 941.239
46 A 0.989* 941.198
47 Q 0.989* 941.258
48 G 0.989* 941.179
49 T 0.989* 941.166
50 K 0.989* 941.205
51 E 0.989* 941.210
52 Y 0.989* 941.215
53 S 0.989* 941.225
54 T 0.989* 941.196
55 Q 0.989* 941.258
56 N 0.989* 941.179
57 A 0.989* 941.198
58 S 0.989* 941.247
59 G 0.989* 941.210
60 G 0.989* 941.210
61 P 0.989* 941.229
62 S 0.989* 941.208
63 G 0.989* 941.179
64 P 0.989* 941.226
65 F 0.989* 941.210
66 Y 0.989* 941.215
67 D 0.989* 941.214
68 G 0.989* 941.205
69 A 0.989* 941.198
70 V 0.989* 941.202
71 F 0.989* 941.229
72 H 0.989* 941.236
73 R 0.989* 941.230
74 V 0.989* 941.196
75 I 0.989* 941.203
76 Q 0.989* 941.258
77 G 0.989* 941.179
78 F 0.989* 941.210
79 M 0.989* 941.186
80 I 0.989* 941.203
81 Q 0.989* 941.250
82 G 0.989* 941.210
83 G 0.989* 941.205
84 D 0.989* 941.214
85 P 0.989* 941.247
86 T 0.989* 941.166
87 G 0.989* 941.205
88 T 0.989* 941.234
89 G 0.989* 941.210
90 R 0.989* 941.233
91 G 0.989* 941.179
92 G 0.989* 941.179
93 P 0.989* 941.247
94 G 0.989* 941.179
95 Y 0.989* 941.233
96 K 0.989* 941.205
97 F 0.989* 941.210
98 A 0.989* 941.168
99 D 0.989* 941.214
100 E 0.989* 941.240
101 F 0.989* 941.210
102 H 0.989* 941.220
103 P 0.989* 941.229
104 E 0.989* 941.210
105 L 0.989* 941.228
106 Q 0.989* 941.250
107 F 0.989* 941.210
108 D 0.989* 941.186
109 K 0.989* 941.238
110 P 1.000** 951.457
111 Y 0.989* 941.215
112 L 0.989* 941.239
113 L 0.989* 941.253
114 A 0.989* 941.198
115 M 0.989* 941.186
116 A 0.989* 941.168
117 N 0.989* 941.210
118 A 0.989* 941.198
119 G 0.989* 941.179
120 P 0.989* 941.226
121 G 0.989* 941.210
122 T 0.989* 941.202
123 N 0.989* 941.179
124 G 0.989* 941.210
125 S 0.989* 941.228
126 Q 0.989* 941.250
127 F 0.989* 941.210
128 F 0.989* 941.210
129 I 0.989* 941.168
130 T 0.989* 941.166
131 V 0.989* 941.234
132 G 0.989* 941.179
133 E 0.989* 941.210
134 T 0.989* 941.202
135 P 0.989* 941.247
136 H 0.989* 941.220
137 L 0.989* 941.239
138 N 0.989* 941.210
139 R 0.989* 941.230
140 R 0.989* 941.253
141 H 0.989* 941.220
142 T 0.989* 941.196
143 I 0.989* 941.168
144 F 0.989* 941.229
145 G 0.989* 941.179
146 E 0.989* 941.240
147 V 0.989* 941.196
148 T 0.989* 941.166
149 D 0.989* 941.186
150 P 0.989* 941.229
151 D 0.989* 941.186
152 S 0.989* 941.225
153 Q 0.989* 941.250
154 K 0.989* 941.205
155 V 0.989* 941.166
156 V 0.989* 941.166
157 D 0.989* 941.214
158 A 0.989* 941.198
159 I 0.989* 941.203
160 S 0.989* 941.225
161 T 0.989* 941.196
162 T 0.989* 941.234
163 A 0.989* 941.203
164 T 0.989* 941.166
165 D 0.989* 941.214
166 G 0.989* 941.179
167 N 0.989* 941.179
168 D 0.989* 941.186
169 R 0.989* 941.230
170 P 0.989* 941.229
171 T 0.989* 941.166
172 E 0.989* 941.240
173 P 0.989* 941.226
174 V 0.989* 941.202
175 V 0.989* 941.196
176 I 0.989* 941.203
177 D 0.989* 941.186
178 S 0.989* 941.225
179 I 0.989* 941.168
180 T 0.989* 941.234
181 I 0.989* 941.203
182 S 0.989* 941.228
