--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:33:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/proB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1493.95         -1498.55
2      -1494.03         -1498.42
--------------------------------------
TOTAL    -1493.99         -1498.49
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.866988    0.088123    0.363793    1.473930    0.841334   1306.77   1320.39    1.000
r(A<->C){all}   0.132168    0.014106    0.000016    0.370677    0.098995    256.67    261.14    1.000
r(A<->G){all}   0.214529    0.022980    0.000081    0.511109    0.189259    237.71    251.48    1.010
r(A<->T){all}   0.133308    0.015110    0.000129    0.389175    0.093756    239.97    257.76    1.000
r(C<->G){all}   0.175152    0.023509    0.000073    0.501848    0.134423    156.92    160.07    1.001
r(C<->T){all}   0.169677    0.023051    0.000039    0.498164    0.128767    137.66    201.23    1.003
r(G<->T){all}   0.175166    0.021999    0.000084    0.467123    0.136352    173.79    275.23    1.003
pi(A){all}      0.160775    0.000122    0.138773    0.181061    0.160360   1238.86   1320.24    1.001
pi(C){all}      0.288678    0.000189    0.262591    0.315430    0.288606   1119.54   1194.87    1.000
pi(G){all}      0.345195    0.000212    0.316857    0.373100    0.345044   1002.12   1121.16    1.000
pi(T){all}      0.205352    0.000150    0.182048    0.230087    0.205571   1272.42   1330.88    1.000
alpha{1,2}      0.197868    0.046888    0.000584    0.505165    0.139619   1314.51   1407.76    1.000
alpha{3}        0.413519    0.229481    0.000249    1.368128    0.238222   1157.14   1234.21    1.000
pinvar{all}     0.996695    0.000007    0.991531    0.999915    0.997400   1265.60   1374.03    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1439.119915
Model 2: PositiveSelection	-1438.75032
Model 0: one-ratio	-1438.749673
Model 7: beta	-1439.119925
Model 8: beta&w>1	-1438.749812


Model 0 vs 1	0.740483999999924

Model 2 vs 1	0.7391899999997804

Model 8 vs 7	0.7402259999998932
>C1
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C2
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C3
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C4
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C5
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C6
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNGNDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=367 

C1              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C2              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C3              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C4              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C5              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C6              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
                **************************************************

C1              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C2              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C3              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C4              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C5              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C6              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
                **************************************************

C1              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C2              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C3              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C4              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C5              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C6              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNGNDTVATNE
                ***************************************** ********

C1              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C2              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C3              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C4              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C5              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C6              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
                **************************************************

C1              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C2              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C3              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C4              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C5              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C6              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
                **************************************************

C1              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C2              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C3              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C4              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C5              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C6              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
                **************************************************

C1              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C2              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C3              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C4              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C5              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C6              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
                **************************************************

C1              PCELRRPAVHADDLVSI
C2              PCELRRPAVHADDLVSI
C3              PCELRRPAVHADDLVSI
C4              PCELRRPAVHADDLVSI
C5              PCELRRPAVHADDLVSI
C6              PCELRRPAVHADDLVSI
                *****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  367 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  367 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11010]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [11010]--->[11010]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.525 Mb, Max= 30.941 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C2              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C3              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C4              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C5              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
C6              VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
                **************************************************

C1              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C2              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C3              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C4              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C5              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
C6              DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
                **************************************************

C1              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C2              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C3              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C4              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C5              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
C6              YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNGNDTVATNE
                ***************************************** ********

C1              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C2              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C3              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C4              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C5              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
C6              IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
                **************************************************

C1              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C2              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C3              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C4              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C5              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
C6              SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
                **************************************************

C1              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C2              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C3              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C4              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C5              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
C6              DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
                **************************************************

C1              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C2              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C3              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C4              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C5              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
C6              AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
                **************************************************

C1              PCELRRPAVHADDLVSI
C2              PCELRRPAVHADDLVSI
C3              PCELRRPAVHADDLVSI
C4              PCELRRPAVHADDLVSI
C5              PCELRRPAVHADDLVSI
C6              PCELRRPAVHADDLVSI
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.73 C1	 C6	 99.73
TOP	    5    0	 99.73 C6	 C1	 99.73
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.73 C2	 C6	 99.73
TOP	    5    1	 99.73 C6	 C2	 99.73
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.73 C3	 C6	 99.73
TOP	    5    2	 99.73 C6	 C3	 99.73
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.73 C4	 C6	 99.73
TOP	    5    3	 99.73 C6	 C4	 99.73
BOT	    4    5	 99.73 C5	 C6	 99.73
TOP	    5    4	 99.73 C6	 C5	 99.73
AVG	 0	 C1	  *	 99.95
AVG	 1	 C2	  *	 99.95
AVG	 2	 C3	  *	 99.95
AVG	 3	 C4	  *	 99.95
AVG	 4	 C5	  *	 99.95
AVG	 5	 C6	  *	 99.73
TOT	 TOT	  *	 99.91
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
C2              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
C3              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
C4              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
C5              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
C6              GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
                **************************************************

C1              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
C2              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
C3              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
C4              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
C5              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
C6              GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
                **************************************************

C1              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
C2              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
C3              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
C4              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
C5              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
C6              GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
                **************************************************

C1              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
C2              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
C3              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
C4              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
C5              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
C6              GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
                **************************************************

C1              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
C2              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
C3              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
C4              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
C5              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
C6              TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
                **************************************************

C1              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
C2              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
C3              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
C4              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
C5              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
C6              GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
                **************************************************

C1              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
C2              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
C3              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
C4              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
C5              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
C6              TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
                **************************************************

C1              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
C2              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
C3              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
C4              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
C5              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
C6              GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
                **************************************************

C1              TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
C2              TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
C3              TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
C4              TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
C5              TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
C6              TTCATGCGGTGGCAATCGTCAACGGGAACGACACCGTGGCTACCAACGAG
                ************************.*************************

C1              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
C2              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
C3              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
C4              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
C5              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
C6              ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
                **************************************************

C1              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
C2              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
C3              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
C4              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
C5              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
C6              CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
                **************************************************

C1              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
C2              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
C3              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
C4              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
C5              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
C6              CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
                **************************************************

C1              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
C2              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
C3              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
C4              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
C5              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
C6              TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
                **************************************************

C1              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
C2              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
C3              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
C4              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
C5              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
C6              AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
                **************************************************

C1              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
C2              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
C3              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
C4              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
C5              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
C6              GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
                **************************************************

C1              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
C2              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
C3              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
C4              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
C5              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
C6              GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
                **************************************************

C1              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
C2              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
C3              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
C4              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
C5              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
C6              CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
                **************************************************

C1              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
C2              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
C3              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
C4              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
C5              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
C6              TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
                **************************************************

C1              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
C2              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
C3              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
C4              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
C5              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
C6              GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
                **************************************************

C1              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
C2              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
C3              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
C4              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
C5              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
C6              GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
                **************************************************

C1              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
C2              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
C3              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
C4              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
C5              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
C6              ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
                **************************************************

C1              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
C2              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
C3              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
C4              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
C5              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
C6              CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
                **************************************************

C1              T
C2              T
C3              T
C4              T
C5              T
C6              T
                *



>C1
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C2
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C3
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C4
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C5
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGAGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C6
GTGAGTGTACATCGCGACGCGATCAGAGCTGCTCGGAGTTTGGTCGTCAA
GGTTGGGACTAACGCGCTCACCACATCATCCGGAGTATTCGATTCTAGCC
GGCTGGCCAGACTGGTCGACGCGATAGAGGCGCGGATGAAGGCCGGTACT
GATGTGGTCATCGTGTCTTCGGGTGCCATCGCCGCCGGCATTGAGCCGCT
TGGATTATCACTTCGCCCAAAAGATTTAGCGACCAAGCAGGCTGCGGCCA
GCGTCGGGCAAGTTGCGCTGGTAAACTCCTGGAGCGCAGCGTTCGCCCGG
TATGGTCGCGCGGTAGGGCAGGTGCTGCTGACTGCGCAGGATATTTCGAT
GCGAGTCCAACACACTAACGCTCAACGCACCCTAGACCGGTTGCGGGCGC
TTCATGCGGTGGCAATCGTCAACGGGAACGACACCGTGGCTACCAACGAG
ATCCGGTTCGGTGACAACGATCGGCTTTCGGCGGTGGTGGCGCACCTGGT
CGGTGCCGAAGCTTTAGTGCTGCTATCCGATATCAATGGTCTCTACGATT
CGGATCCGCGGAAGAATACCGGTGCGCGCTTTGTTCCTGAGGTGACCGGG
TCGGCAGATCTCGATGGTGTGGTCGCCAGCCGGGGCAGTTCCTTGGGAAC
AGGTGGAATGGTATCGAAGATGTCATCGGCGCTACTGGCCGCCGACGCGG
GTGTGCCGGTGCTGCTGGCTGCCGCGGCTGACGCCGCGACTGCGCTTACC
GATGCCTCGGTTGGCACAGTGTTCGCCGCGCGGCCGGACCGGATGTCCGC
CCGGCGGTTCTGGTTGCGCTATGCTGCCGACTCTGTCGGCTCGTTAACCC
TCGACGAGGGTGCGGTATGGGCAGTGGTACAGCAACGCCGCTCGCTGCTG
GCCGCGGGTATCACCGCGGTTTCGGGCCGGTTCTACGGCGGTGATGTCGT
GGAATTGCGCGGACCAGACGCGACGATGGTCGCCCGCGGTGTGGTCGCCT
ATGACGCGACCGAGCTGGCCGCCATGATGGGCCGGTCGACCTCGGAGCTG
CCTTGCGAGCTGCGCCGGCCCGCGGTGCACGCCGACGACCTCGTCTCGAT
T
>C1
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C2
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C3
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C4
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C5
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI
>C6
VSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGT
DVVIVSSGAIAAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFAR
YGRAVGQVLLTAQDISMRVQHTNAQRTLDRLRALHAVAIVNGNDTVATNE
IRFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRKNTGARFVPEVTG
SADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLAAAADAATALT
DASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSEL
PCELRRPAVHADDLVSI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1101 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579786338
      Setting output file names to "/data/10res/proB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1605507352
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9693919032
      Seed = 1850854138
      Swapseed = 1579786338
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2467.493639 -- -24.965149
         Chain 2 -- -2467.493639 -- -24.965149
         Chain 3 -- -2467.493639 -- -24.965149
         Chain 4 -- -2467.493639 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2467.493496 -- -24.965149
         Chain 2 -- -2467.493496 -- -24.965149
         Chain 3 -- -2467.493198 -- -24.965149
         Chain 4 -- -2467.492089 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2467.494] (-2467.494) (-2467.494) (-2467.494) * [-2467.493] (-2467.493) (-2467.493) (-2467.492) 
        500 -- (-1523.253) (-1509.765) (-1525.248) [-1529.155] * (-1496.113) (-1512.650) [-1504.985] (-1499.992) -- 0:00:00
       1000 -- (-1501.173) [-1497.723] (-1501.090) (-1505.057) * [-1496.816] (-1506.765) (-1502.052) (-1500.407) -- 0:00:00
       1500 -- (-1512.548) (-1500.359) [-1497.721] (-1497.994) * (-1500.690) [-1491.516] (-1499.106) (-1500.845) -- 0:00:00
       2000 -- (-1503.514) (-1501.435) [-1496.810] (-1500.700) * (-1507.366) [-1495.824] (-1494.487) (-1494.904) -- 0:00:00
       2500 -- [-1498.288] (-1506.318) (-1498.310) (-1499.104) * (-1499.491) (-1500.774) (-1499.369) [-1496.207] -- 0:00:00
       3000 -- (-1501.378) (-1500.356) [-1498.929] (-1498.225) * [-1496.797] (-1504.160) (-1500.371) (-1501.677) -- 0:00:00
       3500 -- (-1500.033) (-1502.657) (-1511.273) [-1494.841] * (-1501.992) (-1498.223) (-1505.951) [-1496.332] -- 0:00:00
       4000 -- [-1497.923] (-1502.447) (-1501.276) (-1501.431) * [-1500.694] (-1500.491) (-1503.661) (-1496.903) -- 0:00:00
       4500 -- (-1497.129) (-1493.429) (-1497.197) [-1499.440] * (-1498.594) (-1497.807) (-1499.162) [-1501.691] -- 0:00:00
       5000 -- [-1492.989] (-1504.003) (-1495.538) (-1497.858) * (-1493.854) (-1504.533) (-1503.237) [-1498.400] -- 0:03:19

      Average standard deviation of split frequencies: 0.074826

       5500 -- [-1501.525] (-1503.834) (-1502.003) (-1495.618) * (-1505.390) [-1501.709] (-1498.963) (-1501.480) -- 0:03:00
       6000 -- (-1502.883) [-1503.264] (-1497.485) (-1502.793) * [-1492.806] (-1502.607) (-1496.973) (-1494.190) -- 0:02:45
       6500 -- (-1507.337) (-1500.562) (-1514.303) [-1499.597] * (-1499.688) (-1496.916) [-1497.629] (-1500.906) -- 0:02:32
       7000 -- (-1511.213) [-1506.083] (-1498.105) (-1500.413) * (-1502.722) (-1497.126) [-1501.904] (-1494.679) -- 0:02:21
       7500 -- (-1498.684) (-1504.382) (-1503.246) [-1493.604] * (-1498.633) (-1505.460) [-1501.153] (-1498.979) -- 0:02:12
       8000 -- (-1498.277) [-1494.623] (-1496.766) (-1504.836) * (-1498.039) (-1499.758) [-1497.859] (-1499.198) -- 0:02:04
       8500 -- (-1500.521) (-1507.555) (-1500.369) [-1494.037] * (-1495.409) (-1497.462) (-1495.504) [-1495.839] -- 0:01:56
       9000 -- (-1507.002) (-1500.929) (-1504.369) [-1497.978] * (-1497.074) (-1494.600) (-1505.477) [-1499.151] -- 0:01:50
       9500 -- [-1498.859] (-1494.543) (-1495.957) (-1503.079) * [-1498.509] (-1500.237) (-1504.363) (-1499.483) -- 0:01:44
      10000 -- (-1500.275) (-1498.900) (-1501.577) [-1502.755] * (-1499.062) (-1501.157) (-1506.902) [-1499.815] -- 0:01:39

      Average standard deviation of split frequencies: 0.053033

      10500 -- [-1496.942] (-1501.720) (-1497.121) (-1497.635) * (-1499.794) (-1500.911) [-1496.636] (-1497.272) -- 0:01:34
      11000 -- (-1494.772) (-1499.971) [-1493.852] (-1500.967) * (-1504.118) (-1509.076) [-1496.167] (-1500.808) -- 0:01:29
      11500 -- [-1500.240] (-1498.634) (-1499.986) (-1503.775) * (-1504.221) [-1496.470] (-1497.714) (-1495.225) -- 0:01:25
      12000 -- [-1496.317] (-1500.856) (-1500.232) (-1494.588) * (-1500.587) (-1501.853) [-1497.786] (-1498.150) -- 0:01:22
      12500 -- [-1496.001] (-1498.486) (-1496.279) (-1497.454) * (-1497.682) (-1508.199) [-1493.900] (-1503.811) -- 0:01:19
      13000 -- [-1496.820] (-1497.602) (-1499.897) (-1505.551) * (-1496.899) (-1497.451) [-1493.562] (-1501.494) -- 0:01:15
      13500 -- (-1502.090) (-1499.281) [-1497.244] (-1503.644) * (-1499.137) (-1501.052) (-1495.732) [-1495.836] -- 0:01:13
      14000 -- (-1499.823) (-1499.822) [-1494.323] (-1496.564) * (-1497.160) [-1494.530] (-1496.793) (-1496.058) -- 0:01:10
      14500 -- (-1503.738) (-1502.438) (-1508.145) [-1496.635] * (-1502.323) [-1497.781] (-1503.527) (-1498.066) -- 0:01:07
      15000 -- [-1498.805] (-1504.104) (-1504.808) (-1497.370) * [-1498.683] (-1495.747) (-1499.310) (-1493.669) -- 0:01:05

      Average standard deviation of split frequencies: 0.043493

      15500 -- (-1499.131) (-1502.362) [-1496.342] (-1495.672) * (-1500.212) (-1497.805) [-1497.678] (-1495.690) -- 0:01:03
      16000 -- [-1496.089] (-1498.926) (-1505.643) (-1505.092) * (-1500.152) [-1492.543] (-1498.326) (-1501.862) -- 0:01:01
      16500 -- (-1502.105) (-1501.372) (-1503.608) [-1496.080] * (-1499.980) [-1504.715] (-1500.307) (-1495.668) -- 0:00:59
      17000 -- (-1501.771) (-1501.946) (-1499.294) [-1496.562] * (-1499.700) [-1497.487] (-1503.675) (-1497.165) -- 0:00:57
      17500 -- (-1500.884) (-1497.408) [-1494.977] (-1500.002) * (-1501.549) [-1492.783] (-1501.660) (-1495.750) -- 0:00:56
      18000 -- (-1507.532) (-1500.010) [-1505.463] (-1500.797) * (-1501.640) [-1496.715] (-1501.081) (-1496.934) -- 0:00:54
      18500 -- (-1502.833) (-1495.121) (-1497.137) [-1497.660] * (-1497.733) (-1501.050) (-1507.988) [-1506.962] -- 0:00:53
      19000 -- (-1511.956) (-1495.883) [-1499.513] (-1494.329) * (-1497.148) (-1499.459) [-1500.622] (-1496.967) -- 0:00:51
      19500 -- [-1499.160] (-1496.238) (-1501.205) (-1501.093) * (-1497.661) [-1496.738] (-1497.597) (-1497.487) -- 0:01:40
      20000 -- (-1493.762) (-1498.803) (-1499.709) [-1499.773] * (-1497.899) [-1495.940] (-1502.214) (-1498.571) -- 0:01:38

      Average standard deviation of split frequencies: 0.041058

      20500 -- (-1501.047) (-1503.944) [-1502.375] (-1495.896) * (-1498.029) [-1494.327] (-1494.398) (-1502.946) -- 0:01:35
      21000 -- (-1508.114) [-1497.405] (-1499.552) (-1497.684) * (-1503.743) (-1510.940) (-1510.633) [-1494.961] -- 0:01:33
      21500 -- (-1499.551) (-1496.946) [-1501.989] (-1501.067) * (-1503.360) (-1499.778) (-1494.109) [-1498.189] -- 0:01:31
      22000 -- (-1497.647) (-1497.632) (-1496.254) [-1498.815] * (-1498.696) [-1497.516] (-1495.700) (-1503.592) -- 0:01:28
      22500 -- (-1502.216) [-1495.485] (-1503.749) (-1505.378) * (-1496.297) (-1502.214) [-1494.606] (-1494.023) -- 0:01:26
      23000 -- (-1498.931) (-1495.999) (-1502.010) [-1497.790] * (-1499.562) [-1497.640] (-1494.892) (-1498.583) -- 0:01:24
      23500 -- (-1499.738) (-1494.476) [-1500.560] (-1496.474) * (-1500.588) [-1500.653] (-1495.575) (-1504.237) -- 0:01:23
      24000 -- (-1500.454) (-1500.374) (-1502.586) [-1497.733] * (-1504.771) [-1499.942] (-1495.231) (-1498.068) -- 0:01:21
      24500 -- [-1495.529] (-1498.844) (-1502.170) (-1506.512) * (-1498.180) (-1498.175) (-1496.358) [-1495.860] -- 0:01:19
      25000 -- (-1497.139) (-1497.208) (-1502.473) [-1505.558] * (-1498.472) (-1507.071) [-1498.713] (-1497.029) -- 0:01:18

      Average standard deviation of split frequencies: 0.032141

      25500 -- (-1502.009) (-1494.991) (-1493.941) [-1497.122] * (-1497.861) [-1502.565] (-1496.160) (-1497.636) -- 0:01:16
      26000 -- (-1501.842) [-1493.314] (-1500.829) (-1503.645) * (-1503.110) (-1503.129) (-1497.784) [-1492.937] -- 0:01:14
      26500 -- [-1498.637] (-1495.507) (-1501.296) (-1499.620) * (-1503.027) (-1494.528) (-1498.296) [-1496.251] -- 0:01:13
      27000 -- [-1503.316] (-1496.594) (-1502.123) (-1497.100) * (-1497.334) [-1503.010] (-1502.052) (-1499.889) -- 0:01:12
      27500 -- (-1503.827) (-1500.102) (-1504.241) [-1496.202] * (-1497.809) (-1504.042) [-1497.714] (-1504.149) -- 0:01:10
      28000 -- (-1503.941) (-1500.298) [-1495.767] (-1508.267) * [-1496.715] (-1499.453) (-1496.848) (-1501.776) -- 0:01:09
      28500 -- (-1505.946) (-1498.807) [-1498.188] (-1497.355) * (-1495.451) (-1499.868) (-1503.449) [-1498.331] -- 0:01:08
      29000 -- (-1498.470) [-1495.701] (-1503.892) (-1495.731) * (-1498.357) (-1502.491) (-1498.042) [-1500.618] -- 0:01:06
      29500 -- [-1499.422] (-1495.039) (-1497.517) (-1494.211) * (-1498.433) (-1500.662) (-1498.930) [-1499.409] -- 0:01:05
      30000 -- (-1496.668) [-1494.897] (-1502.614) (-1511.132) * (-1497.255) (-1499.564) (-1500.593) [-1495.026] -- 0:01:04