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907463_1_10_MLBR_RS00060)
Pr(w>1) post mean +- SE for w
110 P 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -733.341773 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005572 951.435001 2.528009 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005592
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005572);
(NC_011896_1_WP_010907463_1_10_MLBR_RS00060: 0.000004, NC_002677_1_NP_301138_1_10_ppiA: 0.000004, NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020: 0.000004, NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880: 0.000004, NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060: 0.000004, NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060: 0.005572);
Detailed output identifying parameters
kappa (ts/tv) = 951.43500
Parameters in M7 (beta):
p = 2.52801 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 373.6 172.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 373.6 172.4 1.0000 0.0019 0.0019 0.7 0.3
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -732.967818 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005547 951.435706 0.000010 0.005000 2.326527 951.438765
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005567
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005547);
(NC_011896_1_WP_010907463_1_10_MLBR_RS00060: 0.000004, NC_002677_1_NP_301138_1_10_ppiA: 0.000004, NZ_LVXE01000010_1_WP_010907463_1_275_A3216_RS05020: 0.000004, NZ_LYPH01000099_1_WP_010907463_1_2876_A8144_RS13880: 0.000004, NZ_CP029543_1_WP_010907463_1_10_DIJ64_RS00060: 0.000004, NZ_AP014567_1_WP_119607854_1_10_JK2ML_RS00060: 0.005547);
Detailed output identifying parameters
kappa (ts/tv) = 951.43571
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.32653
(p1 = 0.99999) w = 951.43876
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 951.43876
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 373.6 172.4 951.4293 0.0000 0.0000 0.0 0.0
7..2 0.000 373.6 172.4 951.4293 0.0000 0.0000 0.0 0.0
7..3 0.000 373.6 172.4 951.4293 0.0000 0.0000 0.0 0.0
7..4 0.000 373.6 172.4 951.4293 0.0000 0.0000 0.0 0.0
7..5 0.000 373.6 172.4 951.4293 0.0000 0.0000 0.0 0.0
7..6 0.006 373.6 172.4 951.4293 0.0027 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907463_1_10_MLBR_RS00060)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.429
2 A 1.000** 951.429
3 H 1.000** 951.429
4 C 1.000** 951.429
5 D 1.000** 951.429
6 F 1.000** 951.429
7 V 1.000** 951.429
8 T 1.000** 951.429
9 N 1.000** 951.429
10 S 1.000** 951.429
11 L 1.000** 951.429
12 I 1.000** 951.429
13 Q 1.000** 951.429
14 N 1.000** 951.429
15 A 1.000** 951.429
16 T 1.000** 951.429
17 A 1.000** 951.429
18 T 1.000** 951.429
19 L 1.000** 951.429
20 H 1.000** 951.429
21 T 1.000** 951.429
22 N 1.000** 951.429
23 R 1.000** 951.429
24 G 1.000** 951.429
25 D 1.000** 951.429
26 I 1.000** 951.429
27 K 1.000** 951.429