      Average standard deviation of split frequencies: 0.035635

      30500 -- (-1504.200) (-1495.024) [-1498.906] (-1504.928) * (-1496.642) (-1500.433) [-1496.695] (-1496.100) -- 0:01:03
      31000 -- (-1498.819) (-1496.063) [-1494.925] (-1494.704) * [-1496.867] (-1495.807) (-1497.789) (-1495.816) -- 0:01:02
      31500 -- (-1501.084) (-1495.401) [-1502.348] (-1498.282) * [-1495.249] (-1499.342) (-1504.087) (-1495.730) -- 0:01:01
      32000 -- (-1501.695) (-1497.569) [-1498.129] (-1498.571) * (-1495.533) [-1497.480] (-1495.609) (-1499.327) -- 0:01:00
      32500 -- (-1499.598) (-1494.054) (-1494.451) [-1499.404] * (-1494.696) (-1497.009) (-1495.548) [-1496.903] -- 0:00:59
      33000 -- (-1501.260) (-1500.398) (-1497.216) [-1498.495] * [-1496.383] (-1500.887) (-1498.071) (-1507.292) -- 0:00:58
      33500 -- [-1496.232] (-1499.864) (-1497.712) (-1500.952) * [-1498.159] (-1499.396) (-1496.221) (-1508.840) -- 0:00:57
      34000 -- (-1505.146) (-1499.442) (-1496.101) [-1496.532] * (-1494.781) (-1495.550) (-1497.040) [-1499.022] -- 0:01:25
      34500 -- (-1505.009) (-1494.411) (-1500.631) [-1500.170] * (-1493.259) (-1494.636) (-1495.738) [-1498.703] -- 0:01:23
      35000 -- (-1502.714) (-1492.854) (-1498.303) [-1492.304] * (-1493.728) (-1492.897) (-1495.914) [-1495.092] -- 0:01:22

      Average standard deviation of split frequencies: 0.036665

      35500 -- (-1505.338) (-1492.859) (-1497.617) [-1501.219] * [-1496.764] (-1498.249) (-1498.413) (-1497.966) -- 0:01:21
      36000 -- (-1505.197) (-1493.853) (-1499.857) [-1494.025] * (-1497.311) [-1496.583] (-1497.072) (-1506.679) -- 0:01:20
      36500 -- (-1502.879) (-1494.797) [-1495.766] (-1503.540) * (-1499.811) [-1495.288] (-1498.157) (-1491.341) -- 0:01:19
      37000 -- (-1494.433) (-1494.756) [-1498.424] (-1502.283) * [-1501.872] (-1496.061) (-1499.838) (-1505.356) -- 0:01:18
      37500 -- (-1509.056) (-1496.820) [-1496.977] (-1496.830) * (-1495.516) (-1495.729) (-1497.292) [-1499.941] -- 0:01:17
      38000 -- [-1497.605] (-1498.544) (-1501.418) (-1497.649) * (-1493.493) (-1498.740) (-1499.353) [-1494.165] -- 0:01:15
      38500 -- (-1498.273) (-1501.172) [-1495.645] (-1505.479) * (-1493.836) [-1494.033] (-1496.772) (-1492.581) -- 0:01:14
      39000 -- (-1499.281) [-1495.726] (-1499.476) (-1498.547) * (-1494.875) (-1495.470) (-1498.032) [-1497.576] -- 0:01:13
      39500 -- (-1497.434) [-1493.870] (-1495.622) (-1496.970) * (-1496.487) (-1497.522) (-1499.837) [-1498.445] -- 0:01:12
      40000 -- (-1497.643) [-1492.709] (-1498.179) (-1502.643) * [-1495.566] (-1494.911) (-1496.181) (-1506.505) -- 0:01:12

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-1499.264) (-1493.254) [-1494.551] (-1500.852) * (-1499.525) [-1494.599] (-1495.016) (-1496.920) -- 0:01:11
      41000 -- [-1508.467] (-1496.154) (-1503.004) (-1496.659) * (-1494.939) (-1493.539) (-1496.261) [-1500.247] -- 0:01:10
      41500 -- [-1494.803] (-1499.164) (-1501.936) (-1498.265) * (-1496.882) (-1498.432) (-1498.194) [-1497.783] -- 0:01:09
      42000 -- (-1509.745) (-1499.042) [-1494.435] (-1501.124) * (-1499.596) [-1493.702] (-1499.213) (-1498.030) -- 0:01:08
      42500 -- [-1504.731] (-1497.940) (-1503.220) (-1506.171) * (-1504.066) (-1493.490) (-1498.288) [-1500.825] -- 0:01:07
      43000 -- (-1498.250) (-1494.947) [-1500.327] (-1502.296) * (-1495.187) [-1494.549] (-1497.777) (-1501.247) -- 0:01:06
      43500 -- (-1507.915) (-1495.787) (-1501.644) [-1496.167] * [-1493.813] (-1499.565) (-1496.242) (-1502.548) -- 0:01:05
      44000 -- (-1500.623) (-1500.552) [-1501.693] (-1497.468) * (-1497.092) (-1496.302) [-1497.752] (-1502.247) -- 0:01:05
      44500 -- (-1501.895) (-1499.495) [-1499.389] (-1501.405) * (-1496.180) [-1496.296] (-1495.373) (-1497.520) -- 0:01:04
      45000 -- (-1504.040) (-1493.893) (-1494.487) [-1495.835] * (-1495.175) (-1498.776) (-1495.898) [-1495.336] -- 0:01:03

      Average standard deviation of split frequencies: 0.028881

      45500 -- [-1497.384] (-1494.934) (-1502.391) (-1508.511) * (-1493.162) (-1499.817) [-1493.557] (-1496.779) -- 0:01:02
      46000 -- (-1500.528) [-1495.308] (-1495.566) (-1502.683) * (-1497.922) [-1498.082] (-1498.073) (-1504.633) -- 0:01:02
      46500 -- (-1504.652) (-1494.750) [-1492.483] (-1496.239) * (-1497.044) (-1498.808) (-1498.915) [-1498.417] -- 0:01:01
      47000 -- (-1499.361) [-1493.325] (-1505.067) (-1498.265) * [-1493.917] (-1496.921) (-1495.246) (-1500.521) -- 0:01:00
      47500 -- [-1499.514] (-1494.344) (-1500.689) (-1494.272) * (-1494.252) (-1498.055) [-1495.795] (-1495.584) -- 0:01:00
      48000 -- (-1496.061) (-1495.707) (-1498.401) [-1495.704] * (-1494.248) (-1498.715) (-1494.859) [-1492.912] -- 0:00:59
      48500 -- [-1494.757] (-1501.566) (-1502.330) (-1497.712) * (-1492.522) [-1495.448] (-1494.438) (-1501.742) -- 0:01:18
      49000 -- [-1495.409] (-1500.222) (-1496.513) (-1492.508) * (-1497.952) (-1494.658) (-1498.132) [-1498.324] -- 0:01:17
      49500 -- (-1498.541) (-1497.486) [-1499.183] (-1496.650) * (-1494.893) (-1495.537) [-1492.916] (-1496.855) -- 0:01:16
      50000 -- (-1497.604) (-1496.906) (-1495.657) [-1496.633] * (-1498.372) (-1497.548) (-1492.819) [-1497.705] -- 0:01:16

      Average standard deviation of split frequencies: 0.031013

      50500 -- [-1497.467] (-1498.461) (-1496.108) (-1493.289) * (-1498.976) (-1495.948) [-1497.718] (-1499.671) -- 0:01:15
      51000 -- [-1505.955] (-1496.045) (-1498.103) (-1496.654) * [-1497.975] (-1496.123) (-1495.809) (-1497.202) -- 0:01:14
      51500 -- (-1496.179) (-1497.529) (-1500.469) [-1493.954] * (-1497.280) [-1493.853] (-1493.664) (-1503.730) -- 0:01:13
      52000 -- (-1496.005) (-1494.624) [-1497.159] (-1493.818) * (-1503.306) (-1492.382) [-1497.766] (-1502.029) -- 0:01:12
      52500 -- (-1499.832) (-1492.215) (-1505.637) [-1492.997] * (-1501.351) [-1498.166] (-1495.425) (-1499.487) -- 0:01:12
      53000 -- (-1503.238) (-1497.769) (-1501.912) [-1493.654] * (-1496.451) (-1495.129) (-1494.626) [-1497.800] -- 0:01:11
      53500 -- [-1499.946] (-1497.013) (-1496.838) (-1493.794) * [-1494.525] (-1494.279) (-1494.139) (-1497.750) -- 0:01:10
      54000 -- [-1499.435] (-1498.615) (-1495.434) (-1493.592) * (-1497.275) (-1494.901) (-1495.933) [-1503.420] -- 0:01:10
      54500 -- [-1494.369] (-1494.910) (-1501.309) (-1493.222) * (-1492.533) (-1496.749) (-1496.215) [-1498.033] -- 0:01:09
      55000 -- (-1496.656) (-1496.441) [-1499.945] (-1497.991) * (-1492.852) (-1497.519) [-1492.959] (-1494.761) -- 0:01:08

      Average standard deviation of split frequencies: 0.030570

      55500 -- (-1512.003) [-1495.977] (-1500.628) (-1493.392) * (-1495.059) (-1499.512) [-1493.786] (-1494.640) -- 0:01:08
      56000 -- (-1498.952) (-1494.641) [-1493.943] (-1492.732) * (-1493.957) (-1498.383) (-1494.933) [-1501.532] -- 0:01:07
      56500 -- (-1495.616) (-1497.006) (-1500.854) [-1492.711] * (-1493.461) (-1500.178) (-1495.214) [-1497.676] -- 0:01:06
      57000 -- (-1496.074) (-1494.086) [-1502.585] (-1493.228) * (-1496.207) (-1496.035) (-1495.423) [-1495.713] -- 0:01:06
      57500 -- (-1495.348) (-1495.943) [-1495.845] (-1493.067) * [-1494.318] (-1495.904) (-1494.309) (-1502.119) -- 0:01:05
      58000 -- [-1498.020] (-1495.142) (-1502.130) (-1498.652) * (-1498.278) [-1493.856] (-1494.976) (-1507.840) -- 0:01:04
      58500 -- (-1497.488) (-1499.711) [-1496.723] (-1495.889) * (-1494.754) [-1492.791] (-1494.667) (-1498.660) -- 0:01:04
      59000 -- (-1496.331) (-1501.304) [-1498.663] (-1493.842) * (-1497.105) (-1505.565) [-1494.077] (-1497.200) -- 0:01:03
      59500 -- (-1498.019) (-1500.756) (-1495.788) [-1493.606] * (-1497.394) (-1499.135) (-1494.274) [-1498.184] -- 0:01:03
      60000 -- (-1495.298) (-1497.524) [-1494.932] (-1495.291) * (-1497.698) (-1503.071) (-1493.111) [-1502.079] -- 0:01:02

      Average standard deviation of split frequencies: 0.031082

      60500 -- (-1495.561) (-1499.335) (-1499.514) [-1495.818] * (-1494.741) (-1496.701) (-1493.275) [-1500.809] -- 0:01:02
      61000 -- (-1499.134) (-1498.072) [-1499.556] (-1495.485) * [-1493.922] (-1494.244) (-1494.843) (-1498.249) -- 0:01:01
      61500 -- (-1495.701) [-1497.210] (-1510.795) (-1495.607) * (-1494.015) (-1495.506) (-1496.487) [-1496.069] -- 0:01:01
      62000 -- [-1496.446] (-1507.499) (-1500.819) (-1495.826) * (-1494.894) (-1494.121) (-1496.206) [-1494.075] -- 0:01:00
      62500 -- (-1496.612) (-1500.480) [-1497.366] (-1496.548) * [-1496.821] (-1495.125) (-1494.112) (-1501.667) -- 0:01:15
      63000 -- [-1498.347] (-1501.882) (-1504.720) (-1495.315) * (-1494.366) (-1496.691) (-1497.424) [-1505.594] -- 0:01:14
      63500 -- (-1496.245) (-1501.269) [-1500.245] (-1493.999) * (-1493.485) (-1496.414) (-1495.859) [-1498.125] -- 0:01:13
      64000 -- (-1504.100) (-1497.660) (-1504.086) [-1494.517] * [-1493.783] (-1495.018) (-1500.252) (-1496.834) -- 0:01:13
      64500 -- (-1498.600) (-1497.388) (-1507.239) [-1498.720] * [-1493.099] (-1493.377) (-1499.064) (-1500.240) -- 0:01:12
      65000 -- (-1498.261) (-1496.158) [-1495.544] (-1494.826) * (-1494.107) (-1495.214) (-1495.210) [-1501.016] -- 0:01:11

      Average standard deviation of split frequencies: 0.033081

      65500 -- (-1497.590) (-1499.510) [-1501.504] (-1493.236) * (-1493.794) (-1492.934) (-1497.887) [-1497.162] -- 0:01:11
      66000 -- (-1498.984) (-1493.664) (-1495.551) [-1491.568] * (-1492.772) (-1494.929) (-1498.044) [-1501.212] -- 0:01:10
      66500 -- (-1494.678) [-1494.614] (-1504.886) (-1492.628) * (-1494.708) (-1492.430) [-1499.469] (-1495.401) -- 0:01:10
      67000 -- (-1495.149) (-1495.836) (-1502.652) [-1495.417] * (-1493.441) (-1494.474) [-1502.952] (-1511.537) -- 0:01:09
      67500 -- [-1494.657] (-1496.649) (-1506.899) (-1494.548) * [-1493.210] (-1497.585) (-1497.008) (-1501.707) -- 0:01:09
      68000 -- (-1496.984) (-1498.512) [-1511.824] (-1495.866) * (-1497.719) [-1499.000] (-1493.392) (-1513.126) -- 0:01:08
      68500 -- [-1495.255] (-1493.295) (-1496.488) (-1497.157) * (-1495.077) (-1495.770) [-1493.191] (-1498.177) -- 0:01:07
      69000 -- (-1497.302) (-1497.731) (-1497.193) [-1494.643] * (-1492.944) (-1498.763) (-1498.000) [-1493.545] -- 0:01:07
      69500 -- [-1493.887] (-1496.993) (-1495.467) (-1494.771) * [-1493.390] (-1497.175) (-1496.819) (-1499.064) -- 0:01:06
      70000 -- [-1497.900] (-1494.525) (-1494.004) (-1492.840) * (-1499.466) [-1492.266] (-1498.022) (-1505.201) -- 0:01:06

      Average standard deviation of split frequencies: 0.028589

      70500 -- (-1498.694) (-1496.092) (-1493.946) [-1494.244] * [-1497.073] (-1495.606) (-1497.913) (-1494.735) -- 0:01:05
      71000 -- (-1500.083) (-1496.367) [-1494.818] (-1496.201) * (-1497.213) [-1492.474] (-1497.691) (-1495.450) -- 0:01:05
      71500 -- (-1496.461) (-1492.730) (-1496.235) [-1494.564] * (-1493.671) (-1492.793) [-1494.805] (-1493.449) -- 0:01:04
      72000 -- (-1496.544) [-1493.039] (-1495.173) (-1493.429) * [-1495.570] (-1497.674) (-1494.557) (-1493.182) -- 0:01:04
      72500 -- (-1496.432) (-1494.738) [-1495.952] (-1498.415) * (-1493.213) [-1494.254] (-1496.175) (-1492.691) -- 0:01:03
      73000 -- (-1494.533) (-1493.376) [-1497.393] (-1494.397) * (-1495.038) [-1492.875] (-1497.945) (-1495.627) -- 0:01:03
      73500 -- [-1494.675] (-1495.299) (-1496.829) (-1493.409) * (-1494.633) [-1493.153] (-1501.745) (-1494.082) -- 0:01:03
      74000 -- (-1495.795) (-1496.063) (-1495.950) [-1495.504] * (-1497.181) (-1493.556) [-1494.752] (-1493.380) -- 0:01:02
      74500 -- (-1498.397) [-1494.634] (-1493.028) (-1495.695) * (-1496.244) [-1494.862] (-1494.369) (-1493.996) -- 0:01:02
      75000 -- [-1494.621] (-1493.359) (-1496.368) (-1497.385) * [-1498.016] (-1495.022) (-1497.288) (-1496.682) -- 0:01:01

      Average standard deviation of split frequencies: 0.031358

      75500 -- [-1497.628] (-1493.485) (-1493.300) (-1496.141) * [-1496.891] (-1493.457) (-1496.208) (-1494.969) -- 0:01:01
      76000 -- (-1496.704) [-1493.437] (-1492.745) (-1494.117) * (-1495.615) (-1498.112) [-1494.408] (-1498.139) -- 0:01:12
      76500 -- (-1496.177) (-1493.141) (-1499.411) [-1497.457] * (-1492.967) (-1498.402) [-1499.333] (-1497.709) -- 0:01:12
      77000 -- [-1497.718] (-1495.939) (-1492.705) (-1494.311) * (-1495.817) (-1498.780) [-1494.202] (-1492.733) -- 0:01:11
      77500 -- [-1495.163] (-1493.059) (-1497.711) (-1498.191) * (-1493.429) (-1496.539) [-1494.280] (-1494.917) -- 0:01:11
      78000 -- [-1494.792] (-1492.320) (-1493.547) (-1493.519) * [-1493.980] (-1495.760) (-1494.349) (-1494.035) -- 0:01:10
      78500 -- (-1498.225) [-1492.201] (-1497.248) (-1495.383) * (-1499.092) [-1498.855] (-1493.261) (-1493.846) -- 0:01:10
      79000 -- (-1498.619) [-1495.610] (-1492.573) (-1495.037) * (-1497.608) (-1498.534) [-1493.042] (-1494.178) -- 0:01:09
      79500 -- (-1496.553) (-1493.075) (-1495.233) [-1496.360] * (-1492.962) [-1495.623] (-1492.092) (-1493.530) -- 0:01:09
      80000 -- (-1493.937) [-1492.739] (-1493.204) (-1498.690) * (-1495.160) [-1498.569] (-1492.190) (-1499.910) -- 0:01:09

      Average standard deviation of split frequencies: 0.025323

      80500 -- [-1493.955] (-1491.809) (-1493.476) (-1503.365) * (-1498.439) [-1496.470] (-1492.777) (-1499.212) -- 0:01:08
      81000 -- (-1495.933) [-1494.415] (-1493.475) (-1497.329) * (-1495.419) (-1492.959) [-1492.359] (-1498.106) -- 0:01:08
      81500 -- (-1499.668) (-1494.088) (-1494.432) [-1492.876] * [-1494.195] (-1494.644) (-1495.912) (-1495.494) -- 0:01:07
      82000 -- (-1499.740) (-1492.566) (-1492.777) [-1495.674] * (-1499.261) (-1495.993) [-1496.100] (-1498.147) -- 0:01:07
      82500 -- (-1498.188) (-1492.758) [-1494.980] (-1495.385) * (-1499.923) (-1494.480) [-1493.898] (-1498.094) -- 0:01:06
      83000 -- [-1495.189] (-1494.695) (-1493.895) (-1496.340) * (-1495.446) (-1498.379) [-1493.234] (-1496.605) -- 0:01:06
      83500 -- (-1497.631) [-1499.335] (-1496.776) (-1498.186) * (-1494.486) (-1496.072) [-1495.044] (-1496.115) -- 0:01:05
      84000 -- [-1498.069] (-1496.323) (-1494.146) (-1496.695) * (-1496.326) [-1495.414] (-1493.840) (-1497.077) -- 0:01:05
      84500 -- [-1496.934] (-1494.690) (-1498.847) (-1498.687) * [-1492.882] (-1494.915) (-1493.694) (-1495.836) -- 0:01:05
      85000 -- (-1495.356) [-1491.867] (-1497.880) (-1495.926) * [-1493.552] (-1493.135) (-1492.900) (-1492.857) -- 0:01:04

      Average standard deviation of split frequencies: 0.025165

      85500 -- [-1496.606] (-1492.144) (-1498.124) (-1497.207) * [-1493.398] (-1496.884) (-1493.241) (-1493.221) -- 0:01:04
      86000 -- (-1502.629) (-1495.546) (-1496.557) [-1494.439] * [-1497.264] (-1496.145) (-1493.009) (-1493.684) -- 0:01:03
      86500 -- (-1496.968) (-1493.724) [-1493.134] (-1496.193) * (-1496.049) (-1495.759) [-1493.870] (-1499.343) -- 0:01:03
      87000 -- [-1496.543] (-1494.845) (-1496.059) (-1493.767) * [-1492.765] (-1495.683) (-1495.375) (-1503.838) -- 0:01:02
      87500 -- (-1498.088) (-1493.559) (-1496.617) [-1494.289] * (-1493.080) [-1493.041] (-1494.046) (-1501.665) -- 0:01:02
      88000 -- (-1499.933) [-1495.952] (-1495.022) (-1495.800) * [-1495.439] (-1497.078) (-1492.919) (-1494.566) -- 0:01:02
      88500 -- (-1496.570) (-1494.555) (-1497.191) [-1494.785] * (-1497.872) [-1492.743] (-1495.769) (-1496.014) -- 0:01:01
      89000 -- (-1495.595) (-1497.367) [-1499.508] (-1494.830) * (-1493.503) (-1493.631) [-1495.201] (-1494.637) -- 0:01:01
      89500 -- (-1501.968) [-1494.017] (-1494.501) (-1495.805) * (-1494.524) (-1492.567) (-1498.553) [-1498.415] -- 0:01:01
      90000 -- (-1494.671) (-1499.986) (-1496.613) [-1494.419] * (-1494.403) (-1502.018) (-1499.041) [-1495.258] -- 0:01:00