28 V 1.000** 951.429
29 A 1.000** 951.429
30 L 1.000** 951.429
31 F 1.000** 951.429
32 G 1.000** 951.429
33 N 1.000** 951.429
34 H 1.000** 951.429
35 V 1.000** 951.429
36 P 1.000** 951.429
37 K 1.000** 951.429
38 T 1.000** 951.429
39 V 1.000** 951.429
40 A 1.000** 951.429
41 N 1.000** 951.429
42 F 1.000** 951.429
43 V 1.000** 951.429
44 G 1.000** 951.429
45 L 1.000** 951.429
46 A 1.000** 951.429
47 Q 1.000** 951.429
48 G 1.000** 951.429
49 T 1.000** 951.429
50 K 1.000** 951.429
51 E 1.000** 951.429
52 Y 1.000** 951.429
53 S 1.000** 951.429
54 T 1.000** 951.429
55 Q 1.000** 951.429
56 N 1.000** 951.429
57 A 1.000** 951.429
58 S 1.000** 951.429
59 G 1.000** 951.429
60 G 1.000** 951.429
61 P 1.000** 951.429
62 S 1.000** 951.429
63 G 1.000** 951.429
64 P 1.000** 951.429
65 F 1.000** 951.429
66 Y 1.000** 951.429
67 D 1.000** 951.429
68 G 1.000** 951.429
69 A 1.000** 951.429
70 V 1.000** 951.429
71 F 1.000** 951.429
72 H 1.000** 951.429
73 R 1.000** 951.429
74 V 1.000** 951.429
75 I 1.000** 951.429
76 Q 1.000** 951.429
77 G 1.000** 951.429
78 F 1.000** 951.429
79 M 1.000** 951.429
80 I 1.000** 951.429
81 Q 1.000** 951.429
82 G 1.000** 951.429
83 G 1.000** 951.429
84 D 1.000** 951.429
85 P 1.000** 951.429
86 T 1.000** 951.429
87 G 1.000** 951.429
88 T 1.000** 951.429
89 G 1.000** 951.429
90 R 1.000** 951.429
91 G 1.000** 951.429
92 G 1.000** 951.429
93 P 1.000** 951.429
94 G 1.000** 951.429
95 Y 1.000** 951.429
96 K 1.000** 951.429
97 F 1.000** 951.429
98 A 1.000** 951.429
99 D 1.000** 951.429
100 E 1.000** 951.429
101 F 1.000** 951.429
102 H 1.000** 951.429
103 P 1.000** 951.429
104 E 1.000** 951.429
105 L 1.000** 951.429
106 Q 1.000** 951.429
107 F 1.000** 951.429
108 D 1.000** 951.429
109 K 1.000** 951.429
110 P 1.000** 951.439
111 Y 1.000** 951.429
112 L 1.000** 951.429
113 L 1.000** 951.429
114 A 1.000** 951.429
115 M 1.000** 951.429
116 A 1.000** 951.429
117 N 1.000** 951.429
118 A 1.000** 951.429
119 G 1.000** 951.429
120 P 1.000** 951.429
121 G 1.000** 951.429
122 T 1.000** 951.429
123 N 1.000** 951.429
124 G 1.000** 951.429
125 S 1.000** 951.429
126 Q 1.000** 951.429
127 F 1.000** 951.429
128 F 1.000** 951.429
129 I 1.000** 951.429
130 T 1.000** 951.429
131 V 1.000** 951.429
132 G 1.000** 951.429
133 E 1.000** 951.429
134 T 1.000** 951.429
135 P 1.000** 951.429
136 H 1.000** 951.429
137 L 1.000** 951.429
138 N 1.000** 951.429
139 R 1.000** 951.429
140 R 1.000** 951.429
141 H 1.000** 951.429
142 T 1.000** 951.429
143 I 1.000** 951.429
144 F 1.000** 951.429
145 G 1.000** 951.429
146 E 1.000** 951.429
147 V 1.000** 951.429
148 T 1.000** 951.429
149 D 1.000** 951.429
150 P 1.000** 951.429
151 D 1.000** 951.429
152 S 1.000** 951.429
153 Q 1.000** 951.429
154 K 1.000** 951.429
155 V 1.000** 951.429
156 V 1.000** 951.429
157 D 1.000** 951.429
158 A 1.000** 951.429
159 I 1.000** 951.429
160 S 1.000** 951.429
161 T 1.000** 951.429