      Average standard deviation of split frequencies: 0.023917

      90500 -- (-1495.625) (-1494.776) [-1493.944] (-1498.064) * (-1495.865) (-1502.272) [-1494.101] (-1494.255) -- 0:01:00
      91000 -- [-1493.442] (-1495.834) (-1495.225) (-1497.836) * (-1497.098) (-1496.520) [-1495.394] (-1497.172) -- 0:01:09
      91500 -- (-1495.102) [-1496.228] (-1499.915) (-1496.955) * (-1499.792) [-1497.559] (-1497.277) (-1494.760) -- 0:01:09
      92000 -- (-1494.764) (-1495.968) (-1496.959) [-1500.005] * (-1499.557) (-1494.927) [-1496.540] (-1495.655) -- 0:01:09
      92500 -- [-1498.279] (-1495.705) (-1496.361) (-1500.368) * (-1497.024) (-1495.647) (-1494.804) [-1495.103] -- 0:01:08
      93000 -- [-1494.536] (-1494.181) (-1493.051) (-1501.149) * (-1494.607) (-1495.788) (-1496.409) [-1500.485] -- 0:01:08
      93500 -- (-1494.285) (-1496.566) [-1494.476] (-1497.923) * (-1496.453) [-1493.045] (-1495.390) (-1500.665) -- 0:01:07
      94000 -- (-1497.940) (-1496.736) (-1495.836) [-1496.730] * [-1495.280] (-1495.536) (-1494.066) (-1496.111) -- 0:01:07
      94500 -- [-1493.697] (-1495.048) (-1495.819) (-1499.164) * (-1494.790) (-1496.747) (-1495.525) [-1492.488] -- 0:01:07
      95000 -- (-1494.212) (-1493.627) [-1492.594] (-1495.086) * [-1494.488] (-1496.550) (-1495.815) (-1497.985) -- 0:01:06

      Average standard deviation of split frequencies: 0.025488

      95500 -- (-1497.668) (-1495.094) [-1496.581] (-1496.562) * (-1495.269) (-1495.942) [-1495.433] (-1499.100) -- 0:01:06
      96000 -- (-1496.771) (-1495.771) (-1495.677) [-1493.618] * [-1494.178] (-1494.780) (-1499.204) (-1494.905) -- 0:01:05
      96500 -- (-1493.799) (-1493.306) (-1495.458) [-1496.079] * (-1498.054) [-1493.682] (-1499.207) (-1498.744) -- 0:01:05
      97000 -- (-1494.009) (-1496.423) (-1494.352) [-1496.011] * [-1493.367] (-1496.824) (-1497.466) (-1492.879) -- 0:01:05
      97500 -- (-1494.434) (-1498.598) (-1493.060) [-1496.657] * (-1497.923) (-1495.741) (-1496.887) [-1495.912] -- 0:01:04
      98000 -- (-1496.082) (-1493.735) (-1492.896) [-1499.920] * (-1501.052) (-1495.521) (-1496.102) [-1496.045] -- 0:01:04
      98500 -- (-1497.188) (-1497.548) [-1494.431] (-1495.642) * (-1497.430) (-1494.334) (-1500.177) [-1494.208] -- 0:01:04
      99000 -- (-1496.162) (-1496.924) [-1496.956] (-1496.400) * (-1496.179) (-1494.726) [-1496.303] (-1493.877) -- 0:01:03
      99500 -- (-1495.142) [-1492.916] (-1497.465) (-1496.825) * (-1499.286) [-1496.176] (-1499.364) (-1493.775) -- 0:01:03
      100000 -- (-1493.586) (-1492.381) [-1494.185] (-1495.021) * (-1497.490) [-1495.772] (-1498.748) (-1495.317) -- 0:01:02

      Average standard deviation of split frequencies: 0.026016

      100500 -- (-1494.629) (-1496.564) (-1497.169) [-1495.651] * (-1501.557) (-1492.826) [-1493.540] (-1495.100) -- 0:01:02
      101000 -- [-1495.862] (-1493.244) (-1498.000) (-1492.778) * [-1501.911] (-1497.517) (-1495.930) (-1493.562) -- 0:01:02
      101500 -- (-1493.936) (-1496.154) (-1499.257) [-1493.368] * (-1498.183) (-1498.133) [-1498.663] (-1494.983) -- 0:01:01
      102000 -- [-1493.493] (-1495.921) (-1502.041) (-1497.148) * (-1497.024) (-1496.059) (-1498.792) [-1497.817] -- 0:01:01
      102500 -- (-1494.052) [-1498.958] (-1498.889) (-1492.614) * (-1492.927) (-1494.119) (-1497.099) [-1496.896] -- 0:01:01
      103000 -- (-1494.557) (-1494.066) (-1494.168) [-1494.068] * (-1493.684) [-1494.972] (-1500.404) (-1493.494) -- 0:01:00
      103500 -- (-1494.951) (-1493.179) (-1493.621) [-1493.934] * [-1496.337] (-1495.634) (-1499.680) (-1498.759) -- 0:01:00
      104000 -- (-1496.535) [-1494.411] (-1495.306) (-1496.218) * (-1494.160) (-1494.304) (-1494.825) [-1494.278] -- 0:01:00
      104500 -- (-1493.806) (-1495.119) [-1492.382] (-1494.392) * (-1496.530) (-1493.660) (-1496.582) [-1493.766] -- 0:00:59
      105000 -- (-1495.688) (-1497.290) (-1496.106) [-1494.619] * [-1495.445] (-1497.157) (-1493.858) (-1499.749) -- 0:00:59

      Average standard deviation of split frequencies: 0.025836

      105500 -- [-1498.144] (-1499.499) (-1497.537) (-1498.657) * (-1493.444) [-1494.912] (-1496.838) (-1496.812) -- 0:01:07
      106000 -- [-1493.794] (-1499.738) (-1493.351) (-1497.916) * [-1495.705] (-1498.064) (-1497.272) (-1495.454) -- 0:01:07
      106500 -- (-1495.143) [-1499.653] (-1500.260) (-1498.445) * (-1492.855) (-1496.047) (-1495.919) [-1495.088] -- 0:01:07
      107000 -- (-1495.348) (-1497.644) [-1497.665] (-1491.641) * (-1494.276) (-1495.138) (-1496.716) [-1492.726] -- 0:01:06
      107500 -- (-1495.529) (-1497.826) [-1493.591] (-1491.985) * (-1492.810) (-1495.084) (-1497.147) [-1492.213] -- 0:01:06
      108000 -- (-1495.864) (-1502.112) [-1492.450] (-1499.549) * [-1494.872] (-1497.722) (-1496.126) (-1498.685) -- 0:01:06
      108500 -- (-1496.388) (-1499.287) [-1496.325] (-1495.618) * [-1495.724] (-1497.544) (-1497.620) (-1497.643) -- 0:01:05
      109000 -- [-1496.285] (-1508.420) (-1493.052) (-1497.565) * (-1493.242) (-1497.371) (-1496.608) [-1493.018] -- 0:01:05
      109500 -- (-1493.963) [-1496.681] (-1496.886) (-1493.827) * (-1497.227) [-1495.045] (-1495.878) (-1493.440) -- 0:01:05
      110000 -- (-1495.025) (-1498.350) (-1497.748) [-1493.602] * (-1500.605) (-1498.455) (-1493.056) [-1492.742] -- 0:01:04

      Average standard deviation of split frequencies: 0.024493

      110500 -- (-1494.538) [-1495.259] (-1494.218) (-1496.913) * [-1496.756] (-1496.850) (-1494.741) (-1494.185) -- 0:01:04
      111000 -- (-1497.452) (-1497.975) [-1494.859] (-1492.511) * [-1498.358] (-1498.834) (-1496.072) (-1493.865) -- 0:01:04
      111500 -- (-1496.761) (-1494.961) (-1497.047) [-1496.085] * (-1493.233) (-1497.705) [-1497.496] (-1491.740) -- 0:01:03
      112000 -- (-1497.333) [-1496.835] (-1499.760) (-1496.057) * (-1497.259) [-1496.874] (-1499.654) (-1492.058) -- 0:01:03
      112500 -- (-1497.270) (-1494.454) (-1495.882) [-1494.749] * (-1497.868) (-1494.582) (-1493.125) [-1495.717] -- 0:01:03
      113000 -- [-1498.137] (-1494.828) (-1497.012) (-1498.396) * (-1495.462) (-1494.841) [-1494.600] (-1500.779) -- 0:01:02
      113500 -- (-1496.222) [-1496.297] (-1495.423) (-1492.478) * [-1494.039] (-1496.645) (-1494.523) (-1494.964) -- 0:01:02
      114000 -- (-1501.424) (-1497.171) (-1494.215) [-1493.498] * (-1498.834) (-1496.490) [-1496.455] (-1495.560) -- 0:01:02
      114500 -- (-1501.908) (-1495.607) (-1495.609) [-1492.786] * (-1495.287) [-1496.303] (-1494.399) (-1494.170) -- 0:01:01
      115000 -- (-1500.310) [-1495.566] (-1494.095) (-1492.222) * (-1494.392) (-1499.428) [-1493.932] (-1500.015) -- 0:01:01

      Average standard deviation of split frequencies: 0.022351

      115500 -- (-1495.712) [-1493.038] (-1493.536) (-1493.862) * (-1496.935) (-1497.362) [-1493.039] (-1493.879) -- 0:01:01
      116000 -- (-1497.575) (-1500.487) [-1495.673] (-1495.837) * (-1497.533) (-1495.351) (-1494.832) [-1493.793] -- 0:01:00
      116500 -- [-1502.890] (-1496.542) (-1495.972) (-1491.905) * (-1501.108) (-1497.081) (-1494.075) [-1495.019] -- 0:01:00
      117000 -- (-1497.240) [-1496.525] (-1497.711) (-1494.232) * (-1503.834) (-1496.054) (-1497.293) [-1493.024] -- 0:01:00
      117500 -- [-1498.692] (-1497.842) (-1493.355) (-1491.690) * (-1495.872) (-1494.691) (-1501.353) [-1494.073] -- 0:01:00
      118000 -- [-1496.391] (-1495.381) (-1493.652) (-1493.396) * (-1494.921) (-1495.429) (-1499.710) [-1495.619] -- 0:00:59
      118500 -- (-1499.024) (-1496.295) (-1494.048) [-1492.287] * (-1496.880) [-1494.716] (-1493.962) (-1494.882) -- 0:00:59
      119000 -- (-1497.639) (-1495.886) (-1494.060) [-1494.810] * (-1494.959) (-1498.276) (-1498.157) [-1499.022] -- 0:00:59
      119500 -- (-1499.012) (-1497.132) [-1493.796] (-1497.913) * (-1497.900) (-1495.753) [-1498.056] (-1495.093) -- 0:00:58
      120000 -- (-1494.928) (-1492.724) (-1498.352) [-1497.781] * [-1495.657] (-1493.103) (-1494.375) (-1495.138) -- 0:01:06

      Average standard deviation of split frequencies: 0.023223

      120500 -- [-1494.211] (-1496.345) (-1496.729) (-1494.101) * (-1497.523) [-1498.031] (-1496.052) (-1497.337) -- 0:01:05
      121000 -- (-1495.788) (-1498.974) (-1493.183) [-1493.712] * (-1497.469) (-1492.483) (-1494.189) [-1493.019] -- 0:01:05
      121500 -- (-1495.632) [-1496.564] (-1493.348) (-1494.705) * (-1494.910) (-1493.718) [-1495.297] (-1493.363) -- 0:01:05
      122000 -- (-1497.168) (-1495.510) (-1493.644) [-1497.059] * (-1496.300) (-1495.871) [-1494.900] (-1494.502) -- 0:01:04
      122500 -- (-1495.958) (-1494.395) (-1496.308) [-1495.998] * (-1496.108) [-1493.159] (-1495.241) (-1495.093) -- 0:01:04
      123000 -- (-1498.457) (-1494.740) [-1494.582] (-1496.659) * (-1500.890) [-1493.664] (-1493.106) (-1499.191) -- 0:01:04
      123500 -- (-1498.757) (-1494.973) [-1497.292] (-1492.974) * (-1495.372) [-1495.240] (-1497.758) (-1497.255) -- 0:01:03
      124000 -- (-1498.479) [-1491.867] (-1495.391) (-1495.322) * (-1495.621) (-1496.076) [-1495.441] (-1496.273) -- 0:01:03
      124500 -- (-1495.470) (-1497.965) [-1493.699] (-1492.690) * [-1493.599] (-1493.738) (-1499.880) (-1493.719) -- 0:01:03
      125000 -- (-1497.477) (-1498.305) (-1495.641) [-1493.022] * [-1493.670] (-1495.286) (-1499.331) (-1493.844) -- 0:01:03

      Average standard deviation of split frequencies: 0.022448

      125500 -- [-1495.585] (-1499.223) (-1498.419) (-1492.193) * (-1495.480) (-1494.034) [-1495.974] (-1493.221) -- 0:01:02
      126000 -- (-1495.335) (-1494.557) (-1498.103) [-1491.719] * (-1493.799) [-1492.415] (-1499.190) (-1494.971) -- 0:01:02
      126500 -- (-1494.740) (-1497.633) (-1497.393) [-1493.775] * (-1499.628) (-1493.287) (-1495.159) [-1494.359] -- 0:01:02
      127000 -- [-1497.474] (-1497.119) (-1496.081) (-1499.329) * (-1494.894) (-1492.674) (-1498.625) [-1492.875] -- 0:01:01
      127500 -- (-1498.678) [-1499.496] (-1495.732) (-1495.099) * [-1495.042] (-1493.963) (-1493.856) (-1495.504) -- 0:01:01
      128000 -- (-1495.914) (-1498.887) [-1495.433] (-1498.377) * (-1496.821) [-1495.078] (-1500.812) (-1495.654) -- 0:01:01
      128500 -- (-1501.402) (-1497.171) [-1493.793] (-1493.763) * (-1494.300) [-1493.575] (-1497.508) (-1496.309) -- 0:01:01
      129000 -- (-1500.532) [-1498.051] (-1496.756) (-1495.581) * (-1494.367) (-1493.252) (-1498.927) [-1499.972] -- 0:01:00
      129500 -- [-1493.503] (-1497.293) (-1493.294) (-1494.978) * (-1496.757) (-1494.232) (-1498.269) [-1496.234] -- 0:01:00
      130000 -- (-1494.327) (-1495.380) (-1493.843) [-1495.979] * (-1492.400) (-1498.085) [-1496.411] (-1495.775) -- 0:01:00

      Average standard deviation of split frequencies: 0.022216

      130500 -- (-1496.144) (-1496.936) [-1494.182] (-1499.456) * (-1493.839) (-1495.770) [-1493.460] (-1497.613) -- 0:00:59
      131000 -- [-1494.295] (-1498.643) (-1493.200) (-1497.021) * (-1496.495) [-1492.510] (-1494.195) (-1497.337) -- 0:00:59
      131500 -- (-1495.105) [-1495.194] (-1495.657) (-1494.249) * (-1496.420) [-1494.441] (-1496.182) (-1498.721) -- 0:00:59
      132000 -- (-1494.597) [-1493.560] (-1492.001) (-1496.738) * [-1493.878] (-1499.333) (-1498.254) (-1497.365) -- 0:00:59
      132500 -- [-1493.772] (-1495.497) (-1495.260) (-1496.607) * [-1496.062] (-1495.678) (-1497.814) (-1498.770) -- 0:00:58
      133000 -- (-1493.907) (-1495.265) (-1496.879) [-1493.094] * (-1497.171) [-1493.847] (-1496.670) (-1496.919) -- 0:00:58
      133500 -- (-1495.363) (-1493.291) (-1492.630) [-1493.455] * (-1499.525) (-1496.643) (-1499.071) [-1499.191] -- 0:00:58
      134000 -- (-1492.843) (-1491.554) [-1493.634] (-1496.738) * (-1494.395) [-1492.604] (-1496.153) (-1502.554) -- 0:01:04
      134500 -- [-1493.728] (-1492.758) (-1494.540) (-1495.707) * (-1493.141) (-1492.299) [-1497.072] (-1501.063) -- 0:01:04
      135000 -- (-1494.883) (-1493.002) [-1493.561] (-1492.828) * (-1491.386) [-1493.057] (-1497.207) (-1500.455) -- 0:01:04

      Average standard deviation of split frequencies: 0.019703

      135500 -- (-1494.411) [-1496.122] (-1494.204) (-1493.640) * (-1496.573) [-1492.973] (-1497.099) (-1499.363) -- 0:01:03
      136000 -- (-1498.463) (-1493.423) [-1495.441] (-1500.572) * [-1495.797] (-1495.123) (-1493.033) (-1500.350) -- 0:01:03
      136500 -- (-1501.092) (-1497.316) (-1495.816) [-1492.870] * (-1496.962) [-1495.887] (-1495.841) (-1497.994) -- 0:01:03
      137000 -- (-1496.983) [-1499.689] (-1497.214) (-1497.814) * (-1498.116) (-1496.470) (-1493.576) [-1497.865] -- 0:01:02
      137500 -- (-1495.133) (-1498.593) [-1493.203] (-1495.333) * [-1494.280] (-1493.844) (-1497.313) (-1497.500) -- 0:01:02
      138000 -- (-1496.372) [-1494.437] (-1496.355) (-1496.808) * (-1494.854) (-1496.449) [-1495.651] (-1496.685) -- 0:01:02
      138500 -- (-1497.486) (-1494.055) (-1497.733) [-1495.881] * (-1493.487) (-1497.387) (-1495.467) [-1495.559] -- 0:01:02
      139000 -- [-1492.644] (-1496.692) (-1494.441) (-1494.483) * [-1492.173] (-1494.636) (-1496.874) (-1494.559) -- 0:01:01
      139500 -- (-1495.146) [-1496.912] (-1495.765) (-1496.316) * (-1497.105) (-1491.971) (-1495.588) [-1500.506] -- 0:01:01
      140000 -- (-1494.846) (-1494.742) [-1490.551] (-1498.936) * (-1498.504) (-1496.364) [-1492.702] (-1496.828) -- 0:01:01

      Average standard deviation of split frequencies: 0.017347

      140500 -- [-1494.032] (-1494.237) (-1493.344) (-1501.250) * (-1493.567) [-1492.513] (-1497.614) (-1497.697) -- 0:01:01
      141000 -- [-1493.785] (-1492.778) (-1493.888) (-1496.727) * (-1494.339) (-1494.345) [-1493.108] (-1495.695) -- 0:01:00
      141500 -- (-1492.373) (-1495.329) [-1492.708] (-1496.682) * [-1495.421] (-1494.660) (-1494.564) (-1496.296) -- 0:01:00
      142000 -- [-1491.223] (-1496.857) (-1491.748) (-1496.930) * (-1496.266) (-1494.113) [-1494.844] (-1495.721) -- 0:01:00
      142500 -- (-1495.193) (-1500.213) [-1494.102] (-1497.767) * (-1493.088) [-1498.507] (-1499.056) (-1495.266) -- 0:01:00
      143000 -- (-1494.033) (-1494.987) (-1496.084) [-1495.106] * (-1494.628) (-1494.822) (-1495.435) [-1496.146] -- 0:00:59
      143500 -- (-1492.125) (-1494.842) [-1495.138] (-1495.127) * (-1494.582) [-1493.617] (-1496.346) (-1498.833) -- 0:00:59
      144000 -- [-1493.175] (-1495.235) (-1494.979) (-1494.333) * (-1498.852) (-1497.912) (-1497.511) [-1494.149] -- 0:00:59
      144500 -- (-1495.775) [-1494.847] (-1494.706) (-1494.565) * (-1499.072) (-1497.310) (-1497.728) [-1494.651] -- 0:00:59
      145000 -- (-1496.291) (-1494.367) [-1497.449] (-1497.585) * (-1502.115) (-1494.908) (-1495.755) [-1495.974] -- 0:00:58

      Average standard deviation of split frequencies: 0.017220

      145500 -- (-1494.652) (-1493.418) (-1494.488) [-1493.984] * (-1497.322) [-1493.081] (-1493.113) (-1493.963) -- 0:00:58
      146000 -- (-1494.894) (-1494.639) (-1495.837) [-1495.320] * (-1495.298) (-1494.592) (-1499.127) [-1496.184] -- 0:00:58
      146500 -- (-1499.160) (-1499.414) (-1500.800) [-1493.475] * (-1494.514) [-1498.517] (-1494.803) (-1497.029) -- 0:00:58
      147000 -- (-1497.646) (-1494.688) (-1496.370) [-1499.062] * (-1494.118) (-1500.868) [-1497.359] (-1492.773) -- 0:00:58
      147500 -- [-1496.915] (-1495.310) (-1495.117) (-1495.767) * (-1495.017) [-1499.297] (-1497.754) (-1491.969) -- 0:00:57
      148000 -- [-1492.928] (-1493.872) (-1494.692) (-1497.144) * (-1498.267) (-1493.597) (-1496.930) [-1496.230] -- 0:00:57
      148500 -- (-1494.706) (-1495.162) [-1496.018] (-1492.584) * (-1493.949) (-1494.236) (-1498.371) [-1498.896] -- 0:01:03
      149000 -- (-1501.876) (-1494.064) [-1494.437] (-1494.329) * (-1496.464) [-1494.157] (-1494.653) (-1496.909) -- 0:01:02
      149500 -- (-1499.260) (-1497.171) [-1493.372] (-1497.038) * (-1498.027) [-1495.972] (-1494.936) (-1495.997) -- 0:01:02
      150000 -- (-1498.013) (-1496.575) [-1493.544] (-1495.216) * (-1495.530) (-1493.722) (-1500.524) [-1496.751] -- 0:01:02