162 T 1.000** 951.429
163 A 1.000** 951.429
164 T 1.000** 951.429
165 D 1.000** 951.429
166 G 1.000** 951.429
167 N 1.000** 951.429
168 D 1.000** 951.429
169 R 1.000** 951.429
170 P 1.000** 951.429
171 T 1.000** 951.429
172 E 1.000** 951.429
173 P 1.000** 951.429
174 V 1.000** 951.429
175 V 1.000** 951.429
176 I 1.000** 951.429
177 D 1.000** 951.429
178 S 1.000** 951.429
179 I 1.000** 951.429
180 T 1.000** 951.429
181 I 1.000** 951.429
182 S 1.000** 951.429
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907463_1_10_MLBR_RS00060)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 A 0.639 4.860 +- 3.856
3 H 0.639 4.860 +- 3.856
4 C 0.639 4.860 +- 3.856
5 D 0.639 4.860 +- 3.856
6 F 0.639 4.860 +- 3.856
7 V 0.639 4.860 +- 3.856
8 T 0.639 4.860 +- 3.856
9 N 0.639 4.860 +- 3.856
10 S 0.639 4.860 +- 3.856
11 L 0.639 4.860 +- 3.856
12 I 0.639 4.860 +- 3.856
13 Q 0.639 4.860 +- 3.856
14 N 0.639 4.860 +- 3.856
15 A 0.639 4.860 +- 3.856
16 T 0.639 4.860 +- 3.856
17 A 0.639 4.860 +- 3.856
18 T 0.639 4.860 +- 3.856
19 L 0.639 4.860 +- 3.856
20 H 0.639 4.860 +- 3.856
21 T 0.639 4.860 +- 3.856
22 N 0.639 4.860 +- 3.856
23 R 0.639 4.860 +- 3.856
24 G 0.639 4.860 +- 3.856
25 D 0.639 4.860 +- 3.856
26 I 0.639 4.860 +- 3.856
27 K 0.639 4.860 +- 3.856
28 V 0.639 4.860 +- 3.856
29 A 0.639 4.860 +- 3.856
30 L 0.639 4.860 +- 3.856
31 F 0.639 4.860 +- 3.856
32 G 0.639 4.860 +- 3.856
33 N 0.639 4.860 +- 3.856
34 H 0.639 4.860 +- 3.856
35 V 0.639 4.860 +- 3.856
36 P 0.639 4.860 +- 3.856
37 K 0.639 4.860 +- 3.856
38 T 0.639 4.860 +- 3.856
39 V 0.639 4.860 +- 3.856
40 A 0.639 4.860 +- 3.856
41 N 0.639 4.860 +- 3.856
42 F 0.639 4.860 +- 3.856
43 V 0.639 4.860 +- 3.856
44 G 0.639 4.860 +- 3.856
45 L 0.639 4.860 +- 3.856
46 A 0.639 4.860 +- 3.856
47 Q 0.639 4.860 +- 3.856
48 G 0.639 4.860 +- 3.856
49 T 0.639 4.860 +- 3.856
50 K 0.639 4.860 +- 3.856
51 E 0.639 4.860 +- 3.856
52 Y 0.639 4.860 +- 3.856
53 S 0.639 4.860 +- 3.856
54 T 0.639 4.860 +- 3.856
55 Q 0.639 4.860 +- 3.856
56 N 0.639 4.860 +- 3.856
57 A 0.639 4.860 +- 3.856
58 S 0.639 4.860 +- 3.856
59 G 0.639 4.860 +- 3.856
60 G 0.639 4.860 +- 3.856
61 P 0.639 4.860 +- 3.856
62 S 0.639 4.860 +- 3.856
63 G 0.639 4.860 +- 3.856
64 P 0.639 4.860 +- 3.856
65 F 0.639 4.860 +- 3.856
66 Y 0.639 4.860 +- 3.856
67 D 0.639 4.860 +- 3.856
68 G 0.639 4.860 +- 3.856
69 A 0.639 4.860 +- 3.856
70 V 0.639 4.860 +- 3.856
71 F 0.639 4.860 +- 3.856
72 H 0.639 4.860 +- 3.856
73 R 0.639 4.860 +- 3.856
74 V 0.639 4.860 +- 3.856
75 I 0.639 4.860 +- 3.856
76 Q 0.639 4.860 +- 3.856
77 G 0.639 4.860 +- 3.856
78 F 0.639 4.860 +- 3.856
79 M 0.639 4.860 +- 3.856
80 I 0.639 4.860 +- 3.856
81 Q 0.639 4.860 +- 3.856
82 G 0.639 4.860 +- 3.856
83 G 0.639 4.860 +- 3.856
84 D 0.639 4.860 +- 3.856
85 P 0.639 4.860 +- 3.856
86 T 0.639 4.860 +- 3.856
87 G 0.639 4.860 +- 3.856
88 T 0.639 4.860 +- 3.856