      Average standard deviation of split frequencies: 0.017208

      150500 -- [-1499.072] (-1496.564) (-1498.398) (-1499.875) * (-1496.585) (-1496.938) [-1499.140] (-1497.171) -- 0:01:02
      151000 -- (-1497.034) [-1496.790] (-1494.368) (-1493.550) * (-1494.833) (-1493.945) [-1496.321] (-1496.196) -- 0:01:01
      151500 -- [-1494.705] (-1493.995) (-1500.489) (-1494.177) * (-1496.134) (-1497.568) (-1496.066) [-1498.033] -- 0:01:01
      152000 -- (-1495.205) (-1494.187) (-1501.023) [-1493.094] * (-1497.743) [-1496.512] (-1495.628) (-1495.603) -- 0:01:01
      152500 -- [-1493.461] (-1494.965) (-1498.099) (-1501.203) * (-1494.195) [-1493.425] (-1495.680) (-1495.093) -- 0:01:01
      153000 -- [-1495.899] (-1493.363) (-1498.156) (-1497.788) * (-1497.068) (-1493.694) [-1496.648] (-1496.104) -- 0:01:00
      153500 -- (-1497.061) [-1496.881] (-1497.578) (-1492.212) * (-1494.028) (-1493.250) [-1495.418] (-1498.250) -- 0:01:00
      154000 -- [-1496.162] (-1496.363) (-1497.638) (-1492.746) * (-1496.007) (-1496.831) (-1493.748) [-1499.561] -- 0:01:00
      154500 -- (-1491.913) [-1495.707] (-1495.066) (-1494.545) * (-1494.242) (-1493.639) (-1497.601) [-1495.106] -- 0:01:00
      155000 -- (-1493.968) (-1496.642) [-1494.831] (-1496.213) * [-1496.688] (-1496.365) (-1504.720) (-1497.616) -- 0:00:59

      Average standard deviation of split frequencies: 0.017564

      155500 -- [-1493.981] (-1495.323) (-1498.616) (-1498.218) * (-1497.526) (-1498.795) [-1500.493] (-1496.084) -- 0:00:59
      156000 -- (-1492.475) (-1496.517) (-1494.303) [-1495.713] * (-1496.411) [-1495.878] (-1501.368) (-1497.341) -- 0:00:59
      156500 -- [-1492.361] (-1495.767) (-1496.329) (-1498.194) * (-1494.621) (-1493.145) (-1495.657) [-1496.881] -- 0:00:59
      157000 -- (-1491.959) (-1500.799) [-1492.375] (-1497.407) * (-1496.665) [-1493.323] (-1494.023) (-1499.257) -- 0:00:59
      157500 -- (-1495.627) (-1499.295) (-1498.347) [-1494.117] * (-1501.796) (-1494.552) [-1493.796] (-1492.985) -- 0:00:58
      158000 -- (-1501.109) (-1495.798) (-1492.425) [-1494.572] * (-1500.243) [-1496.411] (-1494.962) (-1493.278) -- 0:00:58
      158500 -- (-1497.286) [-1495.978] (-1494.877) (-1497.350) * (-1495.674) [-1496.548] (-1493.007) (-1505.197) -- 0:00:58
      159000 -- (-1498.424) (-1496.154) [-1492.032] (-1497.269) * (-1494.139) [-1494.838] (-1496.140) (-1498.840) -- 0:00:58
      159500 -- (-1496.378) [-1497.689] (-1497.050) (-1494.918) * (-1494.534) [-1497.756] (-1502.652) (-1501.289) -- 0:00:57
      160000 -- [-1496.421] (-1496.949) (-1497.075) (-1493.141) * [-1491.907] (-1493.863) (-1499.835) (-1496.153) -- 0:00:57

      Average standard deviation of split frequencies: 0.017421

      160500 -- (-1496.489) [-1494.799] (-1494.081) (-1497.256) * [-1492.450] (-1492.406) (-1500.915) (-1495.438) -- 0:00:57
      161000 -- [-1494.118] (-1498.312) (-1495.878) (-1497.025) * (-1492.461) [-1497.907] (-1497.852) (-1494.751) -- 0:00:57
      161500 -- [-1495.039] (-1500.186) (-1498.957) (-1495.053) * [-1492.788] (-1498.890) (-1498.493) (-1493.735) -- 0:00:57
      162000 -- (-1492.943) (-1496.137) (-1496.264) [-1493.449] * (-1493.327) [-1496.561] (-1497.583) (-1497.300) -- 0:00:56
      162500 -- (-1493.694) [-1496.563] (-1494.175) (-1493.976) * [-1494.529] (-1497.265) (-1499.572) (-1494.806) -- 0:00:56
      163000 -- (-1490.953) (-1496.368) (-1493.687) [-1494.543] * (-1492.819) (-1498.259) [-1496.813] (-1498.906) -- 0:01:01
      163500 -- (-1494.536) (-1501.499) [-1496.284] (-1494.540) * (-1496.484) [-1497.088] (-1496.480) (-1496.890) -- 0:01:01
      164000 -- (-1498.584) (-1497.448) (-1497.612) [-1497.318] * (-1494.243) (-1498.609) [-1493.835] (-1495.616) -- 0:01:01
      164500 -- (-1496.270) (-1495.252) (-1496.883) [-1499.583] * [-1493.155] (-1493.568) (-1497.065) (-1497.613) -- 0:01:00
      165000 -- (-1494.899) (-1496.305) [-1497.438] (-1493.134) * [-1496.739] (-1493.599) (-1500.643) (-1500.297) -- 0:01:00

      Average standard deviation of split frequencies: 0.016371

      165500 -- [-1495.063] (-1497.914) (-1494.733) (-1494.332) * (-1491.582) [-1494.332] (-1502.480) (-1496.461) -- 0:01:00
      166000 -- (-1493.663) (-1498.974) [-1493.003] (-1495.152) * [-1492.724] (-1495.990) (-1493.727) (-1495.421) -- 0:01:00
      166500 -- (-1497.090) (-1494.964) [-1492.502] (-1491.887) * (-1500.573) (-1494.225) (-1493.301) [-1497.511] -- 0:01:00
      167000 -- (-1494.734) (-1497.479) (-1494.132) [-1493.274] * (-1494.192) [-1494.033] (-1500.663) (-1496.266) -- 0:00:59
      167500 -- (-1494.992) (-1497.436) [-1497.600] (-1493.907) * (-1497.937) (-1498.549) (-1498.530) [-1499.171] -- 0:00:59
      168000 -- (-1495.667) [-1493.762] (-1497.674) (-1493.151) * (-1495.726) (-1495.877) [-1497.492] (-1492.906) -- 0:00:59
      168500 -- (-1494.899) (-1497.800) (-1494.910) [-1494.795] * (-1497.631) (-1496.322) [-1497.476] (-1494.797) -- 0:00:59
      169000 -- (-1493.271) (-1494.950) [-1493.386] (-1493.644) * (-1496.634) (-1497.929) (-1497.957) [-1501.453] -- 0:00:59
      169500 -- (-1492.069) (-1493.884) [-1494.331] (-1494.853) * (-1495.047) (-1500.563) [-1497.649] (-1496.587) -- 0:00:58
      170000 -- [-1492.472] (-1494.963) (-1494.617) (-1499.685) * (-1497.693) [-1496.049] (-1497.441) (-1498.445) -- 0:00:58

      Average standard deviation of split frequencies: 0.017091

      170500 -- (-1496.278) [-1496.228] (-1493.001) (-1494.637) * (-1496.354) (-1498.065) (-1498.732) [-1493.715] -- 0:00:58
      171000 -- (-1493.511) (-1495.431) [-1494.057] (-1494.888) * (-1492.097) (-1496.655) (-1498.654) [-1493.250] -- 0:00:58
      171500 -- (-1494.774) [-1496.489] (-1494.973) (-1496.376) * (-1498.462) (-1496.280) (-1498.529) [-1493.976] -- 0:00:57
      172000 -- (-1495.362) [-1496.971] (-1501.191) (-1499.464) * (-1493.705) (-1493.684) (-1496.756) [-1493.371] -- 0:00:57
      172500 -- [-1493.312] (-1497.901) (-1495.161) (-1493.221) * (-1496.800) (-1496.110) [-1492.286] (-1494.342) -- 0:00:57
      173000 -- [-1495.007] (-1494.880) (-1495.965) (-1494.033) * [-1495.727] (-1497.023) (-1492.532) (-1497.420) -- 0:00:57
      173500 -- (-1496.254) [-1494.255] (-1495.652) (-1493.859) * (-1493.888) (-1495.095) [-1498.483] (-1496.560) -- 0:00:57
      174000 -- (-1494.253) (-1493.310) [-1493.093] (-1495.575) * (-1493.704) (-1495.323) (-1497.726) [-1495.831] -- 0:00:56
      174500 -- (-1494.199) [-1493.304] (-1496.054) (-1500.883) * [-1492.791] (-1496.581) (-1496.541) (-1494.915) -- 0:00:56
      175000 -- (-1493.671) [-1493.186] (-1495.631) (-1497.579) * (-1499.635) (-1495.526) (-1498.189) [-1495.972] -- 0:00:56

      Average standard deviation of split frequencies: 0.018005

      175500 -- (-1494.286) [-1493.450] (-1493.340) (-1496.873) * (-1496.522) [-1494.715] (-1496.652) (-1493.014) -- 0:00:56
      176000 -- [-1495.464] (-1494.608) (-1494.194) (-1498.541) * [-1494.677] (-1492.975) (-1495.221) (-1496.830) -- 0:00:56
      176500 -- (-1494.225) (-1493.334) (-1496.274) [-1496.494] * (-1501.291) (-1494.535) [-1496.708] (-1496.782) -- 0:00:55
      177000 -- (-1493.658) [-1494.965] (-1497.261) (-1496.496) * (-1495.515) [-1494.208] (-1499.711) (-1495.958) -- 0:00:55
      177500 -- (-1494.921) [-1496.471] (-1496.621) (-1497.786) * (-1497.184) [-1496.367] (-1497.462) (-1494.018) -- 0:00:55
      178000 -- (-1493.265) (-1496.741) [-1496.742] (-1497.974) * (-1494.788) (-1496.342) (-1498.688) [-1494.464] -- 0:01:00
      178500 -- (-1494.388) (-1494.892) [-1493.294] (-1498.564) * (-1500.172) [-1495.298] (-1497.452) (-1498.359) -- 0:00:59
      179000 -- (-1496.255) [-1495.930] (-1491.305) (-1495.759) * (-1497.166) [-1493.616] (-1493.145) (-1493.105) -- 0:00:59
      179500 -- (-1492.907) [-1493.749] (-1495.436) (-1499.639) * [-1496.547] (-1494.991) (-1495.930) (-1500.834) -- 0:00:59
      180000 -- (-1491.982) [-1494.515] (-1492.474) (-1493.655) * [-1497.497] (-1495.865) (-1495.105) (-1495.405) -- 0:00:59

      Average standard deviation of split frequencies: 0.018700

      180500 -- (-1494.288) (-1496.002) (-1494.341) [-1492.808] * (-1496.504) (-1501.615) [-1496.226] (-1493.557) -- 0:00:59
      181000 -- (-1494.644) [-1493.504] (-1497.656) (-1494.631) * [-1495.998] (-1504.218) (-1496.860) (-1494.321) -- 0:00:58
      181500 -- (-1496.154) (-1494.175) [-1493.675] (-1497.009) * (-1499.036) (-1496.322) (-1496.326) [-1494.811] -- 0:00:58
      182000 -- [-1497.148] (-1497.401) (-1495.327) (-1496.469) * (-1496.498) (-1497.085) [-1498.011] (-1494.627) -- 0:00:58
      182500 -- (-1494.065) (-1501.855) (-1496.218) [-1493.011] * (-1497.346) (-1496.995) [-1496.161] (-1495.211) -- 0:00:58
      183000 -- [-1495.330] (-1494.686) (-1495.627) (-1496.289) * (-1497.171) (-1494.571) (-1496.933) [-1492.045] -- 0:00:58
      183500 -- (-1493.713) (-1494.741) (-1495.201) [-1500.338] * (-1495.035) (-1499.201) (-1496.128) [-1493.162] -- 0:00:57
      184000 -- (-1491.805) (-1494.781) [-1493.960] (-1496.060) * (-1493.027) (-1494.549) (-1496.196) [-1493.401] -- 0:00:57
      184500 -- (-1496.585) (-1496.371) (-1494.857) [-1495.210] * [-1495.051] (-1494.905) (-1497.056) (-1494.024) -- 0:00:57
      185000 -- [-1493.045] (-1497.268) (-1496.646) (-1498.934) * (-1497.853) (-1494.166) (-1496.636) [-1495.476] -- 0:00:57

      Average standard deviation of split frequencies: 0.017037

      185500 -- [-1495.726] (-1496.022) (-1495.864) (-1493.165) * (-1496.816) [-1492.613] (-1497.834) (-1494.693) -- 0:00:57
      186000 -- [-1497.914] (-1496.934) (-1495.292) (-1498.064) * (-1499.026) (-1494.756) [-1498.886] (-1494.388) -- 0:00:56
      186500 -- [-1495.343] (-1495.108) (-1497.132) (-1495.655) * (-1493.827) (-1495.030) (-1496.692) [-1492.728] -- 0:00:56
      187000 -- (-1493.481) (-1505.291) (-1496.194) [-1494.342] * [-1494.557] (-1499.410) (-1498.627) (-1492.398) -- 0:00:56
      187500 -- (-1492.291) (-1502.223) [-1494.787] (-1497.994) * (-1499.757) (-1499.313) (-1503.445) [-1496.260] -- 0:00:56
      188000 -- (-1493.994) [-1494.659] (-1493.089) (-1501.478) * [-1495.889] (-1500.815) (-1496.537) (-1493.271) -- 0:00:56
      188500 -- (-1497.798) [-1493.207] (-1497.814) (-1497.000) * (-1493.688) (-1497.289) (-1498.150) [-1496.073] -- 0:00:55
      189000 -- (-1495.185) (-1496.290) [-1497.699] (-1494.145) * [-1493.802] (-1499.596) (-1495.748) (-1495.560) -- 0:00:55
      189500 -- [-1495.226] (-1494.473) (-1498.998) (-1495.262) * (-1495.071) (-1494.125) (-1494.802) [-1498.736] -- 0:00:55
      190000 -- [-1499.140] (-1495.841) (-1500.484) (-1497.778) * (-1499.364) (-1494.405) (-1496.019) [-1492.788] -- 0:00:55

      Average standard deviation of split frequencies: 0.016580

      190500 -- [-1495.640] (-1496.281) (-1500.497) (-1500.167) * (-1498.195) (-1496.146) (-1496.018) [-1495.112] -- 0:00:55
      191000 -- (-1495.091) [-1494.792] (-1496.844) (-1498.209) * (-1496.790) [-1496.459] (-1494.885) (-1491.975) -- 0:00:55
      191500 -- (-1495.083) [-1492.811] (-1495.467) (-1493.763) * [-1493.674] (-1492.193) (-1497.958) (-1499.635) -- 0:00:54
      192000 -- (-1493.663) (-1493.240) [-1493.863] (-1497.679) * (-1495.783) [-1493.631] (-1497.377) (-1493.663) -- 0:00:54
      192500 -- (-1492.657) [-1496.432] (-1498.055) (-1497.909) * (-1494.377) (-1501.368) [-1493.668] (-1493.221) -- 0:00:54
      193000 -- (-1494.300) (-1496.886) [-1496.083] (-1497.549) * [-1494.049] (-1501.482) (-1494.666) (-1498.333) -- 0:00:58
      193500 -- (-1495.112) [-1495.511] (-1504.721) (-1493.549) * (-1493.062) (-1495.945) (-1496.697) [-1494.775] -- 0:00:58
      194000 -- (-1494.264) (-1498.408) (-1493.728) [-1493.542] * (-1495.972) [-1493.936] (-1494.148) (-1495.487) -- 0:00:58
      194500 -- (-1495.094) [-1492.712] (-1495.075) (-1493.424) * [-1493.758] (-1495.955) (-1495.081) (-1498.627) -- 0:00:57
      195000 -- (-1495.434) (-1496.367) (-1492.730) [-1493.227] * (-1493.661) (-1495.315) [-1493.731] (-1493.759) -- 0:00:57

      Average standard deviation of split frequencies: 0.015846

      195500 -- (-1495.025) [-1493.889] (-1496.102) (-1493.262) * [-1492.731] (-1493.449) (-1494.762) (-1496.194) -- 0:00:57
      196000 -- (-1492.767) (-1496.574) [-1495.476] (-1495.511) * (-1493.568) (-1498.129) [-1493.935] (-1495.728) -- 0:00:57
      196500 -- [-1491.962] (-1496.815) (-1494.984) (-1494.167) * (-1494.808) (-1495.576) [-1495.915] (-1494.929) -- 0:00:57
      197000 -- (-1492.960) (-1495.132) [-1492.978] (-1492.003) * (-1491.646) [-1494.493] (-1499.462) (-1494.757) -- 0:00:57
      197500 -- [-1494.254] (-1494.350) (-1497.818) (-1492.599) * (-1494.567) (-1494.525) [-1495.770] (-1493.020) -- 0:00:56
      198000 -- [-1499.863] (-1496.646) (-1500.151) (-1494.928) * (-1495.852) (-1496.569) [-1493.829] (-1492.243) -- 0:00:56
      198500 -- (-1497.810) [-1495.397] (-1498.001) (-1496.189) * [-1496.215] (-1497.246) (-1496.477) (-1494.511) -- 0:00:56
      199000 -- (-1495.835) (-1499.137) (-1495.377) [-1496.695] * (-1494.542) (-1500.487) [-1494.741] (-1495.014) -- 0:00:56
      199500 -- [-1495.675] (-1499.798) (-1499.145) (-1495.063) * (-1496.529) [-1496.308] (-1492.187) (-1493.920) -- 0:00:56
      200000 -- (-1495.646) (-1496.994) (-1496.662) [-1497.367] * (-1496.422) [-1495.460] (-1494.502) (-1493.917) -- 0:00:55

      Average standard deviation of split frequencies: 0.014389

      200500 -- (-1493.726) (-1498.892) [-1496.894] (-1491.920) * (-1495.650) (-1494.231) [-1493.618] (-1498.148) -- 0:00:55
      201000 -- [-1493.536] (-1497.707) (-1496.630) (-1499.710) * [-1493.836] (-1495.387) (-1494.550) (-1494.672) -- 0:00:55
      201500 -- (-1494.635) (-1498.349) (-1497.728) [-1491.918] * (-1491.231) (-1497.879) (-1495.841) [-1495.922] -- 0:00:55
      202000 -- (-1493.362) (-1499.269) [-1494.785] (-1495.357) * (-1496.920) [-1496.703] (-1494.752) (-1497.622) -- 0:00:55
      202500 -- (-1494.466) [-1496.305] (-1493.719) (-1495.501) * (-1495.641) [-1494.609] (-1495.031) (-1497.671) -- 0:00:55
      203000 -- (-1493.266) (-1493.998) (-1493.725) [-1494.001] * [-1493.398] (-1497.799) (-1498.892) (-1493.778) -- 0:00:54
      203500 -- (-1494.111) (-1495.393) (-1492.198) [-1493.915] * [-1493.076] (-1495.900) (-1493.389) (-1494.419) -- 0:00:54
      204000 -- [-1494.563] (-1494.670) (-1494.195) (-1498.309) * (-1495.888) (-1497.144) [-1493.162] (-1498.753) -- 0:00:54
      204500 -- [-1494.109] (-1492.762) (-1493.608) (-1496.624) * (-1495.270) (-1497.312) [-1494.732] (-1493.877) -- 0:00:54
      205000 -- (-1495.202) [-1499.785] (-1500.465) (-1497.762) * (-1497.195) (-1496.785) [-1495.091] (-1495.272) -- 0:00:54

      Average standard deviation of split frequencies: 0.014573

      205500 -- (-1495.938) (-1496.986) (-1499.256) [-1494.230] * (-1501.466) (-1496.345) (-1497.679) [-1497.907] -- 0:00:54
      206000 -- (-1494.024) (-1497.208) (-1495.045) [-1493.833] * (-1495.421) [-1495.350] (-1495.596) (-1494.654) -- 0:00:53
      206500 -- [-1494.139] (-1500.164) (-1493.123) (-1495.263) * (-1495.258) [-1494.747] (-1494.458) (-1496.421) -- 0:00:53
      207000 -- (-1496.167) (-1496.115) [-1492.502] (-1494.217) * (-1492.671) [-1494.925] (-1493.901) (-1494.851) -- 0:00:53
      207500 -- (-1494.912) (-1493.505) [-1494.986] (-1495.176) * (-1494.616) (-1496.661) (-1499.620) [-1493.751] -- 0:00:57
      208000 -- (-1493.943) [-1495.023] (-1495.880) (-1498.051) * (-1499.599) (-1495.352) (-1496.422) [-1496.164] -- 0:00:57
      208500 -- (-1496.370) (-1493.291) (-1492.759) [-1498.620] * [-1494.132] (-1497.200) (-1494.817) (-1495.239) -- 0:00:56
      209000 -- (-1496.881) (-1494.098) [-1493.140] (-1493.500) * (-1494.555) (-1498.573) [-1499.131] (-1501.444) -- 0:00:56
      209500 -- [-1498.483] (-1493.487) (-1494.552) (-1496.410) * (-1496.301) (-1493.538) [-1497.261] (-1493.523) -- 0:00:56
      210000 -- (-1495.993) [-1493.334] (-1499.602) (-1494.308) * (-1497.840) (-1495.143) [-1493.108] (-1493.404) -- 0:00:56

      Average standard deviation of split frequencies: 0.014048

      210500 -- [-1501.215] (-1493.646) (-1498.609) (-1498.136) * [-1493.669] (-1497.316) (-1495.239) (-1495.012) -- 0:00:56
      211000 -- (-1502.349) (-1492.663) (-1500.194) [-1495.336] * [-1492.825] (-1494.507) (-1496.561) (-1492.407) -- 0:00:56
      211500 -- [-1497.103] (-1495.062) (-1497.247) (-1499.808) * [-1492.536] (-1493.351) (-1496.499) (-1496.042) -- 0:00:55
      212000 -- [-1494.288] (-1494.531) (-1493.743) (-1495.174) * (-1493.529) (-1496.940) (-1496.045) [-1493.587] -- 0:00:55
      212500 -- [-1492.685] (-1496.043) (-1492.728) (-1496.413) * (-1491.763) [-1497.559] (-1499.542) (-1499.373) -- 0:00:55
      213000 -- (-1493.202) [-1493.449] (-1494.028) (-1496.071) * [-1494.764] (-1499.106) (-1496.241) (-1492.887) -- 0:00:55
      213500 -- (-1497.082) (-1494.708) [-1494.937] (-1494.378) * [-1494.795] (-1496.968) (-1497.541) (-1494.467) -- 0:00:55
      214000 -- (-1496.587) [-1494.361] (-1496.261) (-1495.217) * (-1494.451) (-1497.572) (-1497.052) [-1494.188] -- 0:00:55
      214500 -- [-1497.748] (-1497.209) (-1496.999) (-1493.533) * (-1494.260) [-1497.364] (-1494.623) (-1495.518) -- 0:00:54
      215000 -- [-1495.826] (-1495.086) (-1492.503) (-1495.731) * (-1496.635) (-1498.275) [-1493.731] (-1493.530) -- 0:00:54

      Average standard deviation of split frequencies: 0.014507

      215500 -- (-1495.200) [-1492.980] (-1497.210) (-1494.157) * (-1497.590) (-1496.299) [-1494.321] (-1494.600) -- 0:00:54
      216000 -- (-1494.198) (-1494.513) [-1497.387] (-1497.547) * (-1494.031) (-1495.755) [-1495.422] (-1501.089) -- 0:00:54
      216500 -- (-1503.282) [-1494.237] (-1496.119) (-1493.590) * (-1493.755) [-1494.173] (-1494.680) (-1497.168) -- 0:00:54
      217000 -- (-1498.961) (-1495.598) (-1494.309) [-1493.941] * [-1498.495] (-1496.255) (-1497.696) (-1498.650) -- 0:00:54
      217500 -- (-1497.680) [-1494.624] (-1493.140) (-1493.571) * (-1497.841) [-1495.372] (-1495.727) (-1500.075) -- 0:00:53
      218000 -- (-1498.826) [-1494.151] (-1493.377) (-1499.960) * (-1494.668) [-1494.962] (-1494.942) (-1496.269) -- 0:00:53
      218500 -- (-1498.459) (-1498.826) [-1495.605] (-1495.761) * [-1492.383] (-1496.837) (-1497.716) (-1499.813) -- 0:00:53
      219000 -- (-1497.328) [-1495.839] (-1493.352) (-1497.922) * (-1493.749) [-1493.073] (-1499.955) (-1500.535) -- 0:00:53
      219500 -- (-1497.277) (-1493.307) [-1494.326] (-1495.887) * (-1494.549) (-1492.588) [-1493.634] (-1498.931) -- 0:00:53
      220000 -- (-1497.793) [-1494.156] (-1496.299) (-1494.046) * (-1494.419) (-1493.031) [-1494.117] (-1497.322) -- 0:00:53

      Average standard deviation of split frequencies: 0.013320

      220500 -- [-1497.397] (-1498.191) (-1495.747) (-1496.830) * (-1493.195) [-1494.807] (-1496.982) (-1497.526) -- 0:00:53
      221000 -- (-1495.433) (-1493.852) (-1495.812) [-1493.712] * (-1495.239) [-1494.901] (-1494.798) (-1503.279) -- 0:00:52
      221500 -- (-1496.526) (-1496.406) [-1494.601] (-1494.682) * (-1496.213) [-1495.985] (-1495.571) (-1500.028) -- 0:00:52
      222000 -- (-1494.563) (-1497.952) (-1498.055) [-1495.411] * (-1497.421) (-1497.722) [-1495.131] (-1496.958) -- 0:00:56
      222500 -- (-1492.461) [-1493.057] (-1494.479) (-1496.098) * (-1501.763) [-1496.800] (-1494.669) (-1496.572) -- 0:00:55
      223000 -- (-1494.779) [-1497.432] (-1496.263) (-1500.660) * (-1495.697) [-1493.098] (-1495.143) (-1494.412) -- 0:00:55
      223500 -- (-1494.217) [-1495.022] (-1494.244) (-1497.326) * (-1495.139) [-1494.714] (-1498.292) (-1494.775) -- 0:00:55
      224000 -- (-1498.180) (-1494.944) [-1494.257] (-1492.412) * (-1497.288) (-1494.776) [-1494.831] (-1492.059) -- 0:00:55
      224500 -- (-1498.367) [-1494.572] (-1493.793) (-1495.929) * (-1495.686) (-1493.407) (-1497.802) [-1494.893] -- 0:00:55
      225000 -- [-1500.284] (-1497.019) (-1495.356) (-1495.699) * (-1495.087) (-1497.748) (-1493.154) [-1493.732] -- 0:00:55

      Average standard deviation of split frequencies: 0.013129

      225500 -- (-1495.866) (-1496.863) [-1499.509] (-1496.239) * (-1496.245) (-1496.171) (-1492.903) [-1495.943] -- 0:00:54
      226000 -- (-1495.761) (-1496.376) (-1494.580) [-1493.865] * (-1497.251) [-1496.745] (-1493.067) (-1496.822) -- 0:00:54
      226500 -- (-1498.934) [-1497.117] (-1493.823) (-1495.981) * [-1493.622] (-1498.315) (-1492.965) (-1493.902) -- 0:00:54
      227000 -- (-1494.119) (-1497.442) (-1494.266) [-1495.691] * (-1494.290) (-1498.377) [-1496.532] (-1495.027) -- 0:00:54
      227500 -- (-1495.629) (-1501.251) (-1496.399) [-1494.049] * (-1493.626) (-1496.182) [-1494.144] (-1491.395) -- 0:00:54
      228000 -- (-1493.328) [-1496.579] (-1494.508) (-1494.492) * (-1495.879) (-1493.465) (-1496.268) [-1495.529] -- 0:00:54
      228500 -- (-1497.603) (-1496.604) [-1495.319] (-1497.679) * [-1500.094] (-1494.365) (-1498.617) (-1495.004) -- 0:00:54
      229000 -- (-1495.622) (-1495.511) (-1492.825) [-1495.718] * (-1495.610) [-1495.612] (-1497.659) (-1496.840) -- 0:00:53
      229500 -- (-1494.473) (-1495.949) [-1492.234] (-1496.896) * (-1495.045) (-1495.149) [-1492.622] (-1495.844) -- 0:00:53
      230000 -- (-1493.530) (-1493.500) (-1494.915) [-1495.198] * (-1492.976) [-1493.682] (-1495.574) (-1496.903) -- 0:00:53

      Average standard deviation of split frequencies: 0.013705

      230500 -- (-1497.058) (-1500.199) (-1493.888) [-1492.658] * (-1493.150) [-1496.129] (-1493.901) (-1494.063) -- 0:00:53
      231000 -- (-1493.495) (-1497.358) (-1494.230) [-1493.086] * (-1492.333) (-1494.581) (-1496.548) [-1494.375] -- 0:00:53
      231500 -- (-1493.388) (-1493.625) (-1493.085) [-1493.388] * (-1494.103) [-1495.876] (-1499.240) (-1496.697) -- 0:00:53
      232000 -- (-1496.982) (-1498.039) (-1494.996) [-1495.150] * (-1493.378) (-1494.708) (-1496.558) [-1495.072] -- 0:00:52
      232500 -- (-1495.964) (-1494.791) (-1495.469) [-1493.618] * (-1493.097) (-1497.234) (-1494.406) [-1493.152] -- 0:00:52
      233000 -- (-1494.586) (-1496.858) [-1492.798] (-1495.871) * (-1492.705) (-1497.221) (-1495.232) [-1491.628] -- 0:00:52
      233500 -- [-1494.803] (-1493.262) (-1492.503) (-1493.996) * [-1493.295] (-1496.600) (-1493.842) (-1498.604) -- 0:00:52
      234000 -- (-1497.214) (-1492.591) [-1493.904] (-1494.247) * (-1493.084) [-1496.703] (-1495.461) (-1499.793) -- 0:00:52
      234500 -- [-1495.165] (-1494.679) (-1491.260) (-1494.604) * (-1493.368) (-1495.893) [-1493.416] (-1501.023) -- 0:00:52
      235000 -- (-1495.931) (-1495.008) (-1496.824) [-1494.725] * [-1496.394] (-1495.280) (-1494.163) (-1495.837) -- 0:00:52

      Average standard deviation of split frequencies: 0.013630

      235500 -- (-1494.148) [-1493.175] (-1498.867) (-1492.956) * (-1496.265) (-1495.856) (-1494.183) [-1494.236] -- 0:00:51
      236000 -- (-1495.324) (-1495.152) [-1498.264] (-1494.123) * (-1494.046) (-1495.675) (-1497.043) [-1496.423] -- 0:00:51
      236500 -- (-1493.692) [-1492.245] (-1501.183) (-1494.381) * (-1493.448) (-1498.349) (-1494.877) [-1495.107] -- 0:00:51
      237000 -- (-1492.803) [-1495.377] (-1494.226) (-1492.841) * (-1493.600) (-1498.301) [-1494.380] (-1497.387) -- 0:00:54
      237500 -- [-1495.565] (-1497.411) (-1495.765) (-1495.982) * (-1493.714) (-1496.916) (-1496.861) [-1494.523] -- 0:00:54
      238000 -- [-1491.856] (-1495.797) (-1496.502) (-1491.731) * (-1495.489) (-1502.170) [-1494.467] (-1498.917) -- 0:00:54
      238500 -- [-1499.165] (-1497.138) (-1495.885) (-1494.834) * (-1500.839) [-1494.922] (-1496.814) (-1503.337) -- 0:00:54
      239000 -- [-1492.694] (-1494.332) (-1493.840) (-1497.833) * (-1497.788) [-1496.980] (-1497.134) (-1494.122) -- 0:00:54
      239500 -- (-1493.682) [-1493.889] (-1494.047) (-1494.968) * [-1495.963] (-1498.094) (-1498.501) (-1495.819) -- 0:00:53
      240000 -- [-1496.518] (-1497.844) (-1495.363) (-1495.932) * (-1494.650) [-1494.045] (-1494.208) (-1494.630) -- 0:00:53

      Average standard deviation of split frequencies: 0.012514

      240500 -- [-1494.136] (-1494.277) (-1494.843) (-1496.774) * (-1493.583) [-1497.037] (-1494.789) (-1500.807) -- 0:00:53
      241000 -- (-1493.477) (-1495.363) (-1493.109) [-1500.183] * (-1495.150) (-1495.974) [-1498.365] (-1497.462) -- 0:00:53
      241500 -- (-1497.049) (-1497.967) (-1495.118) [-1494.210] * [-1493.804] (-1497.029) (-1496.418) (-1496.473) -- 0:00:53
      242000 -- (-1493.214) [-1497.671] (-1496.517) (-1497.154) * (-1497.211) (-1497.773) [-1496.527] (-1495.447) -- 0:00:53
      242500 -- (-1493.294) (-1497.917) (-1496.566) [-1494.286] * [-1494.317] (-1496.641) (-1497.446) (-1495.326) -- 0:00:53
      243000 -- [-1495.245] (-1492.966) (-1493.387) (-1494.961) * (-1493.805) (-1494.982) (-1493.144) [-1495.643] -- 0:00:52
      243500 -- (-1502.850) (-1495.701) (-1491.483) [-1493.784] * [-1493.557] (-1496.672) (-1494.388) (-1499.486) -- 0:00:52
      244000 -- [-1492.485] (-1500.867) (-1497.362) (-1493.638) * (-1493.123) (-1498.731) [-1494.244] (-1498.434) -- 0:00:52
      244500 -- (-1497.135) [-1492.880] (-1496.078) (-1493.759) * [-1493.708] (-1494.477) (-1495.545) (-1496.301) -- 0:00:52
      245000 -- (-1497.273) [-1497.583] (-1491.281) (-1494.115) * [-1494.552] (-1499.077) (-1496.332) (-1495.532) -- 0:00:52

      Average standard deviation of split frequencies: 0.013095

      245500 -- [-1493.470] (-1496.279) (-1493.820) (-1494.286) * [-1496.916] (-1497.975) (-1497.760) (-1496.487) -- 0:00:52
      246000 -- (-1494.957) (-1496.065) (-1493.846) [-1497.740] * (-1497.506) (-1498.016) [-1495.559] (-1497.176) -- 0:00:52
      246500 -- (-1493.421) (-1496.232) [-1492.835] (-1498.855) * (-1496.101) (-1493.790) [-1495.218] (-1496.664) -- 0:00:51
      247000 -- (-1496.580) (-1494.835) (-1493.194) [-1495.867] * [-1495.351] (-1493.417) (-1495.520) (-1498.121) -- 0:00:51
      247500 -- [-1495.198] (-1496.907) (-1495.183) (-1493.861) * (-1496.671) (-1503.149) (-1495.987) [-1496.910] -- 0:00:51
      248000 -- [-1494.825] (-1495.970) (-1494.413) (-1496.810) * (-1495.786) (-1499.278) [-1493.492] (-1499.934) -- 0:00:51
      248500 -- (-1498.955) (-1497.922) (-1496.149) [-1496.302] * (-1495.738) (-1497.644) [-1494.314] (-1496.450) -- 0:00:51
      249000 -- (-1494.490) [-1495.105] (-1493.264) (-1498.943) * (-1500.081) [-1495.463] (-1494.083) (-1494.272) -- 0:00:51
      249500 -- [-1496.441] (-1494.137) (-1494.512) (-1499.932) * (-1499.299) (-1501.873) (-1497.519) [-1497.574] -- 0:00:51
      250000 -- [-1494.555] (-1496.852) (-1496.671) (-1495.175) * (-1496.863) (-1498.414) (-1496.861) [-1497.019] -- 0:00:51

      Average standard deviation of split frequencies: 0.013896

      250500 -- [-1498.960] (-1494.866) (-1500.032) (-1498.140) * (-1492.738) (-1499.545) (-1498.738) [-1496.718] -- 0:00:50
      251000 -- (-1497.267) [-1494.127] (-1499.106) (-1497.556) * (-1497.816) (-1498.912) [-1493.069] (-1496.685) -- 0:00:50
      251500 -- (-1497.282) (-1492.849) (-1494.986) [-1495.522] * (-1498.283) (-1494.660) [-1495.249] (-1497.080) -- 0:00:53
      252000 -- [-1494.022] (-1495.347) (-1498.755) (-1493.761) * (-1497.406) (-1495.037) (-1497.584) [-1494.388] -- 0:00:53
      252500 -- (-1501.061) (-1498.264) (-1496.162) [-1494.957] * (-1497.317) (-1495.736) (-1497.805) [-1496.172] -- 0:00:53
      253000 -- (-1493.925) [-1497.796] (-1493.678) (-1495.038) * (-1497.821) (-1495.437) (-1495.032) [-1495.762] -- 0:00:53
      253500 -- (-1498.996) (-1497.011) [-1494.224] (-1501.312) * [-1495.623] (-1499.419) (-1495.475) (-1500.150) -- 0:00:53
      254000 -- [-1501.234] (-1497.232) (-1493.231) (-1498.853) * (-1496.128) [-1498.505] (-1495.087) (-1496.380) -- 0:00:52
      254500 -- (-1498.424) [-1496.269] (-1497.877) (-1498.214) * [-1496.846] (-1497.852) (-1497.703) (-1494.232) -- 0:00:52
      255000 -- (-1496.926) (-1496.196) [-1492.714] (-1498.563) * (-1495.048) (-1494.158) [-1494.275] (-1494.292) -- 0:00:52

      Average standard deviation of split frequencies: 0.014015

      255500 -- (-1495.961) (-1498.280) (-1501.638) [-1496.490] * (-1497.128) (-1499.543) [-1493.821] (-1495.851) -- 0:00:52
      256000 -- (-1493.993) (-1494.706) (-1494.116) [-1494.202] * (-1497.588) [-1499.654] (-1493.594) (-1493.918) -- 0:00:52
      256500 -- (-1493.575) (-1497.914) [-1494.569] (-1494.587) * [-1498.492] (-1495.995) (-1497.389) (-1494.624) -- 0:00:52
      257000 -- (-1495.778) (-1496.518) (-1493.674) [-1494.328] * (-1498.515) (-1499.195) [-1497.289] (-1496.074) -- 0:00:52
      257500 -- (-1502.907) (-1492.995) (-1497.187) [-1493.178] * (-1498.534) [-1494.096] (-1497.777) (-1497.085) -- 0:00:51
      258000 -- (-1498.785) (-1494.037) [-1492.116] (-1493.522) * (-1495.206) [-1495.698] (-1494.311) (-1494.961) -- 0:00:51
      258500 -- (-1495.703) [-1495.860] (-1493.875) (-1497.214) * [-1495.222] (-1496.353) (-1495.279) (-1497.122) -- 0:00:51
      259000 -- (-1499.527) [-1492.116] (-1492.510) (-1499.291) * (-1492.636) (-1500.799) (-1494.156) [-1494.805] -- 0:00:51
      259500 -- (-1502.357) (-1493.901) [-1493.578] (-1497.818) * (-1496.347) (-1498.709) [-1498.886] (-1497.755) -- 0:00:51
      260000 -- (-1497.995) [-1494.218] (-1492.410) (-1493.922) * [-1498.269] (-1500.865) (-1493.124) (-1495.042) -- 0:00:51

      Average standard deviation of split frequencies: 0.013764

      260500 -- [-1495.653] (-1496.538) (-1493.231) (-1495.530) * [-1498.420] (-1499.359) (-1494.161) (-1494.662) -- 0:00:51
      261000 -- (-1494.010) (-1500.517) (-1496.586) [-1493.836] * (-1497.962) [-1498.329] (-1497.944) (-1494.623) -- 0:00:50
      261500 -- (-1495.748) (-1497.357) [-1495.548] (-1493.670) * [-1497.242] (-1497.735) (-1498.678) (-1493.713) -- 0:00:50
      262000 -- (-1496.390) (-1500.204) (-1500.583) [-1496.434] * (-1496.588) (-1498.883) [-1498.894] (-1495.871) -- 0:00:50
      262500 -- (-1498.427) [-1494.028] (-1494.093) (-1496.961) * (-1495.238) (-1495.578) (-1501.579) [-1493.750] -- 0:00:50
      263000 -- [-1497.586] (-1493.252) (-1495.412) (-1492.529) * [-1494.064] (-1495.790) (-1499.719) (-1495.270) -- 0:00:50
      263500 -- (-1499.554) [-1493.043] (-1493.403) (-1497.623) * (-1496.637) (-1496.809) (-1498.173) [-1494.992] -- 0:00:50
      264000 -- (-1500.651) [-1492.517] (-1494.896) (-1495.775) * (-1493.704) (-1493.840) (-1505.119) [-1496.591] -- 0:00:50
      264500 -- (-1496.502) (-1494.702) [-1494.450] (-1495.492) * (-1497.829) (-1494.555) [-1498.960] (-1495.794) -- 0:00:50
      265000 -- (-1496.598) [-1495.195] (-1496.325) (-1495.636) * (-1495.086) [-1496.305] (-1494.630) (-1498.342) -- 0:00:49