89 G 0.639 4.860 +- 3.856
90 R 0.639 4.860 +- 3.856
91 G 0.639 4.860 +- 3.856
92 G 0.639 4.860 +- 3.856
93 P 0.639 4.860 +- 3.856
94 G 0.639 4.860 +- 3.856
95 Y 0.639 4.860 +- 3.856
96 K 0.639 4.860 +- 3.856
97 F 0.639 4.860 +- 3.856
98 A 0.639 4.860 +- 3.856
99 D 0.639 4.860 +- 3.856
100 E 0.639 4.860 +- 3.856
101 F 0.639 4.860 +- 3.856
102 H 0.639 4.860 +- 3.856
103 P 0.639 4.860 +- 3.856
104 E 0.639 4.860 +- 3.856
105 L 0.639 4.860 +- 3.856
106 Q 0.639 4.860 +- 3.856
107 F 0.639 4.860 +- 3.856
108 D 0.639 4.860 +- 3.856
109 K 0.639 4.860 +- 3.856
110 P 0.923 6.858 +- 3.003
111 Y 0.639 4.860 +- 3.856
112 L 0.639 4.860 +- 3.856
113 L 0.639 4.860 +- 3.856
114 A 0.639 4.860 +- 3.856
115 M 0.639 4.860 +- 3.856
116 A 0.639 4.860 +- 3.856
117 N 0.639 4.860 +- 3.856
118 A 0.639 4.860 +- 3.856
119 G 0.639 4.860 +- 3.856
120 P 0.639 4.860 +- 3.856
121 G 0.639 4.860 +- 3.856
122 T 0.639 4.860 +- 3.856
123 N 0.639 4.860 +- 3.856
124 G 0.639 4.860 +- 3.856
125 S 0.639 4.860 +- 3.856
126 Q 0.639 4.860 +- 3.856
127 F 0.639 4.860 +- 3.856
128 F 0.639 4.860 +- 3.856
129 I 0.639 4.860 +- 3.856
130 T 0.639 4.860 +- 3.856
131 V 0.639 4.860 +- 3.856
132 G 0.639 4.860 +- 3.856
133 E 0.639 4.860 +- 3.856
134 T 0.639 4.860 +- 3.856
135 P 0.639 4.860 +- 3.856
136 H 0.639 4.860 +- 3.856
137 L 0.639 4.860 +- 3.856
138 N 0.639 4.860 +- 3.856
139 R 0.639 4.860 +- 3.856
140 R 0.639 4.860 +- 3.856
141 H 0.639 4.860 +- 3.856
142 T 0.639 4.860 +- 3.856
143 I 0.639 4.860 +- 3.856
144 F 0.639 4.860 +- 3.856
145 G 0.639 4.860 +- 3.856
146 E 0.639 4.860 +- 3.856
147 V 0.639 4.860 +- 3.856
148 T 0.639 4.860 +- 3.856
149 D 0.639 4.860 +- 3.856
150 P 0.639 4.860 +- 3.856
151 D 0.639 4.860 +- 3.856
152 S 0.639 4.860 +- 3.856
153 Q 0.639 4.860 +- 3.856
154 K 0.639 4.860 +- 3.856
155 V 0.639 4.860 +- 3.856
156 V 0.639 4.860 +- 3.856
157 D 0.639 4.860 +- 3.856
158 A 0.639 4.860 +- 3.856
159 I 0.639 4.860 +- 3.856
160 S 0.639 4.860 +- 3.856
161 T 0.639 4.860 +- 3.856
162 T 0.639 4.860 +- 3.856
163 A 0.639 4.860 +- 3.856
164 T 0.639 4.860 +- 3.856
165 D 0.639 4.860 +- 3.856
166 G 0.639 4.860 +- 3.856
167 N 0.639 4.860 +- 3.856
168 D 0.639 4.860 +- 3.856
169 R 0.639 4.860 +- 3.856
170 P 0.639 4.860 +- 3.856
171 T 0.639 4.860 +- 3.856
172 E 0.639 4.860 +- 3.856
173 P 0.639 4.860 +- 3.856
174 V 0.639 4.860 +- 3.856
175 V 0.639 4.860 +- 3.856
176 I 0.639 4.860 +- 3.856
177 D 0.639 4.860 +- 3.856
178 S 0.639 4.860 +- 3.856
179 I 0.639 4.860 +- 3.856
180 T 0.639 4.860 +- 3.856
181 I 0.639 4.860 +- 3.856
182 S 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:16
Model 1: NearlyNeutral -733.341772 Model 2: PositiveSelection -732.967827 Model 0: one-ratio -732.967682 Model 7: beta -733.341773 Model 8: beta&w>1 -732.967818 Model 0 vs 1 0.7481800000000476 Model 2 vs 1 0.7478899999998703 Model 8 vs 7 0.7479100000000471
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