      Average standard deviation of split frequencies: 0.014079

      265500 -- (-1497.522) [-1493.944] (-1496.068) (-1498.817) * (-1494.339) (-1495.655) [-1496.866] (-1494.764) -- 0:00:49
      266000 -- [-1496.634] (-1498.763) (-1496.362) (-1497.148) * (-1497.412) (-1492.382) [-1495.244] (-1497.584) -- 0:00:49
      266500 -- [-1493.461] (-1496.252) (-1495.280) (-1494.347) * (-1496.270) (-1494.912) (-1493.801) [-1496.117] -- 0:00:52
      267000 -- (-1496.253) (-1495.093) [-1497.120] (-1494.094) * (-1493.119) [-1497.094] (-1494.913) (-1494.480) -- 0:00:52
      267500 -- [-1495.139] (-1494.239) (-1500.499) (-1493.032) * [-1492.653] (-1492.971) (-1495.691) (-1496.226) -- 0:00:52
      268000 -- (-1497.572) (-1494.756) [-1496.383] (-1493.889) * (-1493.813) [-1496.800] (-1494.375) (-1495.036) -- 0:00:51
      268500 -- [-1497.156] (-1493.907) (-1496.261) (-1496.074) * (-1493.844) [-1494.218] (-1496.257) (-1496.481) -- 0:00:51
      269000 -- [-1494.648] (-1496.361) (-1492.946) (-1495.137) * (-1494.546) (-1496.847) [-1495.605] (-1495.286) -- 0:00:51
      269500 -- (-1498.384) [-1494.223] (-1495.265) (-1493.972) * (-1495.628) (-1494.369) (-1493.326) [-1497.722] -- 0:00:51
      270000 -- (-1500.711) [-1496.230] (-1495.802) (-1499.297) * (-1496.938) [-1495.573] (-1497.977) (-1497.099) -- 0:00:51

      Average standard deviation of split frequencies: 0.013933

      270500 -- (-1492.802) (-1493.324) (-1493.280) [-1496.369] * (-1498.740) [-1498.011] (-1494.100) (-1495.744) -- 0:00:51
      271000 -- (-1495.047) (-1494.237) [-1495.069] (-1497.184) * [-1493.702] (-1500.434) (-1496.984) (-1498.608) -- 0:00:51
      271500 -- (-1495.788) [-1495.015] (-1498.434) (-1494.277) * (-1499.699) (-1499.270) [-1494.538] (-1496.134) -- 0:00:50
      272000 -- (-1493.349) (-1498.598) [-1497.813] (-1495.698) * (-1498.299) (-1500.266) (-1498.471) [-1496.754] -- 0:00:50
      272500 -- (-1499.206) (-1498.015) (-1498.992) [-1492.299] * (-1501.190) [-1495.411] (-1494.408) (-1496.123) -- 0:00:50
      273000 -- (-1498.997) (-1496.282) [-1495.848] (-1500.615) * (-1497.440) (-1494.230) [-1499.100] (-1493.541) -- 0:00:50
      273500 -- (-1498.996) (-1496.347) [-1494.874] (-1498.463) * (-1495.936) [-1492.622] (-1495.438) (-1497.539) -- 0:00:50
      274000 -- (-1497.848) (-1495.058) (-1494.263) [-1493.455] * [-1496.011] (-1493.443) (-1493.970) (-1495.105) -- 0:00:50
      274500 -- (-1494.066) (-1496.222) [-1493.985] (-1493.830) * (-1501.466) (-1498.706) [-1495.988] (-1495.881) -- 0:00:50
      275000 -- (-1494.236) [-1495.288] (-1498.121) (-1496.113) * (-1499.638) (-1495.010) [-1494.127] (-1497.117) -- 0:00:50

      Average standard deviation of split frequencies: 0.013759

      275500 -- (-1497.406) (-1500.694) [-1495.089] (-1497.469) * (-1494.698) [-1495.701] (-1493.521) (-1495.620) -- 0:00:49
      276000 -- (-1496.949) (-1494.263) [-1492.222] (-1495.072) * (-1495.704) (-1496.850) (-1494.965) [-1495.283] -- 0:00:49
      276500 -- [-1494.216] (-1499.850) (-1494.482) (-1493.254) * (-1493.555) (-1497.504) [-1493.934] (-1499.697) -- 0:00:49
      277000 -- (-1492.573) (-1498.836) [-1495.317] (-1497.322) * (-1493.351) (-1502.669) (-1493.246) [-1495.027] -- 0:00:49
      277500 -- (-1494.859) (-1493.256) [-1496.196] (-1494.236) * [-1494.197] (-1501.909) (-1494.709) (-1497.389) -- 0:00:49
      278000 -- (-1496.605) [-1496.629] (-1500.189) (-1495.781) * (-1494.694) [-1499.832] (-1497.160) (-1499.022) -- 0:00:49
      278500 -- (-1496.730) (-1496.587) (-1497.295) [-1492.030] * (-1494.157) (-1499.590) (-1491.485) [-1500.392] -- 0:00:49
      279000 -- (-1495.541) (-1497.969) (-1497.670) [-1495.099] * [-1493.431] (-1496.390) (-1493.995) (-1497.511) -- 0:00:49
      279500 -- [-1495.372] (-1498.414) (-1493.514) (-1500.894) * (-1494.003) (-1496.937) [-1498.481] (-1499.276) -- 0:00:48
      280000 -- (-1495.083) [-1496.926] (-1493.711) (-1501.758) * (-1497.164) [-1494.959] (-1495.653) (-1499.096) -- 0:00:48

      Average standard deviation of split frequencies: 0.014425

      280500 -- (-1497.637) [-1499.367] (-1494.794) (-1504.858) * [-1499.430] (-1493.910) (-1496.332) (-1496.697) -- 0:00:48
      281000 -- (-1492.997) (-1497.276) [-1496.981] (-1499.814) * (-1493.791) (-1493.235) [-1497.953] (-1498.793) -- 0:00:51
      281500 -- [-1494.427] (-1497.121) (-1495.621) (-1498.252) * (-1495.223) (-1492.782) [-1495.557] (-1497.891) -- 0:00:51
      282000 -- (-1497.969) (-1495.671) [-1495.139] (-1494.568) * (-1495.559) (-1494.909) [-1493.181] (-1496.344) -- 0:00:50
      282500 -- (-1494.729) (-1494.642) (-1493.706) [-1495.517] * [-1494.591] (-1492.529) (-1494.929) (-1499.214) -- 0:00:50
      283000 -- (-1493.252) [-1494.600] (-1496.112) (-1501.943) * [-1494.294] (-1494.984) (-1495.118) (-1496.971) -- 0:00:50
      283500 -- [-1496.529] (-1499.854) (-1495.597) (-1501.537) * [-1493.100] (-1496.184) (-1495.859) (-1500.194) -- 0:00:50
      284000 -- (-1496.745) (-1496.828) [-1494.518] (-1501.123) * (-1496.657) (-1494.175) (-1498.334) [-1494.656] -- 0:00:50
      284500 -- (-1496.255) [-1496.661] (-1497.451) (-1494.663) * (-1503.869) [-1495.823] (-1496.293) (-1495.699) -- 0:00:50
      285000 -- (-1493.786) (-1494.267) (-1500.373) [-1493.010] * (-1498.444) [-1494.653] (-1495.819) (-1495.218) -- 0:00:50

      Average standard deviation of split frequencies: 0.013186

      285500 -- [-1492.414] (-1496.915) (-1496.064) (-1497.560) * (-1493.695) [-1493.255] (-1492.909) (-1493.809) -- 0:00:50
      286000 -- [-1493.096] (-1496.953) (-1495.525) (-1501.930) * (-1493.959) (-1494.802) [-1493.696] (-1496.716) -- 0:00:49
      286500 -- [-1493.591] (-1495.328) (-1497.290) (-1498.145) * (-1496.805) (-1498.112) [-1495.066] (-1492.945) -- 0:00:49
      287000 -- (-1497.517) [-1494.063] (-1500.480) (-1494.842) * (-1498.318) [-1494.280] (-1494.804) (-1496.136) -- 0:00:49
      287500 -- (-1497.613) (-1498.969) (-1495.144) [-1496.145] * (-1492.492) (-1497.499) (-1493.086) [-1494.497] -- 0:00:49
      288000 -- (-1496.628) [-1495.565] (-1494.742) (-1497.220) * (-1493.530) [-1495.213] (-1496.662) (-1495.811) -- 0:00:49
      288500 -- (-1499.995) (-1498.936) [-1494.828] (-1498.110) * (-1496.201) (-1499.260) (-1499.813) [-1495.111] -- 0:00:49
      289000 -- (-1496.874) (-1496.598) [-1493.265] (-1498.458) * [-1492.153] (-1494.212) (-1493.270) (-1496.560) -- 0:00:49
      289500 -- (-1492.990) (-1494.861) [-1493.842] (-1499.535) * (-1495.727) (-1493.159) (-1491.979) [-1494.613] -- 0:00:49
      290000 -- [-1494.901] (-1497.153) (-1497.452) (-1497.774) * (-1496.211) [-1492.439] (-1493.810) (-1495.305) -- 0:00:48

      Average standard deviation of split frequencies: 0.013356

      290500 -- (-1495.507) (-1493.314) [-1495.007] (-1494.783) * (-1493.217) (-1493.962) [-1493.345] (-1495.992) -- 0:00:48
      291000 -- (-1496.409) [-1494.858] (-1496.468) (-1492.277) * (-1495.588) [-1494.508] (-1495.128) (-1493.278) -- 0:00:48
      291500 -- (-1495.537) (-1496.319) (-1495.840) [-1497.710] * [-1494.872] (-1494.183) (-1497.433) (-1495.886) -- 0:00:48
      292000 -- (-1500.495) (-1495.768) [-1497.952] (-1493.346) * (-1495.851) (-1497.948) [-1498.177] (-1492.863) -- 0:00:48
      292500 -- (-1497.238) (-1500.806) (-1493.783) [-1492.648] * [-1497.129] (-1493.962) (-1495.948) (-1495.092) -- 0:00:48
      293000 -- (-1497.164) (-1499.782) (-1497.048) [-1497.368] * (-1500.943) (-1494.831) (-1492.706) [-1497.265] -- 0:00:48
      293500 -- [-1494.698] (-1499.715) (-1494.222) (-1495.251) * (-1496.024) (-1494.729) [-1493.001] (-1495.077) -- 0:00:48
      294000 -- [-1494.359] (-1498.748) (-1494.037) (-1498.065) * (-1498.840) (-1492.678) [-1492.884] (-1501.460) -- 0:00:48
      294500 -- (-1495.649) [-1493.446] (-1496.659) (-1496.297) * [-1494.689] (-1496.409) (-1494.072) (-1495.426) -- 0:00:47
      295000 -- (-1495.637) (-1497.227) [-1494.427] (-1494.956) * (-1503.121) (-1493.245) [-1492.394] (-1493.663) -- 0:00:47

      Average standard deviation of split frequencies: 0.012741

      295500 -- (-1494.503) (-1498.331) (-1494.005) [-1496.700] * (-1494.739) (-1492.595) [-1495.353] (-1496.821) -- 0:00:47
      296000 -- (-1494.141) (-1499.484) (-1494.718) [-1493.235] * [-1494.693] (-1496.553) (-1494.047) (-1496.949) -- 0:00:49
      296500 -- (-1494.257) (-1493.367) [-1497.788] (-1498.530) * (-1494.031) [-1493.429] (-1501.155) (-1494.619) -- 0:00:49
      297000 -- (-1498.024) (-1494.756) [-1495.089] (-1496.655) * (-1496.740) [-1491.983] (-1493.928) (-1497.006) -- 0:00:49
      297500 -- (-1496.136) (-1495.134) [-1495.527] (-1497.017) * (-1501.761) (-1492.993) (-1498.507) [-1495.335] -- 0:00:49
      298000 -- (-1500.083) (-1497.264) (-1498.497) [-1495.072] * (-1495.734) (-1494.462) (-1492.515) [-1499.113] -- 0:00:49
      298500 -- (-1499.003) (-1494.355) (-1494.899) [-1495.174] * (-1497.991) [-1495.304] (-1492.669) (-1496.860) -- 0:00:49
      299000 -- (-1496.945) [-1495.361] (-1492.786) (-1493.659) * (-1498.439) (-1492.364) [-1493.988] (-1497.513) -- 0:00:49
      299500 -- (-1496.515) (-1492.463) [-1494.249] (-1493.696) * (-1496.791) [-1497.118] (-1493.648) (-1498.337) -- 0:00:49
      300000 -- (-1497.611) [-1494.267] (-1494.342) (-1496.764) * [-1493.338] (-1495.937) (-1494.524) (-1502.758) -- 0:00:48

      Average standard deviation of split frequencies: 0.012174

      300500 -- [-1496.451] (-1492.982) (-1494.426) (-1496.091) * (-1495.258) (-1498.600) [-1492.093] (-1497.309) -- 0:00:48
      301000 -- (-1494.853) (-1498.262) (-1495.557) [-1494.160] * (-1498.384) (-1492.433) [-1500.698] (-1496.723) -- 0:00:48
      301500 -- (-1495.528) (-1493.256) [-1494.778] (-1497.139) * (-1497.218) [-1495.856] (-1501.031) (-1492.682) -- 0:00:48
      302000 -- (-1494.105) (-1500.607) [-1496.424] (-1495.397) * (-1495.964) (-1495.389) (-1504.394) [-1496.041] -- 0:00:48
      302500 -- (-1492.428) (-1497.775) [-1496.449] (-1495.810) * (-1503.570) (-1495.250) (-1494.678) [-1494.438] -- 0:00:48
      303000 -- (-1493.375) (-1493.894) [-1495.438] (-1496.918) * [-1496.404] (-1493.339) (-1492.458) (-1493.376) -- 0:00:48
      303500 -- [-1496.491] (-1495.231) (-1499.433) (-1498.075) * (-1494.688) [-1494.155] (-1494.939) (-1494.990) -- 0:00:48
      304000 -- [-1494.790] (-1493.734) (-1496.458) (-1499.800) * (-1494.495) [-1501.734] (-1494.956) (-1494.336) -- 0:00:48
      304500 -- (-1494.898) (-1494.107) (-1494.378) [-1499.786] * [-1494.751] (-1494.366) (-1493.427) (-1497.083) -- 0:00:47
      305000 -- [-1495.880] (-1494.573) (-1497.726) (-1496.168) * [-1494.418] (-1495.656) (-1494.172) (-1499.464) -- 0:00:47

      Average standard deviation of split frequencies: 0.011418

      305500 -- (-1504.811) (-1496.667) [-1492.471] (-1496.674) * (-1495.666) [-1493.960] (-1492.663) (-1502.156) -- 0:00:47
      306000 -- [-1495.702] (-1492.910) (-1493.545) (-1494.978) * (-1495.546) [-1495.972] (-1495.918) (-1496.084) -- 0:00:47
      306500 -- (-1495.463) [-1493.206] (-1493.517) (-1495.015) * (-1496.133) [-1494.982] (-1498.341) (-1494.553) -- 0:00:47
      307000 -- [-1495.956] (-1493.844) (-1496.138) (-1494.459) * [-1495.151] (-1495.020) (-1496.947) (-1494.828) -- 0:00:47
      307500 -- (-1495.998) [-1496.499] (-1497.110) (-1495.900) * [-1497.132] (-1495.788) (-1494.033) (-1495.389) -- 0:00:47
      308000 -- (-1497.500) (-1497.719) (-1498.592) [-1496.533] * (-1499.363) (-1493.313) (-1495.607) [-1492.572] -- 0:00:47
      308500 -- (-1496.709) (-1496.463) (-1496.018) [-1495.875] * [-1492.709] (-1494.418) (-1494.224) (-1495.598) -- 0:00:47
      309000 -- (-1496.583) (-1492.938) [-1493.362] (-1496.385) * (-1493.083) (-1492.668) (-1496.090) [-1494.302] -- 0:00:46
      309500 -- (-1497.678) (-1493.897) (-1497.827) [-1492.639] * [-1494.540] (-1492.590) (-1494.212) (-1500.149) -- 0:00:46
      310000 -- (-1496.842) (-1497.522) [-1495.557] (-1492.625) * (-1493.541) (-1497.866) (-1495.515) [-1492.337] -- 0:00:46

      Average standard deviation of split frequencies: 0.010354

      310500 -- (-1498.838) [-1498.529] (-1496.366) (-1495.676) * (-1493.523) (-1497.914) (-1496.982) [-1497.202] -- 0:00:48
      311000 -- (-1501.220) [-1495.688] (-1499.976) (-1496.927) * (-1494.632) (-1493.649) (-1498.906) [-1497.420] -- 0:00:48
      311500 -- (-1499.632) [-1495.066] (-1496.773) (-1496.142) * (-1496.410) [-1494.667] (-1496.885) (-1496.969) -- 0:00:48
      312000 -- (-1492.193) (-1498.085) [-1495.419] (-1494.771) * (-1495.253) [-1494.508] (-1492.926) (-1497.604) -- 0:00:48
      312500 -- [-1493.729] (-1496.708) (-1493.776) (-1496.000) * [-1494.845] (-1499.460) (-1491.769) (-1498.614) -- 0:00:48
      313000 -- (-1495.646) (-1494.368) [-1494.102] (-1495.901) * (-1492.463) (-1497.038) (-1497.821) [-1499.076] -- 0:00:48
      313500 -- (-1497.404) [-1498.292] (-1496.297) (-1494.379) * [-1493.121] (-1493.865) (-1497.782) (-1495.461) -- 0:00:48
      314000 -- [-1497.459] (-1500.755) (-1495.091) (-1495.257) * (-1494.909) [-1495.021] (-1492.955) (-1497.481) -- 0:00:48
      314500 -- (-1501.430) (-1496.440) (-1494.541) [-1494.194] * (-1494.602) (-1496.901) [-1496.153] (-1495.192) -- 0:00:47
      315000 -- (-1496.228) (-1495.196) [-1497.164] (-1498.918) * (-1494.845) (-1496.372) [-1492.394] (-1496.864) -- 0:00:47

      Average standard deviation of split frequencies: 0.010443

      315500 -- (-1494.939) (-1499.789) [-1492.963] (-1494.520) * (-1494.681) [-1497.705] (-1496.280) (-1500.256) -- 0:00:47
      316000 -- (-1494.960) (-1498.884) (-1492.916) [-1496.205] * (-1494.250) [-1496.448] (-1494.368) (-1499.408) -- 0:00:47
      316500 -- (-1497.107) [-1494.978] (-1496.176) (-1497.275) * [-1496.833] (-1497.080) (-1493.238) (-1496.796) -- 0:00:47
      317000 -- [-1494.823] (-1494.900) (-1497.408) (-1495.503) * (-1494.598) (-1498.806) [-1494.639] (-1500.307) -- 0:00:47
      317500 -- [-1494.919] (-1496.076) (-1495.408) (-1497.177) * (-1493.755) (-1496.666) (-1493.494) [-1497.875] -- 0:00:47
      318000 -- (-1496.545) (-1495.133) [-1495.189] (-1493.847) * (-1498.270) [-1496.396] (-1491.964) (-1496.062) -- 0:00:47
      318500 -- (-1494.387) (-1498.470) (-1494.842) [-1494.021] * (-1494.967) (-1494.669) [-1493.970] (-1495.421) -- 0:00:47
      319000 -- (-1494.814) (-1496.574) (-1497.520) [-1493.428] * (-1494.651) (-1494.523) (-1493.668) [-1495.432] -- 0:00:46
      319500 -- [-1495.613] (-1495.270) (-1502.135) (-1498.400) * (-1493.793) [-1495.110] (-1494.846) (-1500.146) -- 0:00:46
      320000 -- (-1495.935) (-1495.779) (-1493.510) [-1493.995] * [-1494.861] (-1495.921) (-1493.598) (-1499.407) -- 0:00:46

      Average standard deviation of split frequencies: 0.009506

      320500 -- (-1496.310) (-1494.072) (-1496.351) [-1493.448] * (-1494.289) (-1494.442) (-1496.171) [-1495.836] -- 0:00:46
      321000 -- [-1495.685] (-1498.496) (-1494.905) (-1494.911) * (-1498.294) (-1497.442) [-1496.933] (-1493.416) -- 0:00:46
      321500 -- (-1496.688) (-1497.238) [-1495.412] (-1497.601) * (-1494.374) (-1497.690) [-1494.659] (-1495.623) -- 0:00:46
      322000 -- [-1494.030] (-1494.648) (-1496.692) (-1496.894) * (-1496.021) [-1494.574] (-1496.125) (-1493.924) -- 0:00:46
      322500 -- [-1495.238] (-1493.696) (-1498.151) (-1493.843) * [-1493.114] (-1493.635) (-1494.939) (-1498.267) -- 0:00:46
      323000 -- [-1493.652] (-1499.603) (-1494.216) (-1497.147) * (-1494.547) (-1492.702) (-1497.364) [-1497.979] -- 0:00:46
      323500 -- (-1493.709) (-1497.394) [-1494.016] (-1494.128) * [-1493.427] (-1493.583) (-1495.166) (-1500.891) -- 0:00:46
      324000 -- [-1494.935] (-1495.099) (-1497.346) (-1498.210) * [-1495.001] (-1493.918) (-1493.497) (-1494.847) -- 0:00:45
      324500 -- (-1495.727) (-1497.663) [-1500.694] (-1494.069) * [-1493.683] (-1494.312) (-1498.925) (-1494.423) -- 0:00:45
      325000 -- (-1494.594) (-1497.492) [-1494.541] (-1493.998) * (-1492.754) [-1493.718] (-1498.173) (-1495.657) -- 0:00:45

      Average standard deviation of split frequencies: 0.009272

      325500 -- (-1494.923) (-1497.019) [-1493.561] (-1498.117) * (-1495.923) [-1493.590] (-1497.781) (-1494.891) -- 0:00:47
      326000 -- (-1500.455) (-1497.341) [-1494.387] (-1496.870) * (-1495.239) [-1493.671] (-1492.630) (-1493.291) -- 0:00:47
      326500 -- (-1498.924) (-1498.890) [-1493.266] (-1494.286) * (-1493.634) (-1493.660) [-1496.141] (-1500.131) -- 0:00:47
      327000 -- (-1501.938) (-1500.702) (-1493.715) [-1495.965] * [-1494.280] (-1495.116) (-1498.416) (-1494.781) -- 0:00:47
      327500 -- [-1495.996] (-1499.592) (-1494.817) (-1493.420) * [-1491.068] (-1495.666) (-1494.844) (-1494.883) -- 0:00:47
      328000 -- [-1495.214] (-1498.064) (-1496.145) (-1496.711) * (-1493.227) (-1494.610) (-1494.278) [-1499.906] -- 0:00:47
      328500 -- (-1501.114) (-1497.312) (-1500.141) [-1497.389] * [-1495.997] (-1494.229) (-1492.483) (-1497.603) -- 0:00:47
      329000 -- (-1502.369) (-1499.556) [-1497.233] (-1494.646) * [-1491.792] (-1493.340) (-1492.703) (-1493.555) -- 0:00:46
      329500 -- (-1497.353) (-1497.341) [-1497.664] (-1495.495) * (-1491.958) (-1498.461) (-1492.658) [-1495.028] -- 0:00:46
      330000 -- (-1493.831) [-1492.942] (-1498.371) (-1495.717) * (-1494.520) (-1497.943) (-1494.403) [-1495.656] -- 0:00:46

      Average standard deviation of split frequencies: 0.009141

      330500 -- (-1493.912) (-1495.485) (-1496.221) [-1493.671] * (-1494.676) [-1495.850] (-1496.022) (-1497.716) -- 0:00:46
      331000 -- (-1494.352) (-1496.487) (-1500.531) [-1495.891] * (-1494.454) [-1493.230] (-1495.074) (-1497.886) -- 0:00:46
      331500 -- (-1495.411) (-1499.256) (-1504.997) [-1495.017] * (-1493.834) [-1494.679] (-1495.899) (-1497.981) -- 0:00:46
      332000 -- [-1497.093] (-1499.200) (-1497.333) (-1498.765) * (-1494.925) [-1501.593] (-1495.620) (-1497.249) -- 0:00:46
      332500 -- [-1501.544] (-1498.817) (-1494.735) (-1493.820) * [-1495.125] (-1496.809) (-1498.544) (-1495.745) -- 0:00:46
      333000 -- (-1498.118) (-1499.252) [-1494.304] (-1493.700) * (-1497.213) (-1496.128) (-1495.122) [-1494.744] -- 0:00:46
      333500 -- (-1497.885) [-1494.359] (-1494.264) (-1493.182) * (-1495.233) (-1503.561) [-1492.490] (-1493.510) -- 0:00:45
      334000 -- (-1493.236) (-1496.217) [-1497.109] (-1494.476) * (-1495.288) (-1504.430) (-1493.826) [-1496.242] -- 0:00:45
      334500 -- (-1504.176) (-1497.495) (-1495.049) [-1495.602] * (-1494.673) [-1502.900] (-1494.626) (-1496.868) -- 0:00:45
      335000 -- [-1494.119] (-1505.166) (-1493.237) (-1492.242) * (-1498.935) [-1497.867] (-1492.684) (-1494.119) -- 0:00:45

      Average standard deviation of split frequencies: 0.009408

      335500 -- (-1492.672) (-1498.027) (-1496.509) [-1492.226] * [-1495.561] (-1493.667) (-1496.086) (-1495.776) -- 0:00:45
      336000 -- (-1494.771) (-1500.063) (-1493.962) [-1496.130] * (-1496.783) [-1496.190] (-1496.027) (-1498.603) -- 0:00:45
      336500 -- (-1496.789) (-1494.326) [-1494.982] (-1495.749) * [-1494.154] (-1498.454) (-1497.331) (-1494.586) -- 0:00:45
      337000 -- (-1498.535) (-1493.894) (-1497.069) [-1493.404] * [-1495.832] (-1497.844) (-1495.934) (-1494.995) -- 0:00:45
      337500 -- (-1496.693) [-1496.043] (-1497.822) (-1495.210) * [-1494.157] (-1495.864) (-1491.753) (-1495.974) -- 0:00:45
      338000 -- (-1500.587) [-1494.611] (-1497.238) (-1495.415) * (-1492.988) (-1497.864) [-1493.979] (-1499.162) -- 0:00:45
      338500 -- (-1495.774) (-1497.130) [-1496.663] (-1495.955) * (-1494.179) (-1496.635) [-1494.175] (-1493.234) -- 0:00:44
      339000 -- (-1495.442) (-1498.633) (-1499.976) [-1493.470] * (-1495.815) (-1494.774) [-1497.565] (-1498.040) -- 0:00:44
      339500 -- (-1495.401) (-1497.978) [-1492.940] (-1497.411) * (-1493.569) [-1494.544] (-1492.800) (-1494.183) -- 0:00:44
      340000 -- (-1494.773) (-1495.410) (-1497.257) [-1500.152] * (-1493.913) [-1497.534] (-1493.873) (-1494.433) -- 0:00:46

      Average standard deviation of split frequencies: 0.008908

      340500 -- (-1496.292) [-1495.437] (-1494.552) (-1496.288) * (-1494.408) [-1494.109] (-1494.372) (-1498.888) -- 0:00:46
      341000 -- (-1497.237) (-1495.865) [-1495.380] (-1497.756) * [-1494.651] (-1500.266) (-1494.431) (-1494.517) -- 0:00:46
      341500 -- (-1496.722) [-1496.030] (-1493.281) (-1499.273) * (-1495.361) (-1494.959) (-1493.560) [-1493.674] -- 0:00:46
      342000 -- (-1495.694) (-1496.056) (-1494.572) [-1497.135] * (-1497.937) (-1499.034) (-1494.298) [-1494.547] -- 0:00:46
      342500 -- (-1494.013) [-1495.552] (-1498.081) (-1495.234) * (-1497.287) [-1500.562] (-1495.082) (-1496.364) -- 0:00:46
      343000 -- [-1496.267] (-1494.093) (-1492.420) (-1493.883) * [-1493.853] (-1495.409) (-1498.053) (-1498.944) -- 0:00:45
      343500 -- (-1501.813) [-1495.932] (-1493.850) (-1495.060) * (-1494.242) [-1495.410] (-1494.631) (-1496.293) -- 0:00:45
      344000 -- [-1500.445] (-1497.947) (-1492.430) (-1495.519) * (-1495.601) [-1494.463] (-1501.142) (-1496.479) -- 0:00:45
      344500 -- [-1496.657] (-1499.944) (-1493.594) (-1493.637) * [-1491.933] (-1497.767) (-1497.797) (-1498.986) -- 0:00:45
      345000 -- (-1499.949) (-1498.265) [-1494.962] (-1495.368) * [-1493.636] (-1495.712) (-1498.275) (-1494.816) -- 0:00:45

      Average standard deviation of split frequencies: 0.008896

      345500 -- (-1494.615) [-1496.005] (-1499.088) (-1495.818) * (-1497.544) (-1500.528) (-1494.055) [-1493.553] -- 0:00:45
      346000 -- [-1495.581] (-1496.624) (-1494.178) (-1497.463) * (-1497.606) [-1497.089] (-1495.464) (-1494.806) -- 0:00:45
      346500 -- (-1498.539) (-1492.345) (-1495.935) [-1493.707] * [-1498.755] (-1492.781) (-1496.281) (-1494.296) -- 0:00:45
      347000 -- (-1497.828) [-1500.397] (-1494.134) (-1497.908) * (-1495.222) (-1496.499) (-1494.700) [-1494.417] -- 0:00:45
      347500 -- (-1499.984) (-1500.983) [-1495.440] (-1493.802) * (-1495.441) (-1494.565) (-1493.836) [-1494.272] -- 0:00:45
      348000 -- [-1495.253] (-1496.115) (-1492.954) (-1502.591) * (-1494.383) (-1494.688) (-1493.540) [-1494.072] -- 0:00:44
      348500 -- (-1495.288) (-1495.633) [-1494.131] (-1499.213) * (-1494.186) (-1492.970) [-1493.014] (-1499.275) -- 0:00:44
      349000 -- [-1495.268] (-1491.781) (-1498.549) (-1496.047) * (-1493.147) [-1497.443] (-1496.704) (-1495.784) -- 0:00:44
      349500 -- [-1494.349] (-1493.883) (-1496.648) (-1497.380) * (-1493.963) (-1498.197) (-1494.466) [-1494.960] -- 0:00:44
      350000 -- (-1495.320) (-1493.042) (-1494.867) [-1495.606] * [-1495.521] (-1500.677) (-1494.620) (-1495.089) -- 0:00:44

      Average standard deviation of split frequencies: 0.008778

      350500 -- (-1495.719) (-1495.949) [-1493.439] (-1496.015) * [-1494.177] (-1503.927) (-1495.020) (-1497.542) -- 0:00:44
      351000 -- (-1495.037) (-1492.522) [-1495.915] (-1494.285) * (-1497.285) (-1499.102) [-1495.931] (-1497.441) -- 0:00:44
      351500 -- (-1495.330) (-1493.589) [-1493.281] (-1492.283) * (-1495.494) (-1497.801) (-1493.926) [-1493.868] -- 0:00:44
      352000 -- [-1493.829] (-1494.886) (-1493.169) (-1498.004) * (-1498.252) (-1498.689) [-1499.566] (-1493.159) -- 0:00:44
      352500 -- (-1496.918) [-1501.438] (-1498.580) (-1494.015) * (-1496.055) (-1502.393) [-1498.176] (-1493.879) -- 0:00:44
      353000 -- (-1495.558) (-1499.276) [-1495.862] (-1495.135) * (-1494.572) (-1498.046) [-1496.916] (-1492.324) -- 0:00:43
      353500 -- (-1496.238) [-1497.764] (-1495.691) (-1495.999) * (-1494.424) (-1498.585) (-1497.223) [-1499.363] -- 0:00:43
      354000 -- (-1492.507) (-1494.309) (-1495.151) [-1496.919] * (-1494.927) (-1497.841) (-1495.652) [-1492.558] -- 0:00:43
      354500 -- [-1493.773] (-1500.700) (-1497.133) (-1495.511) * (-1497.288) (-1499.704) (-1494.719) [-1494.319] -- 0:00:43
      355000 -- (-1497.557) (-1497.951) [-1494.033] (-1497.067) * (-1493.682) (-1496.251) [-1495.418] (-1494.760) -- 0:00:45

      Average standard deviation of split frequencies: 0.009347

      355500 -- (-1497.161) (-1497.063) [-1495.718] (-1493.071) * (-1494.813) [-1495.618] (-1498.857) (-1496.600) -- 0:00:45
      356000 -- (-1495.143) [-1496.722] (-1497.359) (-1494.394) * (-1492.686) (-1496.753) (-1494.298) [-1493.806] -- 0:00:45
      356500 -- [-1498.040] (-1494.669) (-1496.163) (-1495.204) * (-1494.324) [-1495.841] (-1498.510) (-1493.132) -- 0:00:45
      357000 -- [-1496.067] (-1496.701) (-1495.248) (-1493.203) * (-1492.690) [-1495.404] (-1497.072) (-1495.578) -- 0:00:45
      357500 -- [-1500.324] (-1495.105) (-1496.852) (-1498.307) * [-1493.820] (-1497.675) (-1494.879) (-1497.225) -- 0:00:44
      358000 -- [-1500.144] (-1492.480) (-1495.190) (-1492.719) * (-1497.302) (-1495.135) (-1497.248) [-1494.851] -- 0:00:44
      358500 -- (-1495.051) [-1491.809] (-1495.642) (-1492.914) * [-1494.618] (-1495.672) (-1499.334) (-1495.619) -- 0:00:44
      359000 -- (-1494.701) (-1499.532) (-1501.455) [-1494.503] * (-1497.546) [-1499.039] (-1494.913) (-1494.641) -- 0:00:44
      359500 -- (-1494.036) [-1496.097] (-1496.775) (-1496.390) * (-1498.569) (-1495.035) [-1496.362] (-1493.390) -- 0:00:44
      360000 -- (-1494.130) (-1493.976) [-1496.655] (-1494.915) * (-1505.369) (-1494.017) [-1492.881] (-1495.701) -- 0:00:44

      Average standard deviation of split frequencies: 0.009764

      360500 -- (-1495.469) (-1496.149) (-1498.841) [-1494.749] * (-1500.077) (-1493.587) [-1498.624] (-1494.580) -- 0:00:44
      361000 -- (-1495.052) [-1497.469] (-1496.336) (-1494.735) * [-1496.028] (-1495.311) (-1495.326) (-1494.262) -- 0:00:44
      361500 -- [-1492.874] (-1496.884) (-1494.338) (-1493.757) * (-1494.008) (-1495.766) [-1494.235] (-1496.765) -- 0:00:44
      362000 -- (-1496.398) (-1493.953) (-1496.042) [-1494.375] * (-1493.878) (-1498.018) (-1498.146) [-1496.968] -- 0:00:44
      362500 -- [-1496.607] (-1492.437) (-1498.123) (-1494.373) * (-1492.711) [-1495.059] (-1494.662) (-1500.201) -- 0:00:43
      363000 -- [-1495.137] (-1491.648) (-1496.596) (-1492.632) * [-1492.894] (-1493.656) (-1493.131) (-1499.852) -- 0:00:43
      363500 -- (-1494.507) [-1494.268] (-1496.426) (-1495.893) * (-1493.157) (-1495.263) (-1493.726) [-1494.875] -- 0:00:43
      364000 -- (-1493.812) [-1502.161] (-1495.036) (-1493.461) * [-1495.410] (-1495.081) (-1494.218) (-1496.407) -- 0:00:43
      364500 -- [-1495.482] (-1499.762) (-1495.168) (-1498.681) * [-1493.849] (-1494.769) (-1500.081) (-1493.876) -- 0:00:43
      365000 -- [-1493.584] (-1499.539) (-1496.414) (-1495.535) * [-1493.361] (-1498.024) (-1492.263) (-1503.147) -- 0:00:43

      Average standard deviation of split frequencies: 0.010683

      365500 -- (-1494.365) (-1496.443) [-1494.222] (-1494.509) * (-1498.851) (-1495.395) [-1493.495] (-1491.926) -- 0:00:43
      366000 -- (-1497.834) (-1495.109) (-1497.727) [-1494.976] * [-1493.094] (-1496.243) (-1495.439) (-1494.992) -- 0:00:43
      366500 -- (-1505.031) (-1499.656) [-1497.928] (-1493.988) * [-1493.947] (-1495.246) (-1494.044) (-1497.267) -- 0:00:43
      367000 -- (-1493.754) (-1498.046) [-1495.741] (-1492.208) * [-1493.245] (-1500.579) (-1498.056) (-1496.455) -- 0:00:43
      367500 -- (-1494.319) [-1496.416] (-1494.959) (-1496.144) * [-1497.231] (-1495.343) (-1493.744) (-1498.276) -- 0:00:43
      368000 -- (-1493.423) (-1494.771) [-1492.716] (-1494.715) * (-1495.398) (-1498.332) [-1491.395] (-1497.954) -- 0:00:42
      368500 -- (-1493.752) (-1493.188) (-1493.796) [-1492.341] * (-1493.666) [-1496.623] (-1499.164) (-1497.230) -- 0:00:42
      369000 -- (-1494.664) [-1493.936] (-1493.264) (-1494.475) * (-1493.460) (-1495.811) (-1494.580) [-1493.499] -- 0:00:42
      369500 -- [-1497.374] (-1493.209) (-1498.897) (-1496.751) * [-1493.094] (-1502.350) (-1495.720) (-1501.588) -- 0:00:42
      370000 -- (-1493.942) (-1494.362) [-1498.004] (-1492.459) * (-1498.635) [-1497.061] (-1498.137) (-1500.714) -- 0:00:44

      Average standard deviation of split frequencies: 0.010922

      370500 -- (-1495.296) [-1496.068] (-1493.277) (-1492.402) * (-1497.420) [-1494.403] (-1493.867) (-1496.675) -- 0:00:44
      371000 -- (-1494.739) (-1496.158) [-1493.232] (-1494.930) * [-1492.984] (-1493.924) (-1494.943) (-1496.692) -- 0:00:44
      371500 -- [-1496.048] (-1494.037) (-1497.385) (-1494.494) * (-1494.886) [-1494.833] (-1492.854) (-1500.609) -- 0:00:43
      372000 -- [-1492.426] (-1496.446) (-1494.878) (-1494.792) * (-1499.126) [-1493.864] (-1495.577) (-1496.586) -- 0:00:43
      372500 -- (-1496.244) (-1497.052) [-1493.070] (-1495.776) * (-1497.954) (-1492.659) (-1501.176) [-1492.772] -- 0:00:43
      373000 -- (-1497.226) (-1492.969) [-1494.641] (-1496.264) * [-1500.015] (-1496.879) (-1495.911) (-1493.885) -- 0:00:43
      373500 -- (-1499.083) (-1495.155) [-1495.537] (-1495.857) * (-1498.482) (-1493.844) (-1495.867) [-1493.620] -- 0:00:43
      374000 -- (-1499.446) (-1497.106) (-1496.348) [-1493.737] * (-1496.131) (-1492.271) [-1496.542] (-1494.100) -- 0:00:43
      374500 -- (-1496.773) (-1495.435) (-1493.191) [-1494.929] * (-1494.939) (-1494.645) (-1496.682) [-1494.463] -- 0:00:43
      375000 -- (-1495.221) (-1499.081) [-1491.226] (-1493.492) * [-1494.862] (-1493.903) (-1495.320) (-1498.972) -- 0:00:43

      Average standard deviation of split frequencies: 0.010989

      375500 -- (-1495.836) [-1494.691] (-1498.089) (-1496.542) * (-1496.042) [-1494.135] (-1498.413) (-1496.601) -- 0:00:43
      376000 -- (-1493.970) (-1494.299) (-1493.987) [-1495.985] * (-1495.400) [-1492.629] (-1498.221) (-1499.772) -- 0:00:43
      376500 -- (-1495.500) (-1492.148) [-1493.153] (-1494.844) * (-1494.553) (-1492.682) [-1493.614] (-1494.803) -- 0:00:43
      377000 -- (-1495.883) (-1491.202) (-1497.744) [-1497.887] * (-1497.512) (-1494.684) (-1495.047) [-1497.938] -- 0:00:42
      377500 -- (-1493.824) (-1493.851) (-1495.270) [-1497.042] * (-1498.983) (-1498.152) [-1494.116] (-1496.144) -- 0:00:42
      378000 -- [-1493.848] (-1493.900) (-1494.947) (-1496.701) * (-1501.309) (-1494.762) [-1495.828] (-1493.369) -- 0:00:42
      378500 -- (-1498.930) (-1496.318) (-1501.664) [-1497.015] * (-1496.097) (-1496.018) (-1493.537) [-1495.577] -- 0:00:42
      379000 -- [-1494.318] (-1497.561) (-1497.775) (-1495.098) * [-1495.302] (-1497.654) (-1492.565) (-1497.712) -- 0:00:42
      379500 -- (-1496.046) (-1495.193) [-1494.600] (-1493.913) * (-1498.643) (-1495.457) (-1492.006) [-1495.911] -- 0:00:42
      380000 -- [-1493.039] (-1493.723) (-1492.183) (-1493.953) * (-1497.453) [-1495.581] (-1493.295) (-1494.639) -- 0:00:42

      Average standard deviation of split frequencies: 0.011377

      380500 -- (-1493.466) [-1493.654] (-1494.039) (-1495.343) * (-1497.484) (-1495.081) (-1493.908) [-1497.206] -- 0:00:42
      381000 -- (-1495.458) (-1492.937) (-1498.815) [-1494.341] * (-1497.859) (-1497.387) (-1493.336) [-1495.871] -- 0:00:42
      381500 -- (-1492.101) (-1495.645) [-1493.391] (-1496.389) * [-1494.675] (-1493.522) (-1497.640) (-1496.997) -- 0:00:42
      382000 -- (-1492.844) [-1497.385] (-1496.186) (-1497.790) * (-1496.247) [-1498.885] (-1500.631) (-1496.492) -- 0:00:42
      382500 -- (-1495.410) (-1491.027) [-1497.600] (-1501.049) * (-1493.976) (-1499.146) [-1497.586] (-1496.363) -- 0:00:41
      383000 -- [-1495.079] (-1495.247) (-1501.156) (-1497.197) * (-1493.201) [-1495.205] (-1499.349) (-1494.724) -- 0:00:41
      383500 -- (-1501.104) (-1494.191) [-1497.967] (-1497.738) * (-1498.567) [-1495.228] (-1496.855) (-1492.049) -- 0:00:41
      384000 -- (-1499.860) (-1498.938) (-1495.376) [-1495.335] * (-1501.549) (-1493.953) (-1493.155) [-1495.740] -- 0:00:41
      384500 -- [-1494.432] (-1493.963) (-1494.561) (-1494.926) * (-1496.546) [-1494.225] (-1497.969) (-1495.528) -- 0:00:43
      385000 -- (-1498.920) (-1498.390) [-1496.177] (-1496.541) * (-1493.494) (-1492.913) (-1495.833) [-1493.318] -- 0:00:43

      Average standard deviation of split frequencies: 0.010991

      385500 -- (-1495.494) (-1496.836) (-1494.161) [-1494.505] * (-1494.312) (-1495.029) (-1494.793) [-1495.432] -- 0:00:43
      386000 -- (-1494.912) (-1497.958) (-1497.545) [-1496.009] * (-1494.351) [-1494.552] (-1497.525) (-1497.065) -- 0:00:42
      386500 -- [-1497.994] (-1495.164) (-1496.629) (-1499.278) * (-1501.018) (-1498.719) [-1497.094] (-1496.900) -- 0:00:42
      387000 -- (-1494.651) [-1494.867] (-1496.657) (-1496.682) * (-1495.533) (-1493.909) [-1495.156] (-1495.614) -- 0:00:42
      387500 -- [-1495.959] (-1495.251) (-1496.520) (-1496.779) * (-1496.360) (-1497.226) (-1496.539) [-1496.199] -- 0:00:42
      388000 -- (-1492.300) [-1494.930] (-1497.831) (-1496.959) * (-1496.460) (-1497.571) [-1496.636] (-1492.933) -- 0:00:42
      388500 -- (-1493.308) (-1497.212) [-1495.361] (-1500.110) * (-1493.052) (-1495.863) (-1497.249) [-1492.702] -- 0:00:42
      389000 -- (-1495.874) [-1495.882] (-1499.913) (-1497.012) * (-1492.676) (-1495.324) [-1496.847] (-1492.356) -- 0:00:42
      389500 -- [-1497.874] (-1495.846) (-1498.913) (-1494.879) * (-1494.792) (-1500.820) (-1494.609) [-1492.392] -- 0:00:42
      390000 -- (-1496.262) (-1495.838) (-1498.623) [-1493.872] * (-1496.930) (-1499.412) (-1495.054) [-1499.284] -- 0:00:42

      Average standard deviation of split frequencies: 0.010332

      390500 -- [-1494.950] (-1496.702) (-1495.787) (-1495.151) * [-1497.096] (-1502.657) (-1496.140) (-1499.187) -- 0:00:42
      391000 -- (-1492.560) (-1494.961) [-1494.770] (-1496.389) * (-1495.658) (-1494.374) (-1499.310) [-1493.119] -- 0:00:42
      391500 -- [-1492.064] (-1499.303) (-1498.119) (-1493.495) * (-1496.064) [-1494.329] (-1496.637) (-1495.627) -- 0:00:41
      392000 -- (-1492.282) (-1500.187) (-1499.138) [-1499.800] * [-1496.992] (-1497.037) (-1498.637) (-1493.917) -- 0:00:41
      392500 -- [-1492.466] (-1496.200) (-1499.223) (-1493.884) * [-1495.420] (-1494.603) (-1497.641) (-1495.398) -- 0:00:41
      393000 -- (-1496.825) (-1497.276) (-1498.574) [-1494.847] * (-1497.668) (-1494.824) (-1493.517) [-1493.862] -- 0:00:41
      393500 -- (-1493.477) (-1499.529) [-1494.701] (-1493.862) * (-1494.417) (-1496.855) (-1493.968) [-1494.015] -- 0:00:41
      394000 -- (-1491.715) (-1494.928) (-1499.428) [-1493.079] * [-1496.936] (-1493.362) (-1499.760) (-1495.933) -- 0:00:41
      394500 -- (-1494.518) [-1491.893] (-1492.670) (-1496.026) * [-1493.747] (-1497.334) (-1499.248) (-1498.243) -- 0:00:41
      395000 -- (-1496.428) (-1497.801) [-1494.729] (-1493.604) * (-1494.000) [-1499.442] (-1494.931) (-1500.670) -- 0:00:41

      Average standard deviation of split frequencies: 0.010634

      395500 -- (-1494.139) (-1496.592) (-1499.017) [-1499.226] * (-1493.614) (-1495.919) (-1497.475) [-1497.454] -- 0:00:41
      396000 -- [-1494.827] (-1494.819) (-1497.961) (-1498.267) * [-1493.680] (-1496.906) (-1499.421) (-1499.222) -- 0:00:41
      396500 -- (-1497.636) [-1498.103] (-1495.611) (-1496.657) * (-1493.378) (-1493.456) [-1493.166] (-1501.928) -- 0:00:41
      397000 -- (-1497.257) (-1497.666) (-1494.678) [-1494.133] * (-1492.309) (-1494.799) (-1495.519) [-1498.750] -- 0:00:41
      397500 -- (-1500.074) (-1501.011) (-1497.057) [-1494.490] * (-1493.437) (-1500.234) [-1495.174] (-1496.710) -- 0:00:40
      398000 -- (-1497.270) (-1499.962) (-1493.668) [-1494.056] * (-1495.972) [-1495.895] (-1495.222) (-1497.675) -- 0:00:40
      398500 -- (-1501.024) (-1497.491) [-1492.556] (-1496.638) * (-1495.931) (-1493.297) [-1494.790] (-1497.369) -- 0:00:40
      399000 -- (-1496.879) (-1494.518) (-1496.813) [-1494.901] * (-1496.627) [-1494.200] (-1493.343) (-1494.000) -- 0:00:40
      399500 -- (-1498.244) (-1495.903) (-1498.849) [-1491.569] * (-1499.137) (-1496.826) [-1492.671] (-1494.107) -- 0:00:42
      400000 -- (-1494.095) (-1495.875) (-1496.549) [-1494.381] * (-1496.074) [-1494.195] (-1494.803) (-1500.896) -- 0:00:41

      Average standard deviation of split frequencies: 0.010810

      400500 -- (-1493.318) [-1494.288] (-1495.306) (-1492.863) * (-1493.040) [-1495.604] (-1495.049) (-1495.072) -- 0:00:41
      401000 -- (-1497.929) [-1492.419] (-1493.580) (-1494.875) * [-1495.225] (-1494.673) (-1500.043) (-1501.805) -- 0:00:41
      401500 -- (-1505.529) (-1493.850) [-1492.833] (-1495.259) * [-1495.619] (-1495.962) (-1492.675) (-1496.963) -- 0:00:41
      402000 -- [-1494.928] (-1498.168) (-1496.413) (-1494.761) * (-1495.685) (-1498.977) (-1493.069) [-1500.741] -- 0:00:41
      402500 -- (-1496.716) [-1493.057] (-1493.951) (-1507.869) * [-1494.484] (-1496.502) (-1494.207) (-1496.352) -- 0:00:41
      403000 -- (-1497.102) (-1500.950) [-1493.442] (-1497.567) * [-1494.968] (-1495.836) (-1495.392) (-1500.573) -- 0:00:41
      403500 -- [-1496.473] (-1495.167) (-1495.853) (-1496.730) * [-1494.190] (-1498.047) (-1497.886) (-1495.564) -- 0:00:41
      404000 -- (-1496.425) [-1499.104] (-1496.544) (-1495.235) * [-1491.876] (-1495.573) (-1498.163) (-1498.976) -- 0:00:41
      404500 -- [-1496.244] (-1496.527) (-1494.744) (-1497.396) * (-1494.629) (-1495.602) (-1494.983) [-1496.822] -- 0:00:41
      405000 -- [-1498.044] (-1497.492) (-1494.443) (-1495.119) * [-1494.946] (-1494.345) (-1502.071) (-1503.170) -- 0:00:41

      Average standard deviation of split frequencies: 0.010740

      405500 -- (-1496.969) [-1496.815] (-1496.751) (-1493.480) * (-1493.494) (-1497.976) [-1497.613] (-1499.948) -- 0:00:41
      406000 -- (-1495.724) (-1495.055) (-1497.863) [-1493.354] * (-1495.600) [-1496.387] (-1492.991) (-1498.996) -- 0:00:40
      406500 -- (-1497.158) (-1495.465) [-1498.185] (-1500.159) * (-1491.617) (-1497.179) (-1497.780) [-1497.084] -- 0:00:40
      407000 -- (-1496.363) (-1496.078) [-1494.908] (-1495.005) * [-1494.956] (-1494.627) (-1494.733) (-1497.124) -- 0:00:40
      407500 -- (-1499.308) (-1499.111) (-1496.502) [-1495.098] * (-1496.654) [-1499.174] (-1504.912) (-1496.754) -- 0:00:40
      408000 -- (-1495.503) (-1502.302) [-1494.097] (-1493.220) * (-1492.678) (-1498.781) (-1497.097) [-1499.550] -- 0:00:40
      408500 -- [-1493.186] (-1498.742) (-1496.779) (-1497.998) * (-1494.099) (-1498.528) [-1498.970] (-1494.806) -- 0:00:40
      409000 -- (-1495.359) (-1496.920) (-1494.028) [-1496.623] * (-1495.117) [-1495.595] (-1493.882) (-1494.110) -- 0:00:40
      409500 -- (-1495.234) [-1497.341] (-1495.702) (-1495.460) * (-1493.383) (-1494.923) (-1494.031) [-1494.725] -- 0:00:40
      410000 -- (-1498.620) (-1497.157) [-1493.924] (-1496.100) * [-1496.256] (-1495.982) (-1493.757) (-1501.659) -- 0:00:40

      Average standard deviation of split frequencies: 0.010044

      410500 -- (-1501.025) (-1495.985) (-1495.758) [-1495.449] * (-1494.448) [-1493.590] (-1494.870) (-1496.346) -- 0:00:40
      411000 -- [-1498.954] (-1497.260) (-1492.907) (-1493.299) * (-1495.966) (-1496.336) [-1493.523] (-1497.022) -- 0:00:40
      411500 -- [-1497.601] (-1496.794) (-1493.837) (-1493.076) * [-1493.267] (-1494.901) (-1495.361) (-1495.440) -- 0:00:40
      412000 -- (-1496.710) (-1497.319) (-1495.424) [-1497.521] * (-1494.764) (-1499.033) (-1498.026) [-1497.910] -- 0:00:39
      412500 -- (-1496.705) [-1497.116] (-1496.895) (-1494.713) * (-1496.001) (-1495.821) (-1494.746) [-1493.674] -- 0:00:39
      413000 -- (-1501.725) (-1495.442) (-1493.456) [-1493.476] * (-1495.263) [-1495.792] (-1492.082) (-1495.270) -- 0:00:39
      413500 -- (-1496.661) [-1494.527] (-1497.247) (-1494.035) * (-1499.781) (-1493.584) [-1494.609] (-1495.967) -- 0:00:39
      414000 -- [-1494.404] (-1495.859) (-1494.226) (-1492.809) * (-1495.510) (-1496.531) (-1495.106) [-1493.468] -- 0:00:41
      414500 -- [-1493.159] (-1493.821) (-1495.859) (-1496.912) * (-1493.956) (-1496.698) [-1491.619] (-1496.233) -- 0:00:40
      415000 -- (-1498.367) (-1494.752) (-1494.197) [-1492.680] * (-1494.301) [-1494.242] (-1494.545) (-1495.859) -- 0:00:40

      Average standard deviation of split frequencies: 0.009972

      415500 -- (-1499.274) (-1497.097) [-1496.172] (-1495.738) * (-1494.438) (-1494.922) [-1493.605] (-1496.178) -- 0:00:40
      416000 -- (-1494.748) (-1493.600) [-1496.723] (-1493.305) * (-1496.741) (-1496.212) [-1495.073] (-1498.883) -- 0:00:40
      416500 -- (-1497.606) (-1500.191) (-1499.270) [-1493.460] * (-1495.630) (-1494.637) [-1492.872] (-1493.924) -- 0:00:40
      417000 -- [-1495.006] (-1493.155) (-1500.941) (-1497.238) * (-1494.799) (-1497.973) [-1492.977] (-1496.495) -- 0:00:40
      417500 -- [-1493.996] (-1498.433) (-1499.931) (-1493.137) * [-1497.501] (-1493.795) (-1497.901) (-1498.170) -- 0:00:40
      418000 -- [-1495.130] (-1497.112) (-1499.173) (-1494.054) * (-1494.567) (-1493.751) [-1492.988] (-1494.872) -- 0:00:40
      418500 -- [-1494.579] (-1496.027) (-1496.863) (-1497.276) * [-1495.119] (-1493.118) (-1495.976) (-1493.832) -- 0:00:40
      419000 -- [-1494.503] (-1498.089) (-1497.158) (-1496.439) * [-1492.488] (-1495.690) (-1496.978) (-1499.561) -- 0:00:40
      419500 -- (-1497.336) (-1495.960) (-1496.757) [-1495.196] * (-1501.904) (-1494.800) [-1498.264] (-1495.723) -- 0:00:40
      420000 -- [-1497.001] (-1499.411) (-1497.403) (-1492.947) * (-1493.798) [-1492.297] (-1494.867) (-1496.298) -- 0:00:40

      Average standard deviation of split frequencies: 0.009875

      420500 -- (-1493.361) (-1498.475) (-1498.023) [-1492.955] * (-1495.993) (-1493.806) [-1493.787] (-1497.359) -- 0:00:39
      421000 -- (-1496.627) (-1495.157) (-1499.362) [-1497.744] * (-1498.948) [-1496.037] (-1498.399) (-1494.755) -- 0:00:39
      421500 -- (-1493.811) (-1495.711) (-1496.488) [-1497.373] * (-1492.015) (-1496.102) [-1495.513] (-1499.664) -- 0:00:39
      422000 -- [-1492.572] (-1496.603) (-1501.656) (-1497.808) * (-1494.518) (-1493.126) (-1502.161) [-1495.744] -- 0:00:39
      422500 -- [-1493.582] (-1500.447) (-1495.410) (-1494.238) * [-1494.160] (-1496.230) (-1495.307) (-1494.262) -- 0:00:39
      423000 -- (-1494.259) (-1502.308) [-1498.054] (-1493.141) * [-1492.381] (-1498.428) (-1493.800) (-1495.493) -- 0:00:39
      423500 -- [-1494.827] (-1495.402) (-1494.549) (-1493.265) * (-1494.826) (-1500.925) [-1493.141] (-1494.436) -- 0:00:39
      424000 -- (-1498.302) [-1493.940] (-1497.526) (-1495.541) * (-1495.581) (-1494.850) [-1492.924] (-1497.635) -- 0:00:39
      424500 -- [-1496.275] (-1494.842) (-1497.282) (-1496.213) * (-1495.211) (-1494.604) [-1492.764] (-1498.400) -- 0:00:39
      425000 -- (-1499.860) (-1492.729) [-1496.538] (-1492.662) * (-1502.183) (-1497.130) (-1495.791) [-1492.648] -- 0:00:39

      Average standard deviation of split frequencies: 0.010028

      425500 -- [-1498.682] (-1495.714) (-1493.249) (-1494.050) * (-1496.800) (-1493.560) (-1498.986) [-1492.849] -- 0:00:39
      426000 -- (-1494.944) (-1494.738) [-1492.149] (-1494.294) * (-1494.972) (-1493.074) (-1494.023) [-1494.086] -- 0:00:39
      426500 -- [-1492.317] (-1498.698) (-1492.729) (-1493.467) * (-1495.205) [-1494.408] (-1495.593) (-1494.676) -- 0:00:38
      427000 -- [-1495.214] (-1495.700) (-1493.583) (-1497.554) * (-1493.620) (-1494.537) [-1494.633] (-1498.836) -- 0:00:38
      427500 -- [-1497.737] (-1497.407) (-1492.994) (-1496.777) * (-1493.513) [-1493.180] (-1495.112) (-1497.186) -- 0:00:38
      428000 -- (-1498.096) (-1497.180) (-1495.050) [-1494.712] * (-1499.329) [-1495.666] (-1492.885) (-1497.561) -- 0:00:38
      428500 -- (-1492.945) (-1493.863) (-1497.457) [-1494.721] * (-1496.507) [-1497.379] (-1494.174) (-1496.076) -- 0:00:38
      429000 -- (-1497.255) (-1496.132) [-1492.553] (-1496.211) * (-1500.812) (-1496.453) (-1502.239) [-1495.872] -- 0:00:39
      429500 -- (-1493.263) (-1494.464) (-1493.893) [-1497.420] * (-1498.024) (-1494.161) [-1498.819] (-1493.923) -- 0:00:39
      430000 -- (-1495.729) (-1495.605) (-1494.480) [-1494.183] * (-1496.712) [-1496.275] (-1492.085) (-1497.783) -- 0:00:39

      Average standard deviation of split frequencies: 0.008894

      430500 -- (-1495.376) (-1493.626) (-1495.143) [-1497.145] * (-1495.538) [-1494.693] (-1493.657) (-1494.975) -- 0:00:39
      431000 -- (-1499.810) (-1501.037) [-1495.603] (-1495.643) * (-1493.374) (-1497.715) [-1492.676] (-1498.398) -- 0:00:39
      431500 -- [-1493.302] (-1498.807) (-1496.986) (-1497.906) * (-1493.752) [-1495.391] (-1492.762) (-1494.542) -- 0:00:39
      432000 -- (-1494.469) [-1494.749] (-1492.946) (-1497.876) * (-1493.382) (-1498.031) [-1495.168] (-1497.107) -- 0:00:39
      432500 -- (-1495.210) (-1495.920) [-1494.436] (-1497.891) * (-1492.252) (-1497.559) (-1494.513) [-1497.512] -- 0:00:39
      433000 -- (-1502.069) (-1493.692) (-1500.524) [-1495.167] * (-1494.842) [-1493.696] (-1497.381) (-1498.379) -- 0:00:39
      433500 -- (-1500.297) (-1493.789) [-1493.557] (-1497.636) * (-1496.274) (-1496.848) (-1497.785) [-1496.394] -- 0:00:39
      434000 -- (-1495.802) [-1498.311] (-1494.770) (-1494.497) * [-1492.734] (-1500.713) (-1499.430) (-1499.486) -- 0:00:39
      434500 -- (-1496.615) (-1498.450) [-1492.918] (-1494.849) * (-1495.790) (-1500.163) [-1495.951] (-1499.985) -- 0:00:39
      435000 -- (-1499.263) (-1501.359) (-1494.149) [-1495.629] * [-1498.544] (-1497.488) (-1496.608) (-1498.182) -- 0:00:38

      Average standard deviation of split frequencies: 0.008217

      435500 -- [-1495.149] (-1496.073) (-1495.562) (-1493.260) * [-1495.077] (-1496.407) (-1496.715) (-1493.704) -- 0:00:38
      436000 -- [-1494.664] (-1495.423) (-1493.219) (-1505.196) * [-1493.010] (-1493.888) (-1496.942) (-1495.182) -- 0:00:38
      436500 -- (-1494.578) (-1498.838) [-1491.757] (-1498.476) * [-1493.031] (-1497.255) (-1491.721) (-1498.659) -- 0:00:38
      437000 -- (-1493.718) [-1495.446] (-1492.981) (-1499.958) * (-1496.152) [-1494.237] (-1495.326) (-1497.011) -- 0:00:38
      437500 -- (-1500.360) (-1495.125) [-1495.502] (-1495.298) * (-1494.480) (-1494.360) (-1496.179) [-1496.850] -- 0:00:38
      438000 -- (-1493.178) (-1496.446) (-1493.869) [-1494.914] * (-1495.234) (-1494.217) [-1493.100] (-1497.639) -- 0:00:38
      438500 -- (-1496.466) [-1495.369] (-1494.689) (-1494.243) * (-1492.707) (-1498.084) [-1495.455] (-1495.416) -- 0:00:38
      439000 -- (-1492.945) (-1498.283) [-1493.548] (-1492.944) * (-1498.922) (-1496.349) [-1492.073] (-1494.218) -- 0:00:38
      439500 -- [-1495.329] (-1498.393) (-1496.169) (-1492.922) * (-1493.904) (-1498.460) (-1496.858) [-1492.400] -- 0:00:38
      440000 -- (-1495.468) (-1498.307) [-1493.352] (-1496.066) * (-1493.723) [-1498.732] (-1492.320) (-1493.475) -- 0:00:38

      Average standard deviation of split frequencies: 0.007555

      440500 -- (-1498.227) (-1500.083) (-1494.835) [-1495.519] * (-1494.067) (-1497.177) [-1494.248] (-1493.059) -- 0:00:38
      441000 -- [-1493.377] (-1496.263) (-1493.528) (-1494.674) * (-1495.170) (-1494.625) [-1493.767] (-1496.109) -- 0:00:38
      441500 -- (-1493.840) (-1497.437) (-1495.457) [-1500.533] * (-1496.232) (-1493.824) [-1493.957] (-1498.653) -- 0:00:37
      442000 -- (-1493.362) (-1496.383) [-1492.445] (-1499.603) * (-1497.876) (-1496.128) (-1497.196) [-1495.387] -- 0:00:37
      442500 -- (-1497.247) [-1497.124] (-1497.380) (-1496.232) * [-1493.519] (-1496.007) (-1496.634) (-1497.079) -- 0:00:37
      443000 -- [-1495.498] (-1501.651) (-1495.125) (-1495.295) * [-1494.530] (-1498.714) (-1495.960) (-1494.006) -- 0:00:37
      443500 -- [-1493.984] (-1494.426) (-1494.481) (-1494.976) * (-1493.356) (-1499.413) [-1494.030] (-1494.985) -- 0:00:38
      444000 -- (-1495.227) (-1496.204) (-1493.448) [-1493.480] * (-1492.778) (-1495.448) [-1494.959] (-1498.433) -- 0:00:38
      444500 -- (-1494.394) (-1494.679) (-1492.681) [-1497.062] * (-1494.195) (-1497.107) [-1493.637] (-1495.895) -- 0:00: