--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 13:35:47 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/purH/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.72 -2156.75 2 -2153.74 -2158.69 -------------------------------------- TOTAL -2153.73 -2158.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898221 0.093570 0.379140 1.534200 0.862866 1286.92 1322.55 1.000 r(A<->C){all} 0.156166 0.017703 0.000003 0.425193 0.119475 225.37 295.72 1.002 r(A<->G){all} 0.156552 0.017741 0.000019 0.423184 0.119026 247.30 321.80 1.000 r(A<->T){all} 0.175546 0.022628 0.000003 0.471364 0.131821 165.21 209.36 1.019 r(C<->G){all} 0.162331 0.018206 0.000059 0.441581 0.127992 205.57 209.63 1.004 r(C<->T){all} 0.162355 0.020198 0.000136 0.447295 0.123349 161.57 184.78 1.014 r(G<->T){all} 0.187050 0.022000 0.000009 0.491285 0.153497 146.56 273.24 1.002 pi(A){all} 0.193565 0.000096 0.174551 0.212454 0.193358 1167.98 1279.42 1.000 pi(C){all} 0.295848 0.000133 0.273629 0.318302 0.296082 1200.29 1229.81 1.000 pi(G){all} 0.315306 0.000141 0.291887 0.338246 0.315204 1299.18 1326.51 1.000 pi(T){all} 0.195281 0.000099 0.176463 0.214981 0.195203 1021.23 1240.10 1.000 alpha{1,2} 0.446857 0.238015 0.000125 1.429778 0.293101 1102.48 1178.96 1.001 alpha{3} 0.478156 0.250436 0.000606 1.459406 0.321519 1158.08 1194.76 1.001 pinvar{all} 0.999062 0.000001 0.997022 1.000000 0.999402 847.70 979.87 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2084.612939 Model 2: PositiveSelection -2084.612939 Model 0: one-ratio -2084.6132 Model 7: beta -2084.612939 Model 8: beta&w>1 -2084.612939 Model 0 vs 1 5.219999993641977E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C2 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C3 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C4 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C5 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C6 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=527 C1 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C2 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C3 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C4 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C5 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C6 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA ************************************************** C1 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C2 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C3 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C4 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C5 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C6 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE ************************************************** C1 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C2 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C3 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C4 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C5 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C6 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP ************************************************** C1 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C2 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C3 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C4 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C5 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C6 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM ************************************************** C1 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C2 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C3 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C4 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C5 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C6 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA ************************************************** C1 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C2 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C3 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C4 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C5 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C6 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS ************************************************** C1 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C2 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C3 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C4 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C5 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C6 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP ************************************************** C1 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C2 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C3 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C4 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C5 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C6 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA ************************************************** C1 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C2 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C3 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C4 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C5 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C6 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN ************************************************** C1 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C2 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C3 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C4 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C5 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C6 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS ************************************************** C1 VRDAEVTAAATKAGVTLYLTGVRHFVH C2 VRDAEVTAAATKAGVTLYLTGVRHFVH C3 VRDAEVTAAATKAGVTLYLTGVRHFVH C4 VRDAEVTAAATKAGVTLYLTGVRHFVH C5 VRDAEVTAAATKAGVTLYLTGVRHFVH C6 VRDAEVTAAATKAGVTLYLTGVRHFVH *************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 527 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 527 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15810] Library Relaxation: Multi_proc [96] Relaxation Summary: [15810]--->[15810] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.567 Mb, Max= 31.131 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C2 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C3 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C4 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C5 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA C6 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA ************************************************** C1 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C2 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C3 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C4 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C5 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE C6 IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE ************************************************** C1 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C2 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C3 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C4 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C5 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP C6 QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP ************************************************** C1 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C2 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C3 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C4 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C5 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM C6 SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM ************************************************** C1 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C2 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C3 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C4 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C5 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA C6 QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA ************************************************** C1 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C2 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C3 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C4 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C5 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS C6 QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS ************************************************** C1 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C2 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C3 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C4 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C5 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP C6 VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP ************************************************** C1 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C2 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C3 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C4 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C5 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA C6 GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA ************************************************** C1 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C2 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C3 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C4 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C5 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN C6 NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN ************************************************** C1 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C2 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C3 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C4 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C5 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS C6 RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS ************************************************** C1 VRDAEVTAAATKAGVTLYLTGVRHFVH C2 VRDAEVTAAATKAGVTLYLTGVRHFVH C3 VRDAEVTAAATKAGVTLYLTGVRHFVH C4 VRDAEVTAAATKAGVTLYLTGVRHFVH C5 VRDAEVTAAATKAGVTLYLTGVRHFVH C6 VRDAEVTAAATKAGVTLYLTGVRHFVH *************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC C2 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC C3 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC C4 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC C5 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC C6 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC ************************************************** C1 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC C2 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC C3 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC C4 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC C5 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC C6 GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC ************************************************** C1 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC C2 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC C3 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC C4 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC C5 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC C6 TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ************************************************** C1 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT C2 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT C3 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT C4 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT C5 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT C6 ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT ************************************************** C1 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG C2 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG C3 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG C4 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG C5 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG C6 CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG ************************************************** C1 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA C2 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA C3 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA C4 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA C5 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA C6 CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA ************************************************** C1 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT C2 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT C3 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT C4 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT C5 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT C6 CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT ************************************************** C1 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA C2 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA C3 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA C4 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA C5 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA C6 CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA ************************************************** C1 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC C2 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC C3 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC C4 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC C5 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC C6 TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC ************************************************** C1 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC C2 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC C3 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC C4 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC C5 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC C6 AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC ************************************************** C1 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA C2 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA C3 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA C4 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA C5 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA C6 GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA ************************************************** C1 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG C2 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG C3 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG C4 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG C5 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG C6 TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG ************************************************** C1 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT C2 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT C3 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT C4 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT C5 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT C6 CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT ************************************************** C1 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC C2 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC C3 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC C4 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC C5 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC C6 TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ************************************************** C1 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC C2 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC C3 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC C4 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC C5 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC C6 ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC ************************************************** C1 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA C2 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA C3 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA C4 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA C5 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA C6 CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA ************************************************** C1 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG C2 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG C3 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG C4 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG C5 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG C6 CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG ************************************************** C1 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG C2 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG C3 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG C4 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG C5 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG C6 CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG ************************************************** C1 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA C2 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA C3 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA C4 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA C5 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA C6 GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA ************************************************** C1 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT C2 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT C3 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT C4 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT C5 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT C6 CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ************************************************** C1 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA C2 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA C3 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA C4 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA C5 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA C6 ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA ************************************************** C1 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC C2 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC C3 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC C4 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC C5 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC C6 GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC ************************************************** C1 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC C2 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC C3 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC C4 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC C5 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC C6 CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC ************************************************** C1 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG C2 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG C3 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG C4 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG C5 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG C6 TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG ************************************************** C1 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA C2 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA C3 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA C4 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA C5 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA C6 AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA ************************************************** C1 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG C2 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG C3 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG C4 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG C5 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG C6 CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG ************************************************** C1 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC C2 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC C3 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC C4 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC C5 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC C6 TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC ************************************************** C1 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG C2 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG C3 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG C4 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG C5 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG C6 CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG ************************************************** C1 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC C2 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC C3 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC C4 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC C5 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC C6 TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC ************************************************** C1 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC C2 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC C3 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC C4 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC C5 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC C6 AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC ************************************************** C1 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT C2 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT C3 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT C4 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT C5 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT C6 GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT ************************************************** C1 GTATCTCACCGGAGTTCGCCACTTCGTGCAC C2 GTATCTCACCGGAGTTCGCCACTTCGTGCAC C3 GTATCTCACCGGAGTTCGCCACTTCGTGCAC C4 GTATCTCACCGGAGTTCGCCACTTCGTGCAC C5 GTATCTCACCGGAGTTCGCCACTTCGTGCAC C6 GTATCTCACCGGAGTTCGCCACTTCGTGCAC ******************************* >C1 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C2 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C3 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C4 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C5 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C6 ATGAGCAGTGACGGCGAGCGAGACATGGCAAGAAAACCGATTCGCCGCGC GTTGATCAGTGTATACGACAAGACCGGTCTGATTGACCTTGCCCAGGGTC TGAATGCGGCGGGTGTCGATATCGTCTCGACCGGATCGACCGCGAAAGCC ATTGCCGATCAAGGGATTGCGGTGACACCTGTGGAGGAACTGACCGGGTT CCCCGAGGTACTTGACGGCCGAGTCAAGACATTGCACCCTCGGGTTCATG CCGGACTGTTGGCCGACTTGCGTAAACCTGAACACGCCGCGGCGCTTGAA CAACTCGGAATTGAGGCATTCGAACTAGTTGTCGTCAACTTGTATCCGTT CAGCCAGACGGTCAAGTCCGGTGCGACTGTCGACGAATGTGTCGAACAGA TCGATATTGGCGGATCTTCGATGGTGCGAGCGGCCGCAAAGAACCATCCC AGTGTGGCGGTGGTCACCGACCCGCTTGGGTACGTTGGCGTGCTTGCCGC GGTGCAGGGCGGTGGGTTCACCCTTGCCGAGCGTAAAATGCTGGCTTCGA TGGCATTTCAGCACATAGCGGAATACGAAATCGCCGTCGCTAGTTGGATG CAGTCGACGCTGGCGCCCGAACAGCCACCAACGGCGTTTCCGCAGTGGTT TGGCCGGAGCTGGCGTCGCTCAGCAATTCTGCGCTACGGGGAGAACCCGC ACCAGCAGGCGGCCTTGTACAGCGACCCCAGTGCCTGTCCTGGCTTGGCC CAGGCCGAGCAGCTGCATGGGAAAAACATGTCCTACAACAACTTCACTGA CGCAGACGCAGCCTGGCGTGCTGCCTTCGACCACGAGCAGTCGTGCGTGG CAATCATCAAACATGCCAACCCGTGCGGGATTGCAATATCGTCGCTTTCG GTCGCCGACGCACATCGCAAGGCTCACGAATGCGACCCGTTGAGTGCCTA CGGCGGAGTTATTGCCGCCAATACTGAGGTCAGCCTTGAGATGGCAGAGT ACGTGAGCACCATCTTCACCGAGGTTATCGTTGCACCCTCCTACGCACCA GGCGCCGTCGACGTGCTGTCCTGCAAAAAAAACGTCCGAGTCTTGGTGGC CTCCGCACCGCTACGCGGTGGTAGCGAGCTACGGCCGGTCAGCGGGGGAC TGTTGATCCAGCAACCCGATCAGCTTGACACGGCCGGTGACAACCCAGCG AACTGGACCTTGGCAACCGGATCACCGGCCGGCCCGGCGACGTTGACGGA CTTGGTTTTTGCGTGGCGTGCCTGCCGCGCGGTGAAGTCGAACGCGATTG TGATCGCCGCCGACGGCGCCACCATAGGTGTTGGCATGGGTCAGGTTAAC CGAGTCGACGCCGCTCGACTTGCCGTTGAGCGTGGCGGCGACCGGGTCCG TGGCGCAGTGGTAGCTTCCGATGCGTTCTTTCCCTTTGCTGACGGACTTC AGACGCTGGCCGCGGCCGGAGTCACGGCGATAGTGCACCCCGGGGGCTCC GTGCGTGACGCGGAGGTTACCGCAGCCGCGACCAAAGCCGGGGTCACTTT GTATCTCACCGGAGTTCGCCACTTCGTGCAC >C1 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C2 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C3 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C4 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C5 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH >C6 MSSDGERDMARKPIRRALISVYDKTGLIDLAQGLNAAGVDIVSTGSTAKA IADQGIAVTPVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALE QLGIEAFELVVVNLYPFSQTVKSGATVDECVEQIDIGGSSMVRAAAKNHP SVAVVTDPLGYVGVLAAVQGGGFTLAERKMLASMAFQHIAEYEIAVASWM QSTLAPEQPPTAFPQWFGRSWRRSAILRYGENPHQQAALYSDPSACPGLA QAEQLHGKNMSYNNFTDADAAWRAAFDHEQSCVAIIKHANPCGIAISSLS VADAHRKAHECDPLSAYGGVIAANTEVSLEMAEYVSTIFTEVIVAPSYAP GAVDVLSCKKNVRVLVASAPLRGGSELRPVSGGLLIQQPDQLDTAGDNPA NWTLATGSPAGPATLTDLVFAWRACRAVKSNAIVIAADGATIGVGMGQVN RVDAARLAVERGGDRVRGAVVASDAFFPFADGLQTLAAAGVTAIVHPGGS VRDAEVTAAATKAGVTLYLTGVRHFVH MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1581 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579786460 Setting output file names to "/data/10res/purH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 560224748 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9612987822 Seed = 153805902 Swapseed = 1579786460 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3538.353794 -- -24.965149 Chain 2 -- -3538.353590 -- -24.965149 Chain 3 -- -3538.353255 -- -24.965149 Chain 4 -- -3538.353794 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3538.353590 -- -24.965149 Chain 2 -- -3538.353794 -- -24.965149 Chain 3 -- -3538.353590 -- -24.965149 Chain 4 -- -3538.353794 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3538.354] (-3538.354) (-3538.353) (-3538.354) * [-3538.354] (-3538.354) (-3538.354) (-3538.354) 500 -- (-2199.782) (-2170.596) (-2171.917) [-2178.681] * (-2183.213) [-2181.369] (-2192.289) (-2186.181) -- 0:00:00 1000 -- (-2180.699) (-2168.969) (-2162.945) [-2162.111] * (-2183.157) (-2167.253) [-2163.226] (-2162.642) -- 0:00:00 1500 -- (-2163.770) [-2159.055] (-2165.983) (-2158.887) * (-2160.510) (-2158.967) (-2169.456) [-2168.349] -- 0:00:00 2000 -- (-2169.067) (-2162.825) [-2162.326] (-2159.963) * (-2161.553) (-2164.216) (-2172.401) [-2161.246] -- 0:00:00 2500 -- (-2170.030) [-2157.288] (-2164.769) (-2162.403) * (-2158.596) [-2157.374] (-2161.784) (-2161.609) -- 0:00:00 3000 -- (-2162.438) (-2174.693) [-2162.563] (-2164.450) * (-2166.273) (-2167.592) (-2157.711) [-2160.239] -- 0:00:00 3500 -- (-2166.737) [-2164.504] (-2163.346) (-2159.309) * (-2165.875) [-2164.591] (-2165.596) (-2161.127) -- 0:00:00 4000 -- [-2161.394] (-2170.654) (-2161.550) (-2171.579) * [-2160.411] (-2159.338) (-2164.888) (-2161.984) -- 0:00:00 4500 -- (-2161.442) (-2160.508) (-2162.651) [-2159.004] * (-2161.099) (-2170.835) [-2158.711] (-2165.587) -- 0:00:00 5000 -- [-2159.381] (-2161.190) (-2165.164) (-2169.564) * (-2164.654) (-2167.111) [-2162.219] (-2159.502) -- 0:00:00 Average standard deviation of split frequencies: 0.075151 5500 -- [-2164.159] (-2159.850) (-2173.783) (-2158.513) * (-2167.248) (-2160.392) [-2163.250] (-2165.486) -- 0:00:00 6000 -- (-2162.620) [-2166.071] (-2166.062) (-2160.016) * (-2167.009) [-2163.585] (-2167.046) (-2163.345) -- 0:00:00 6500 -- (-2170.040) (-2163.101) (-2163.892) [-2158.019] * [-2166.288] (-2158.540) (-2165.030) (-2165.023) -- 0:00:00 7000 -- (-2160.008) (-2165.549) [-2161.432] (-2173.493) * (-2159.030) (-2161.882) [-2162.963] (-2162.893) -- 0:00:00 7500 -- (-2163.064) (-2164.254) [-2159.255] (-2157.472) * (-2161.383) (-2165.109) (-2165.518) [-2159.917] -- 0:00:00 8000 -- (-2166.041) [-2162.189] (-2164.479) (-2165.789) * (-2164.024) (-2173.977) [-2159.812] (-2159.349) -- 0:00:00 8500 -- (-2171.884) (-2167.845) [-2163.148] (-2158.460) * (-2178.687) [-2159.740] (-2158.878) (-2171.383) -- 0:00:00 9000 -- (-2161.149) (-2169.017) (-2163.595) [-2158.178] * (-2159.995) [-2162.635] (-2167.427) (-2162.017) -- 0:00:00 9500 -- (-2164.218) (-2164.189) (-2167.283) [-2160.104] * (-2157.223) [-2163.655] (-2161.927) (-2168.607) -- 0:00:00 10000 -- (-2159.022) [-2167.697] (-2162.042) (-2165.317) * (-2163.130) [-2161.234] (-2165.911) (-2158.568) -- 0:00:00 Average standard deviation of split frequencies: 0.073657 10500 -- [-2161.720] (-2160.931) (-2164.391) (-2162.340) * [-2163.888] (-2160.925) (-2166.469) (-2164.863) -- 0:00:00 11000 -- [-2163.678] (-2165.697) (-2164.963) (-2166.640) * (-2173.483) (-2160.540) [-2157.195] (-2173.393) -- 0:00:00 11500 -- (-2168.521) (-2161.128) (-2164.913) [-2163.065] * (-2160.870) (-2164.828) [-2161.872] (-2161.546) -- 0:00:00 12000 -- [-2166.143] (-2161.084) (-2165.377) (-2162.399) * [-2156.302] (-2163.353) (-2160.111) (-2166.183) -- 0:00:00 12500 -- (-2163.788) [-2165.271] (-2163.033) (-2175.161) * (-2154.334) (-2158.601) (-2168.436) [-2160.769] -- 0:01:19 13000 -- (-2167.956) (-2165.713) (-2165.005) [-2157.948] * (-2152.899) (-2160.673) [-2163.152] (-2163.590) -- 0:01:15 13500 -- (-2167.585) (-2162.509) (-2162.095) [-2160.143] * (-2155.007) (-2160.091) [-2160.469] (-2162.648) -- 0:01:13 14000 -- [-2173.089] (-2159.105) (-2165.934) (-2159.691) * (-2154.509) (-2165.562) (-2163.894) [-2159.844] -- 0:01:10 14500 -- [-2169.695] (-2165.386) (-2167.083) (-2159.324) * (-2152.750) (-2160.599) [-2158.001] (-2164.959) -- 0:01:07 15000 -- (-2172.624) (-2159.759) (-2171.045) [-2163.707] * (-2153.094) (-2162.124) (-2160.496) [-2163.538] -- 0:01:05 Average standard deviation of split frequencies: 0.052723 15500 -- (-2167.458) (-2166.495) (-2165.876) [-2162.831] * (-2153.209) (-2166.128) (-2162.128) [-2161.065] -- 0:01:03 16000 -- (-2155.786) [-2160.372] (-2167.520) (-2168.385) * (-2155.520) (-2165.528) [-2160.061] (-2166.469) -- 0:01:01 16500 -- (-2156.391) (-2164.438) (-2160.227) [-2162.359] * (-2153.976) (-2163.116) [-2167.711] (-2166.184) -- 0:00:59 17000 -- (-2156.397) [-2159.296] (-2165.568) (-2169.146) * [-2155.676] (-2166.292) (-2159.375) (-2160.549) -- 0:00:57 17500 -- (-2156.113) [-2157.623] (-2161.828) (-2163.101) * (-2157.187) [-2157.466] (-2161.586) (-2171.139) -- 0:00:56 18000 -- (-2155.588) (-2161.679) (-2172.609) [-2160.466] * (-2155.274) [-2152.937] (-2164.966) (-2160.542) -- 0:00:54 18500 -- [-2156.468] (-2158.472) (-2165.313) (-2162.549) * (-2156.703) [-2152.209] (-2158.704) (-2166.604) -- 0:00:53 19000 -- (-2157.686) (-2168.675) (-2160.685) [-2164.212] * (-2154.270) [-2152.164] (-2162.561) (-2158.606) -- 0:00:51 19500 -- (-2156.331) (-2169.396) (-2163.189) [-2156.806] * (-2154.165) [-2153.005] (-2157.967) (-2176.998) -- 0:00:50 20000 -- (-2156.715) [-2161.918] (-2165.615) (-2161.054) * (-2154.950) (-2153.301) [-2166.331] (-2163.302) -- 0:00:49 Average standard deviation of split frequencies: 0.046887 20500 -- (-2154.772) (-2165.198) [-2160.053] (-2158.359) * (-2155.243) (-2153.297) [-2165.158] (-2160.672) -- 0:00:47 21000 -- (-2153.733) [-2159.621] (-2162.522) (-2162.670) * (-2158.000) (-2153.304) [-2164.202] (-2166.521) -- 0:00:46 21500 -- (-2153.027) (-2166.913) [-2164.748] (-2158.556) * [-2154.006] (-2152.509) (-2168.689) (-2161.603) -- 0:00:45 22000 -- (-2153.033) [-2161.870] (-2164.768) (-2167.173) * (-2158.277) [-2152.509] (-2169.377) (-2157.944) -- 0:00:44 22500 -- [-2154.224] (-2160.661) (-2165.913) (-2161.057) * (-2156.862) (-2155.140) [-2164.419] (-2161.466) -- 0:00:43 23000 -- (-2154.063) (-2166.139) (-2161.235) [-2159.941] * (-2156.739) [-2154.524] (-2163.435) (-2168.253) -- 0:00:42 23500 -- (-2154.119) (-2165.135) [-2161.671] (-2162.520) * (-2155.264) (-2153.426) (-2161.661) [-2160.462] -- 0:00:41 24000 -- (-2153.912) (-2173.213) [-2162.984] (-2170.191) * [-2155.962] (-2153.055) (-2170.283) (-2159.745) -- 0:00:40 24500 -- (-2152.917) (-2169.444) [-2163.619] (-2163.911) * (-2154.197) (-2153.148) (-2165.143) [-2165.759] -- 0:00:39 25000 -- (-2152.812) (-2170.875) (-2167.407) [-2164.628] * (-2155.530) (-2153.758) [-2162.857] (-2163.800) -- 0:00:39 Average standard deviation of split frequencies: 0.037910 25500 -- (-2153.424) (-2168.616) [-2163.006] (-2166.840) * (-2161.315) [-2153.718] (-2164.371) (-2156.688) -- 0:00:38 26000 -- (-2153.533) [-2164.147] (-2165.600) (-2169.987) * (-2155.142) (-2153.718) (-2166.879) [-2162.319] -- 0:00:37 26500 -- (-2153.924) (-2166.444) (-2168.554) [-2160.985] * [-2157.188] (-2153.718) (-2178.992) (-2171.329) -- 0:01:13 27000 -- (-2155.979) [-2164.404] (-2172.108) (-2162.002) * (-2156.204) (-2153.717) (-2163.181) [-2160.381] -- 0:01:12 27500 -- (-2154.075) (-2159.726) (-2161.291) [-2159.445] * (-2158.537) [-2154.144] (-2175.984) (-2159.774) -- 0:01:10 28000 -- (-2154.472) (-2162.266) [-2156.534] (-2164.004) * (-2156.275) (-2154.070) (-2164.332) [-2160.630] -- 0:01:09 28500 -- (-2156.614) [-2161.350] (-2158.249) (-2161.898) * (-2154.924) (-2154.195) (-2161.815) [-2158.124] -- 0:01:08 29000 -- (-2153.797) (-2163.544) (-2156.566) [-2162.892] * (-2154.706) [-2153.936] (-2155.120) (-2160.947) -- 0:01:06 29500 -- (-2154.571) (-2162.923) (-2157.027) [-2162.309] * [-2153.090] (-2153.873) (-2156.637) (-2165.876) -- 0:01:05 30000 -- (-2153.121) [-2161.979] (-2154.662) (-2163.257) * (-2152.967) [-2153.395] (-2154.155) (-2168.562) -- 0:01:04 Average standard deviation of split frequencies: 0.037332 30500 -- (-2153.765) [-2162.779] (-2153.389) (-2164.608) * [-2152.967] (-2153.335) (-2155.119) (-2166.017) -- 0:01:03 31000 -- [-2153.235] (-2163.136) (-2154.138) (-2163.133) * (-2158.233) (-2153.329) (-2154.539) [-2164.222] -- 0:01:02 31500 -- (-2152.690) [-2160.726] (-2154.759) (-2169.692) * [-2158.844] (-2155.644) (-2155.665) (-2166.562) -- 0:01:01 32000 -- (-2153.180) (-2163.230) (-2154.676) [-2166.479] * (-2160.192) (-2156.019) (-2155.594) [-2159.516] -- 0:01:00 32500 -- [-2153.586] (-2158.257) (-2156.774) (-2168.231) * [-2153.589] (-2153.853) (-2155.057) (-2160.651) -- 0:00:59 33000 -- (-2154.114) [-2160.492] (-2157.143) (-2171.587) * (-2154.233) (-2154.504) [-2155.848] (-2161.833) -- 0:00:58 33500 -- (-2154.635) (-2170.133) [-2155.572] (-2167.318) * (-2154.896) [-2154.662] (-2155.044) (-2166.212) -- 0:00:57 34000 -- (-2155.662) (-2156.909) [-2154.516] (-2164.767) * (-2154.238) (-2155.011) (-2155.281) [-2159.249] -- 0:00:56 34500 -- (-2153.787) [-2161.165] (-2154.277) (-2165.511) * (-2154.789) (-2155.150) (-2155.097) [-2163.081] -- 0:00:55 35000 -- (-2153.959) [-2162.782] (-2159.071) (-2164.354) * (-2154.427) (-2154.476) (-2157.517) [-2162.270] -- 0:00:55 Average standard deviation of split frequencies: 0.031703 35500 -- (-2153.528) [-2164.310] (-2155.714) (-2161.029) * (-2154.723) (-2155.713) [-2159.001] (-2165.637) -- 0:00:54 36000 -- (-2153.879) [-2169.498] (-2152.666) (-2164.057) * (-2153.480) (-2155.514) (-2156.501) [-2160.979] -- 0:00:53 36500 -- (-2154.796) [-2163.081] (-2153.363) (-2163.355) * (-2153.672) (-2154.914) (-2159.036) [-2164.410] -- 0:00:52 37000 -- (-2154.963) (-2163.986) (-2153.372) [-2168.623] * (-2153.786) [-2154.148] (-2158.287) (-2166.175) -- 0:00:52 37500 -- (-2154.496) (-2170.268) [-2155.363] (-2160.808) * [-2156.425] (-2153.105) (-2153.490) (-2164.050) -- 0:00:51 38000 -- (-2155.394) (-2160.892) [-2155.237] (-2165.335) * (-2157.103) (-2153.104) [-2153.215] (-2161.335) -- 0:00:50 38500 -- (-2155.199) (-2171.803) [-2154.220] (-2164.071) * (-2154.583) [-2154.224] (-2155.000) (-2172.328) -- 0:00:49 39000 -- [-2152.693] (-2164.048) (-2152.561) (-2166.019) * (-2154.159) [-2153.645] (-2156.366) (-2163.422) -- 0:00:49 39500 -- (-2154.078) (-2160.051) (-2152.826) [-2161.915] * [-2153.603] (-2153.823) (-2155.907) (-2165.733) -- 0:00:48 40000 -- (-2153.441) (-2160.735) (-2156.465) [-2163.630] * (-2154.633) (-2155.159) [-2156.748] (-2165.088) -- 0:00:48 Average standard deviation of split frequencies: 0.032457 40500 -- (-2152.658) (-2166.953) (-2154.469) [-2162.008] * (-2154.633) [-2154.644] (-2155.940) (-2164.199) -- 0:01:11 41000 -- (-2153.080) (-2168.356) (-2152.469) [-2171.596] * [-2154.957] (-2153.961) (-2154.401) (-2164.007) -- 0:01:10 41500 -- (-2154.562) (-2168.076) [-2152.834] (-2175.971) * [-2154.313] (-2153.189) (-2154.328) (-2164.850) -- 0:01:09 42000 -- (-2153.843) [-2158.378] (-2153.106) (-2161.805) * (-2154.474) (-2158.445) (-2153.023) [-2157.814] -- 0:01:08 42500 -- (-2156.381) [-2159.303] (-2153.802) (-2165.495) * [-2155.686] (-2159.988) (-2153.327) (-2157.503) -- 0:01:07 43000 -- (-2154.750) (-2166.235) (-2154.397) [-2159.989] * (-2157.763) (-2156.737) (-2152.880) [-2162.588] -- 0:01:06 43500 -- [-2152.965] (-2168.632) (-2155.003) (-2160.642) * (-2157.754) (-2157.495) [-2153.718] (-2165.400) -- 0:01:05 44000 -- (-2155.155) [-2163.670] (-2155.757) (-2161.631) * (-2156.260) (-2156.608) [-2152.633] (-2177.811) -- 0:01:05 44500 -- [-2152.996] (-2159.571) (-2155.430) (-2167.652) * (-2153.668) (-2155.722) (-2153.141) [-2168.919] -- 0:01:04 45000 -- (-2152.902) (-2164.773) (-2156.192) [-2157.702] * (-2153.216) (-2154.922) (-2153.046) [-2164.914] -- 0:01:03 Average standard deviation of split frequencies: 0.031232 45500 -- (-2152.911) (-2163.939) (-2155.005) [-2160.694] * [-2152.959] (-2158.462) (-2153.329) (-2163.285) -- 0:01:02 46000 -- (-2153.747) (-2162.846) (-2159.571) [-2168.271] * [-2160.758] (-2153.645) (-2153.329) (-2165.223) -- 0:01:02 46500 -- (-2157.299) (-2165.505) (-2156.234) [-2165.639] * (-2158.549) (-2153.535) [-2153.344] (-2160.417) -- 0:01:01 47000 -- (-2155.294) [-2157.589] (-2156.178) (-2179.766) * (-2153.550) [-2154.569] (-2154.263) (-2163.448) -- 0:01:00 47500 -- (-2153.885) [-2156.773] (-2154.831) (-2169.819) * (-2154.353) (-2156.649) (-2154.258) [-2162.906] -- 0:01:00 48000 -- (-2154.420) (-2157.303) [-2155.984] (-2170.223) * (-2154.226) (-2153.912) [-2157.013] (-2160.851) -- 0:00:59 48500 -- (-2155.805) [-2153.478] (-2157.854) (-2163.389) * (-2155.169) [-2154.237] (-2154.277) (-2169.470) -- 0:00:58 49000 -- (-2153.612) [-2154.180] (-2153.117) (-2169.283) * (-2156.543) (-2154.860) (-2158.461) [-2163.675] -- 0:00:58 49500 -- [-2153.628] (-2153.953) (-2153.301) (-2161.940) * [-2157.858] (-2153.800) (-2154.175) (-2164.224) -- 0:00:57 50000 -- (-2154.701) (-2153.400) [-2152.588] (-2166.706) * (-2158.682) (-2153.634) [-2155.664] (-2162.807) -- 0:00:57 Average standard deviation of split frequencies: 0.029241 50500 -- [-2153.897] (-2153.164) (-2153.404) (-2163.237) * [-2156.561] (-2153.477) (-2154.791) (-2165.689) -- 0:00:56 51000 -- (-2153.577) (-2154.326) [-2153.325] (-2164.335) * (-2157.080) (-2153.454) (-2155.050) [-2160.151] -- 0:00:55 51500 -- (-2155.575) (-2155.513) (-2153.134) [-2162.870] * [-2153.913] (-2155.280) (-2156.458) (-2158.870) -- 0:00:55 52000 -- (-2153.575) [-2154.301] (-2154.071) (-2160.379) * (-2154.032) (-2157.961) (-2154.549) [-2159.465] -- 0:00:54 52500 -- (-2153.575) [-2153.436] (-2155.104) (-2164.713) * (-2154.190) (-2159.184) [-2154.052] (-2163.131) -- 0:00:54 53000 -- (-2153.806) (-2153.436) (-2155.104) [-2163.600] * [-2154.437] (-2155.056) (-2153.753) (-2164.768) -- 0:00:53 53500 -- (-2153.541) (-2153.436) [-2154.419] (-2169.644) * (-2155.582) (-2154.034) [-2154.368] (-2165.168) -- 0:00:53 54000 -- (-2155.087) (-2153.742) (-2156.043) [-2163.845] * (-2156.748) [-2154.207] (-2161.268) (-2164.510) -- 0:00:52 54500 -- (-2156.936) (-2157.419) [-2154.714] (-2158.750) * (-2158.477) (-2157.385) (-2157.856) [-2165.608] -- 0:01:09 55000 -- (-2155.708) (-2153.039) (-2153.557) [-2164.912] * (-2154.939) (-2158.603) [-2154.700] (-2163.516) -- 0:01:08 Average standard deviation of split frequencies: 0.035202 55500 -- (-2155.899) (-2153.586) (-2154.507) [-2164.159] * (-2156.663) (-2154.720) [-2155.696] (-2161.668) -- 0:01:08 56000 -- (-2155.071) (-2153.421) [-2154.507] (-2168.942) * (-2162.206) [-2154.547] (-2157.703) (-2170.562) -- 0:01:07 56500 -- (-2154.939) (-2152.053) (-2154.578) [-2162.912] * (-2154.008) (-2156.412) [-2157.919] (-2170.322) -- 0:01:06 57000 -- (-2156.445) [-2152.053] (-2154.986) (-2162.854) * [-2153.811] (-2153.592) (-2159.610) (-2160.662) -- 0:01:06 57500 -- [-2154.517] (-2153.565) (-2154.360) (-2173.828) * [-2153.353] (-2153.677) (-2157.713) (-2167.824) -- 0:01:05 58000 -- [-2154.750] (-2155.101) (-2153.679) (-2164.512) * (-2160.294) (-2155.935) (-2155.842) [-2161.033] -- 0:01:04 58500 -- (-2157.859) [-2154.721] (-2158.951) (-2165.550) * (-2153.146) [-2154.702] (-2156.411) (-2170.360) -- 0:01:04 59000 -- (-2155.389) (-2154.630) (-2152.850) [-2163.828] * (-2152.967) [-2154.617] (-2156.131) (-2163.523) -- 0:01:03 59500 -- (-2155.503) (-2159.195) (-2152.772) [-2159.763] * [-2152.747] (-2154.311) (-2153.623) (-2163.310) -- 0:01:03 60000 -- (-2156.751) (-2161.362) (-2156.553) [-2156.116] * (-2156.103) (-2154.346) (-2154.161) [-2157.879] -- 0:01:02 Average standard deviation of split frequencies: 0.033801 60500 -- (-2155.612) (-2156.618) [-2157.740] (-2154.764) * (-2157.963) (-2156.462) (-2154.262) [-2161.810] -- 0:01:02 61000 -- [-2152.852] (-2157.513) (-2158.408) (-2152.421) * (-2158.413) (-2158.199) (-2154.377) [-2163.542] -- 0:01:01 61500 -- (-2153.921) (-2153.965) (-2154.531) [-2152.469] * (-2156.345) (-2153.208) [-2155.374] (-2160.873) -- 0:01:01 62000 -- (-2154.504) (-2156.742) (-2152.955) [-2153.640] * (-2153.553) (-2153.262) (-2155.277) [-2161.465] -- 0:01:00 62500 -- [-2155.323] (-2153.998) (-2153.484) (-2152.936) * [-2154.902] (-2156.448) (-2154.329) (-2167.506) -- 0:01:00 63000 -- [-2153.898] (-2155.416) (-2152.419) (-2153.375) * (-2154.711) (-2153.575) (-2153.936) [-2161.629] -- 0:00:59 63500 -- (-2156.025) (-2154.375) [-2152.567] (-2153.416) * (-2152.838) [-2154.270] (-2155.105) (-2164.233) -- 0:00:58 64000 -- (-2153.556) (-2153.745) (-2152.897) [-2157.026] * [-2152.590] (-2154.376) (-2156.048) (-2168.798) -- 0:00:58 64500 -- (-2153.046) [-2153.753] (-2152.520) (-2153.952) * (-2153.334) (-2155.290) [-2154.919] (-2159.548) -- 0:00:58 65000 -- [-2153.359] (-2158.744) (-2153.432) (-2153.982) * [-2153.454] (-2154.097) (-2156.845) (-2165.682) -- 0:00:57 Average standard deviation of split frequencies: 0.036955 65500 -- (-2152.956) (-2153.208) [-2153.135] (-2156.505) * [-2154.734] (-2153.311) (-2152.448) (-2160.601) -- 0:00:57 66000 -- [-2153.036] (-2157.143) (-2152.509) (-2156.132) * (-2154.346) (-2152.309) [-2153.465] (-2158.980) -- 0:00:56 66500 -- (-2153.429) (-2153.796) [-2152.982] (-2157.875) * [-2154.900] (-2152.864) (-2156.216) (-2173.854) -- 0:00:56 67000 -- [-2156.849] (-2153.720) (-2152.888) (-2162.583) * (-2152.918) [-2153.405] (-2156.527) (-2165.117) -- 0:00:55 67500 -- [-2154.072] (-2155.173) (-2152.888) (-2159.604) * [-2153.578] (-2153.775) (-2164.790) (-2163.711) -- 0:00:55 68000 -- [-2153.298] (-2156.213) (-2153.368) (-2155.226) * [-2152.736] (-2154.360) (-2158.909) (-2167.154) -- 0:00:54 68500 -- [-2153.170] (-2155.753) (-2152.759) (-2153.795) * (-2156.087) (-2155.261) [-2155.150] (-2162.985) -- 0:00:54 69000 -- (-2153.197) [-2153.241] (-2154.127) (-2153.903) * (-2156.021) (-2154.906) (-2157.453) [-2159.276] -- 0:01:07 69500 -- (-2154.355) (-2153.493) [-2152.594] (-2154.444) * [-2155.297] (-2154.482) (-2155.635) (-2166.906) -- 0:01:06 70000 -- (-2155.168) (-2152.729) [-2152.821] (-2153.835) * (-2153.129) (-2158.638) [-2155.526] (-2169.870) -- 0:01:06 Average standard deviation of split frequencies: 0.036993 70500 -- (-2153.539) [-2156.645] (-2152.913) (-2155.281) * (-2154.706) (-2154.110) [-2155.371] (-2165.697) -- 0:01:05 71000 -- [-2154.460] (-2157.794) (-2152.913) (-2153.514) * [-2154.775] (-2152.525) (-2155.655) (-2160.110) -- 0:01:05 71500 -- (-2153.312) [-2153.962] (-2152.647) (-2154.230) * [-2155.762] (-2153.042) (-2155.948) (-2161.515) -- 0:01:04 72000 -- (-2157.629) (-2153.890) (-2153.706) [-2154.441] * (-2154.983) (-2152.551) [-2157.792] (-2163.714) -- 0:01:04 72500 -- (-2161.741) (-2154.460) [-2156.439] (-2152.641) * [-2152.979] (-2153.677) (-2157.734) (-2160.867) -- 0:01:03 73000 -- [-2153.209] (-2157.409) (-2153.875) (-2152.438) * (-2153.109) (-2155.897) [-2156.455] (-2161.824) -- 0:01:03 73500 -- (-2153.370) [-2154.394] (-2154.956) (-2153.220) * (-2153.232) (-2153.117) (-2153.726) [-2165.562] -- 0:01:03 74000 -- (-2154.788) (-2153.978) [-2154.336] (-2152.649) * (-2153.232) [-2152.772] (-2153.684) (-2158.602) -- 0:01:02 74500 -- (-2153.597) [-2153.656] (-2154.673) (-2152.344) * (-2153.574) (-2153.474) [-2154.884] (-2163.641) -- 0:01:02 75000 -- [-2154.058] (-2154.768) (-2153.513) (-2153.894) * (-2153.393) (-2156.135) (-2154.313) [-2158.632] -- 0:01:01 Average standard deviation of split frequencies: 0.033495 75500 -- (-2154.545) (-2155.655) [-2154.383] (-2152.827) * (-2154.162) (-2161.047) [-2156.783] (-2162.116) -- 0:01:01 76000 -- (-2156.445) (-2155.615) [-2156.539] (-2154.941) * (-2154.161) (-2160.868) [-2160.545] (-2165.472) -- 0:01:00 76500 -- (-2155.412) [-2154.845] (-2154.979) (-2153.819) * (-2157.087) [-2160.301] (-2158.601) (-2164.586) -- 0:01:00 77000 -- (-2155.735) (-2160.321) (-2160.053) [-2155.495] * (-2159.108) (-2153.301) (-2156.623) [-2165.147] -- 0:00:59 77500 -- (-2153.586) [-2153.347] (-2157.842) (-2155.040) * (-2154.401) (-2158.139) (-2153.941) [-2165.836] -- 0:00:59 78000 -- [-2155.128] (-2153.864) (-2157.713) (-2154.303) * (-2153.682) (-2157.174) (-2154.274) [-2159.920] -- 0:00:59 78500 -- (-2154.040) (-2153.423) (-2156.553) [-2154.917] * (-2157.859) (-2155.866) (-2157.649) [-2168.587] -- 0:00:58 79000 -- [-2154.441] (-2156.536) (-2156.307) (-2156.032) * (-2156.562) [-2156.719] (-2156.085) (-2170.085) -- 0:00:58 79500 -- (-2153.561) (-2156.718) (-2155.860) [-2155.019] * (-2154.045) (-2154.832) [-2154.757] (-2161.726) -- 0:00:57 80000 -- (-2154.600) (-2157.376) [-2155.094] (-2153.698) * [-2154.538] (-2154.252) (-2156.607) (-2165.223) -- 0:00:57 Average standard deviation of split frequencies: 0.029834 80500 -- (-2153.365) (-2153.943) (-2153.269) [-2154.615] * (-2152.843) [-2156.255] (-2154.273) (-2163.995) -- 0:00:57 81000 -- [-2152.132] (-2157.477) (-2153.198) (-2153.503) * [-2152.252] (-2156.310) (-2153.017) (-2167.782) -- 0:00:56 81500 -- [-2152.133] (-2159.371) (-2153.515) (-2152.522) * [-2152.242] (-2163.654) (-2152.853) (-2164.698) -- 0:00:56 82000 -- (-2152.144) [-2156.275] (-2153.774) (-2154.165) * (-2152.242) (-2155.690) [-2153.059] (-2163.329) -- 0:00:55 82500 -- (-2152.133) [-2153.940] (-2153.372) (-2155.504) * [-2152.965] (-2156.729) (-2152.691) (-2162.980) -- 0:00:55 83000 -- (-2154.964) (-2155.245) [-2153.564] (-2154.712) * [-2154.530] (-2155.343) (-2154.150) (-2163.123) -- 0:00:55 83500 -- (-2154.491) (-2154.710) (-2153.638) [-2153.068] * [-2153.394] (-2154.445) (-2154.138) (-2167.571) -- 0:00:54 84000 -- (-2153.500) (-2153.268) [-2155.388] (-2155.845) * (-2153.505) (-2156.360) [-2152.443] (-2162.547) -- 0:01:05 84500 -- [-2153.561] (-2154.743) (-2152.722) (-2153.784) * (-2154.259) (-2154.607) (-2154.762) [-2160.451] -- 0:01:05 85000 -- [-2154.003] (-2154.548) (-2152.893) (-2154.221) * (-2155.704) (-2155.088) (-2154.829) [-2164.598] -- 0:01:04 Average standard deviation of split frequencies: 0.030869 85500 -- (-2154.636) [-2153.877] (-2154.922) (-2154.792) * [-2154.540] (-2157.069) (-2152.162) (-2167.300) -- 0:01:04 86000 -- (-2157.108) (-2155.737) (-2155.860) [-2155.959] * (-2154.758) [-2153.707] (-2155.339) (-2164.056) -- 0:01:03 86500 -- [-2154.208] (-2155.636) (-2159.712) (-2156.583) * (-2159.092) (-2153.686) [-2152.522] (-2161.511) -- 0:01:03 87000 -- (-2153.429) (-2155.338) (-2161.484) [-2154.146] * [-2153.979] (-2155.803) (-2157.277) (-2164.209) -- 0:01:02 87500 -- (-2153.616) (-2153.720) [-2158.009] (-2156.183) * (-2154.299) (-2156.193) [-2157.249] (-2162.640) -- 0:01:02 88000 -- (-2155.915) [-2154.250] (-2155.256) (-2153.020) * (-2156.743) (-2157.663) [-2153.626] (-2166.225) -- 0:01:02 88500 -- (-2158.937) [-2154.695] (-2154.439) (-2157.968) * (-2153.318) (-2158.902) [-2153.782] (-2173.425) -- 0:01:01 89000 -- (-2160.009) [-2155.315] (-2156.929) (-2154.332) * [-2155.371] (-2158.806) (-2157.111) (-2161.478) -- 0:01:01 89500 -- [-2152.524] (-2154.259) (-2158.626) (-2154.053) * (-2155.657) (-2156.295) [-2157.317] (-2169.403) -- 0:01:01 90000 -- [-2152.567] (-2156.663) (-2157.063) (-2152.875) * (-2155.789) (-2157.594) (-2155.052) [-2167.921] -- 0:01:00 Average standard deviation of split frequencies: 0.026776 90500 -- (-2156.400) [-2156.248] (-2155.899) (-2153.241) * (-2158.624) (-2156.686) [-2156.058] (-2170.684) -- 0:01:00 91000 -- (-2152.842) (-2157.465) (-2154.952) [-2153.267] * (-2158.324) (-2156.769) [-2153.584] (-2166.809) -- 0:00:59 91500 -- [-2157.148] (-2155.875) (-2155.608) (-2153.748) * (-2159.040) [-2153.751] (-2153.782) (-2166.599) -- 0:00:59 92000 -- (-2153.604) [-2153.447] (-2154.181) (-2154.985) * (-2154.645) (-2154.840) [-2154.163] (-2160.751) -- 0:00:59 92500 -- [-2154.276] (-2155.734) (-2154.018) (-2152.877) * (-2153.208) [-2155.315] (-2153.275) (-2166.192) -- 0:00:58 93000 -- (-2154.071) (-2155.154) (-2153.615) [-2153.912] * [-2153.191] (-2154.588) (-2153.285) (-2160.181) -- 0:00:58 93500 -- (-2153.746) (-2155.298) (-2154.116) [-2155.285] * (-2152.219) (-2152.794) (-2154.880) [-2164.549] -- 0:00:58 94000 -- (-2155.117) [-2157.454] (-2154.113) (-2154.499) * (-2155.070) (-2154.989) [-2154.477] (-2162.858) -- 0:00:57 94500 -- (-2153.971) (-2155.047) [-2156.433] (-2157.226) * (-2153.787) [-2154.398] (-2155.129) (-2166.757) -- 0:00:57 95000 -- [-2153.172] (-2156.276) (-2153.661) (-2156.446) * (-2156.391) [-2154.338] (-2154.638) (-2161.268) -- 0:00:57 Average standard deviation of split frequencies: 0.026189 95500 -- (-2156.035) (-2156.549) (-2152.918) [-2153.979] * (-2154.406) [-2154.867] (-2154.947) (-2169.215) -- 0:00:56 96000 -- [-2154.311] (-2156.170) (-2152.953) (-2154.291) * [-2154.889] (-2155.061) (-2153.318) (-2166.934) -- 0:00:56 96500 -- (-2154.241) [-2155.149] (-2155.451) (-2155.119) * [-2154.334] (-2154.208) (-2153.196) (-2165.925) -- 0:00:56 97000 -- (-2155.841) (-2157.040) (-2153.218) [-2152.287] * (-2157.028) (-2155.047) [-2153.702] (-2166.599) -- 0:00:55 97500 -- (-2155.404) [-2156.417] (-2153.194) (-2152.287) * (-2158.194) [-2154.173] (-2153.790) (-2165.490) -- 0:00:55 98000 -- [-2155.933] (-2155.328) (-2152.704) (-2152.274) * (-2152.366) (-2154.212) [-2154.458] (-2166.069) -- 0:00:55 98500 -- [-2153.239] (-2157.792) (-2155.288) (-2153.215) * [-2152.366] (-2152.704) (-2153.305) (-2161.564) -- 0:00:54 99000 -- (-2154.914) (-2158.115) (-2153.694) [-2152.681] * (-2153.669) (-2152.811) (-2153.471) [-2167.427] -- 0:01:03 99500 -- (-2155.642) (-2159.389) [-2152.972] (-2152.252) * (-2154.019) (-2152.480) [-2153.229] (-2170.712) -- 0:01:03 100000 -- (-2154.746) (-2154.177) (-2153.361) [-2152.090] * (-2156.629) [-2155.180] (-2155.578) (-2159.303) -- 0:01:02 Average standard deviation of split frequencies: 0.028617 100500 -- (-2152.950) (-2154.950) (-2153.007) [-2152.770] * [-2155.766] (-2153.975) (-2157.420) (-2160.919) -- 0:01:02 101000 -- [-2153.081] (-2156.358) (-2154.405) (-2152.622) * (-2158.357) [-2153.405] (-2155.267) (-2163.239) -- 0:01:02 101500 -- [-2153.128] (-2159.901) (-2153.502) (-2155.676) * (-2158.018) [-2153.297] (-2154.334) (-2165.867) -- 0:01:01 102000 -- (-2153.569) [-2160.471] (-2153.947) (-2160.188) * (-2159.051) (-2158.823) [-2153.007] (-2162.327) -- 0:01:01 102500 -- (-2154.855) (-2152.204) [-2153.452] (-2156.950) * [-2153.347] (-2154.588) (-2155.257) (-2165.806) -- 0:01:01 103000 -- [-2152.508] (-2152.613) (-2156.780) (-2156.105) * [-2154.479] (-2154.647) (-2156.819) (-2171.902) -- 0:01:00 103500 -- (-2154.647) (-2153.512) (-2154.338) [-2156.327] * (-2154.207) (-2155.175) [-2158.457] (-2163.174) -- 0:01:00 104000 -- (-2152.794) (-2153.369) [-2155.480] (-2156.009) * (-2153.522) (-2155.821) (-2156.520) [-2167.140] -- 0:01:00 104500 -- (-2152.689) (-2153.045) [-2153.054] (-2156.386) * (-2154.559) (-2159.598) [-2155.675] (-2166.204) -- 0:00:59 105000 -- (-2154.467) [-2152.590] (-2154.205) (-2156.621) * (-2154.506) (-2159.903) (-2153.013) [-2158.820] -- 0:00:59 Average standard deviation of split frequencies: 0.024904 105500 -- (-2153.271) (-2152.547) [-2152.992] (-2155.710) * [-2154.954] (-2153.495) (-2152.421) (-2164.380) -- 0:00:59 106000 -- (-2153.215) (-2152.735) [-2153.961] (-2155.171) * (-2153.826) (-2152.876) [-2153.238] (-2169.735) -- 0:00:59 106500 -- [-2155.714] (-2152.790) (-2154.471) (-2156.559) * [-2152.435] (-2154.556) (-2152.870) (-2172.156) -- 0:00:58 107000 -- [-2156.248] (-2153.082) (-2154.550) (-2154.178) * [-2154.468] (-2153.644) (-2152.944) (-2167.754) -- 0:00:58 107500 -- (-2153.664) [-2154.519] (-2155.559) (-2153.661) * (-2154.087) (-2154.193) (-2152.431) [-2163.501] -- 0:00:58 108000 -- (-2155.042) (-2155.563) [-2155.133] (-2154.872) * [-2153.839] (-2154.586) (-2153.210) (-2172.485) -- 0:00:57 108500 -- (-2155.333) (-2154.732) [-2155.678] (-2153.892) * [-2154.972] (-2154.961) (-2153.348) (-2165.807) -- 0:00:57 109000 -- (-2154.671) [-2154.511] (-2155.101) (-2157.236) * (-2154.204) (-2156.858) [-2153.343] (-2155.199) -- 0:00:57 109500 -- (-2153.820) [-2153.704] (-2155.116) (-2163.058) * [-2154.040] (-2160.382) (-2157.540) (-2156.732) -- 0:00:56 110000 -- [-2154.153] (-2153.029) (-2154.716) (-2153.977) * [-2153.246] (-2158.831) (-2153.449) (-2155.184) -- 0:00:56 Average standard deviation of split frequencies: 0.025558 110500 -- (-2157.841) (-2154.930) [-2155.300] (-2154.201) * (-2153.970) (-2154.338) [-2152.519] (-2153.183) -- 0:00:56 111000 -- (-2158.052) [-2153.334] (-2158.546) (-2156.860) * [-2153.280] (-2155.228) (-2152.519) (-2153.623) -- 0:00:56 111500 -- (-2156.469) [-2153.254] (-2155.014) (-2155.312) * (-2155.200) (-2154.586) [-2152.519] (-2154.328) -- 0:00:55 112000 -- (-2154.760) [-2155.098] (-2154.454) (-2152.387) * (-2155.805) [-2157.853] (-2153.112) (-2153.728) -- 0:00:55 112500 -- (-2156.469) (-2157.304) (-2152.804) [-2156.215] * [-2154.828] (-2154.451) (-2154.885) (-2153.206) -- 0:00:55 113000 -- (-2155.566) [-2154.068] (-2152.493) (-2157.023) * [-2153.876] (-2155.701) (-2153.245) (-2152.480) -- 0:00:54 113500 -- [-2155.848] (-2164.495) (-2153.535) (-2156.034) * (-2153.971) (-2154.809) [-2153.238] (-2154.796) -- 0:00:54 114000 -- [-2155.834] (-2160.054) (-2155.988) (-2157.657) * [-2154.072] (-2155.297) (-2152.698) (-2155.019) -- 0:01:02 114500 -- [-2155.272] (-2158.940) (-2160.277) (-2154.747) * (-2153.750) (-2155.988) [-2154.680] (-2155.730) -- 0:01:01 115000 -- (-2155.168) (-2154.698) [-2158.838] (-2153.474) * (-2152.865) (-2157.966) [-2152.933] (-2155.032) -- 0:01:01 Average standard deviation of split frequencies: 0.027805 115500 -- (-2155.890) [-2155.939] (-2155.707) (-2153.695) * (-2153.506) (-2156.278) (-2155.884) [-2161.574] -- 0:01:01 116000 -- (-2155.617) [-2154.402] (-2154.455) (-2155.903) * (-2154.733) [-2153.403] (-2157.475) (-2153.549) -- 0:01:00 116500 -- (-2154.386) (-2154.525) [-2154.755] (-2154.402) * (-2153.705) [-2154.228] (-2155.379) (-2153.113) -- 0:01:00 117000 -- [-2153.355] (-2154.635) (-2153.901) (-2153.074) * [-2155.198] (-2155.547) (-2154.047) (-2152.623) -- 0:01:00 117500 -- [-2153.250] (-2153.670) (-2153.997) (-2153.472) * (-2159.132) (-2153.916) (-2160.814) [-2152.496] -- 0:01:00 118000 -- (-2152.810) (-2153.239) [-2153.298] (-2153.303) * (-2158.805) (-2154.771) [-2157.132] (-2153.877) -- 0:00:59 118500 -- (-2152.765) (-2153.804) [-2153.383] (-2152.929) * [-2154.637] (-2154.771) (-2153.424) (-2153.697) -- 0:00:59 119000 -- (-2152.792) (-2154.907) [-2156.608] (-2154.666) * (-2156.545) (-2154.524) (-2154.234) [-2153.705] -- 0:00:59 119500 -- (-2153.005) (-2157.314) (-2153.341) [-2155.625] * (-2156.832) (-2155.044) (-2154.864) [-2154.310] -- 0:00:58 120000 -- (-2153.102) (-2158.652) [-2152.691] (-2154.861) * (-2155.397) (-2155.568) [-2155.093] (-2155.768) -- 0:00:58 Average standard deviation of split frequencies: 0.027758 120500 -- (-2157.074) (-2157.796) (-2153.158) [-2155.292] * (-2158.405) [-2155.067] (-2154.368) (-2156.580) -- 0:00:58 121000 -- (-2154.876) [-2155.490] (-2157.052) (-2156.486) * (-2156.254) (-2153.161) [-2156.027] (-2154.404) -- 0:00:58 121500 -- (-2153.406) (-2155.492) (-2154.796) [-2153.935] * (-2153.066) (-2155.666) [-2155.577] (-2156.219) -- 0:00:57 122000 -- (-2154.897) (-2155.124) (-2155.193) [-2157.319] * (-2152.920) (-2153.805) (-2153.410) [-2155.251] -- 0:00:57 122500 -- [-2154.410] (-2153.793) (-2157.859) (-2155.327) * (-2153.284) (-2155.793) [-2152.967] (-2153.907) -- 0:00:57 123000 -- (-2154.323) (-2153.732) [-2154.572] (-2155.465) * (-2153.948) (-2153.268) [-2157.652] (-2153.332) -- 0:00:57 123500 -- [-2152.824] (-2154.492) (-2154.597) (-2155.247) * (-2154.078) (-2152.591) (-2156.113) [-2153.314] -- 0:00:56 124000 -- (-2153.946) (-2156.334) [-2152.331] (-2158.416) * (-2152.581) (-2152.410) (-2156.613) [-2153.864] -- 0:00:56 124500 -- (-2154.953) (-2153.287) [-2152.371] (-2158.415) * [-2153.923] (-2154.770) (-2157.222) (-2154.832) -- 0:00:56 125000 -- [-2152.679] (-2154.868) (-2155.705) (-2157.323) * (-2152.246) (-2156.368) (-2160.186) [-2154.732] -- 0:00:56 Average standard deviation of split frequencies: 0.027080 125500 -- [-2152.679] (-2153.857) (-2155.011) (-2156.759) * [-2153.067] (-2159.471) (-2158.980) (-2155.201) -- 0:00:55 126000 -- [-2152.475] (-2156.888) (-2155.781) (-2153.078) * [-2154.340] (-2154.655) (-2158.755) (-2155.195) -- 0:00:55 126500 -- (-2153.450) [-2155.249] (-2154.810) (-2154.827) * (-2154.491) [-2155.678] (-2156.011) (-2154.501) -- 0:00:55 127000 -- (-2152.558) [-2152.530] (-2154.526) (-2152.295) * (-2153.814) (-2159.386) (-2154.978) [-2154.023] -- 0:00:54 127500 -- (-2156.284) (-2153.867) [-2154.077] (-2152.274) * (-2152.105) (-2157.962) (-2156.678) [-2154.922] -- 0:00:54 128000 -- (-2158.113) (-2156.327) (-2157.294) [-2152.965] * [-2152.084] (-2152.347) (-2158.081) (-2154.347) -- 0:00:54 128500 -- (-2158.517) (-2153.976) (-2154.794) [-2152.623] * [-2153.132] (-2152.532) (-2158.044) (-2153.700) -- 0:00:54 129000 -- [-2157.735] (-2154.090) (-2155.450) (-2155.469) * (-2154.920) [-2153.506] (-2161.796) (-2153.731) -- 0:01:00 129500 -- [-2154.885] (-2154.265) (-2158.941) (-2154.987) * (-2153.377) [-2153.240] (-2158.901) (-2153.734) -- 0:01:00 130000 -- [-2153.970] (-2156.612) (-2157.443) (-2154.857) * [-2153.410] (-2153.330) (-2158.111) (-2153.689) -- 0:01:00 Average standard deviation of split frequencies: 0.026156 130500 -- (-2154.594) (-2156.867) (-2154.920) [-2152.881] * (-2153.397) (-2153.134) (-2157.214) [-2153.521] -- 0:00:59 131000 -- (-2153.378) [-2154.269] (-2156.728) (-2152.453) * (-2154.251) (-2152.948) (-2155.713) [-2154.790] -- 0:00:59 131500 -- (-2152.748) [-2154.723] (-2158.395) (-2154.954) * (-2154.798) [-2153.182] (-2154.908) (-2153.357) -- 0:00:59 132000 -- (-2152.327) (-2154.174) [-2156.755] (-2154.954) * (-2154.915) (-2153.040) (-2153.059) [-2154.524] -- 0:00:59 132500 -- [-2152.492] (-2153.781) (-2157.844) (-2154.550) * (-2153.659) [-2156.243] (-2153.013) (-2155.258) -- 0:00:58 133000 -- (-2152.599) (-2155.531) [-2153.082] (-2155.232) * [-2156.097] (-2158.350) (-2153.180) (-2153.813) -- 0:00:58 133500 -- [-2153.557] (-2155.136) (-2155.975) (-2153.716) * (-2155.952) (-2153.942) (-2155.533) [-2154.222] -- 0:00:58 134000 -- (-2154.150) (-2157.715) [-2155.328] (-2153.444) * (-2156.420) (-2153.680) [-2155.235] (-2155.821) -- 0:00:58 134500 -- (-2154.068) [-2158.529] (-2161.857) (-2153.445) * (-2157.670) (-2153.937) (-2156.699) [-2160.899] -- 0:00:57 135000 -- (-2154.885) (-2156.132) (-2158.047) [-2152.862] * (-2160.695) (-2154.878) [-2154.655] (-2156.358) -- 0:00:57 Average standard deviation of split frequencies: 0.026312 135500 -- (-2160.951) [-2156.277] (-2157.364) (-2152.571) * (-2155.861) (-2153.493) (-2155.117) [-2154.366] -- 0:00:57 136000 -- (-2160.950) (-2156.491) (-2156.542) [-2153.896] * (-2154.681) (-2154.432) [-2153.026] (-2156.880) -- 0:00:57 136500 -- (-2155.859) [-2156.622] (-2154.139) (-2153.752) * [-2156.013] (-2155.925) (-2157.431) (-2153.776) -- 0:00:56 137000 -- (-2159.320) (-2155.626) [-2153.250] (-2158.897) * (-2156.296) [-2153.358] (-2158.343) (-2153.313) -- 0:00:56 137500 -- [-2155.140] (-2155.512) (-2153.219) (-2157.345) * (-2154.410) [-2153.042] (-2156.014) (-2155.391) -- 0:00:56 138000 -- (-2154.501) (-2157.001) [-2155.865] (-2155.446) * [-2154.995] (-2155.894) (-2155.660) (-2154.046) -- 0:00:56 138500 -- (-2154.255) (-2161.138) (-2154.343) [-2154.301] * (-2154.673) [-2155.073] (-2154.810) (-2154.456) -- 0:00:55 139000 -- [-2152.374] (-2156.530) (-2154.635) (-2155.255) * (-2153.937) [-2154.924] (-2155.797) (-2153.635) -- 0:00:55 139500 -- (-2156.381) [-2154.955] (-2152.887) (-2153.348) * [-2153.412] (-2158.004) (-2159.629) (-2153.261) -- 0:00:55 140000 -- (-2154.603) (-2155.291) [-2152.786] (-2155.478) * (-2153.732) [-2156.783] (-2154.998) (-2153.351) -- 0:00:55 Average standard deviation of split frequencies: 0.025751 140500 -- (-2154.232) (-2154.291) (-2152.835) [-2154.893] * (-2153.559) (-2153.713) [-2154.630] (-2155.385) -- 0:00:55 141000 -- (-2154.554) (-2154.412) [-2154.691] (-2153.007) * [-2153.111] (-2157.268) (-2153.942) (-2155.708) -- 0:00:54 141500 -- (-2155.882) [-2153.207] (-2155.095) (-2152.909) * [-2153.078] (-2155.721) (-2152.976) (-2157.416) -- 0:00:54 142000 -- (-2155.712) (-2153.204) (-2155.785) [-2152.632] * [-2156.404] (-2155.135) (-2154.034) (-2157.333) -- 0:00:54 142500 -- (-2154.640) (-2155.496) [-2154.988] (-2152.564) * (-2159.564) [-2154.586] (-2154.215) (-2154.844) -- 0:00:54 143000 -- (-2154.593) [-2154.311] (-2154.241) (-2154.144) * (-2154.049) (-2155.440) [-2156.267] (-2154.427) -- 0:00:59 143500 -- [-2155.354] (-2157.454) (-2155.129) (-2155.218) * (-2154.894) (-2154.696) [-2156.101] (-2154.345) -- 0:00:59 144000 -- (-2153.454) (-2159.063) [-2154.551] (-2155.259) * (-2153.787) [-2154.086] (-2153.931) (-2153.902) -- 0:00:59 144500 -- (-2154.961) (-2155.856) [-2155.518] (-2154.213) * (-2156.273) (-2155.457) [-2153.640] (-2155.320) -- 0:00:59 145000 -- (-2155.019) (-2156.749) (-2153.876) [-2152.837] * (-2154.000) [-2155.083] (-2153.642) (-2152.641) -- 0:00:58 Average standard deviation of split frequencies: 0.023570 145500 -- (-2155.418) [-2153.596] (-2153.899) (-2152.824) * (-2153.947) [-2156.418] (-2153.731) (-2153.259) -- 0:00:58 146000 -- (-2154.072) [-2153.574] (-2153.254) (-2156.107) * (-2152.537) [-2156.363] (-2154.138) (-2153.185) -- 0:00:58 146500 -- (-2153.665) (-2153.656) (-2152.958) [-2158.050] * (-2152.657) (-2153.728) (-2154.564) [-2152.553] -- 0:00:58 147000 -- (-2154.964) [-2152.835] (-2154.839) (-2154.889) * (-2152.959) (-2152.863) (-2154.214) [-2155.588] -- 0:00:58 147500 -- (-2153.497) [-2153.793] (-2154.901) (-2154.961) * (-2152.892) (-2154.517) [-2154.500] (-2156.612) -- 0:00:57 148000 -- (-2155.308) (-2153.823) [-2153.763] (-2155.679) * [-2153.524] (-2155.259) (-2154.755) (-2158.566) -- 0:00:57 148500 -- (-2155.664) (-2153.029) (-2152.504) [-2155.848] * (-2153.761) (-2152.508) [-2155.167] (-2156.564) -- 0:00:57 149000 -- (-2154.408) [-2153.546] (-2152.377) (-2154.244) * (-2155.131) (-2153.611) [-2154.006] (-2155.960) -- 0:00:57 149500 -- (-2153.463) (-2153.265) (-2153.980) [-2155.524] * (-2156.389) (-2153.384) (-2153.764) [-2156.280] -- 0:00:56 150000 -- (-2155.904) (-2156.195) [-2155.885] (-2153.616) * (-2155.982) (-2153.036) (-2153.439) [-2156.809] -- 0:00:56 Average standard deviation of split frequencies: 0.021408 150500 -- (-2153.979) (-2155.549) (-2155.814) [-2155.990] * (-2156.236) (-2153.562) (-2152.671) [-2154.185] -- 0:00:56 151000 -- [-2153.454] (-2160.710) (-2156.088) (-2155.962) * (-2154.834) [-2156.569] (-2154.741) (-2157.177) -- 0:00:56 151500 -- [-2153.433] (-2162.017) (-2157.101) (-2155.910) * (-2155.823) [-2156.535] (-2156.137) (-2153.046) -- 0:00:56 152000 -- (-2153.867) [-2155.734] (-2157.073) (-2156.401) * (-2154.139) (-2157.894) (-2153.858) [-2153.056] -- 0:00:55 152500 -- [-2153.866] (-2154.861) (-2157.682) (-2153.304) * (-2153.453) (-2157.811) [-2154.264] (-2153.440) -- 0:00:55 153000 -- (-2154.241) [-2153.022] (-2154.341) (-2154.066) * (-2154.576) [-2156.184] (-2152.186) (-2153.936) -- 0:00:55 153500 -- (-2154.476) (-2154.346) (-2155.059) [-2154.267] * [-2154.376] (-2157.693) (-2156.747) (-2156.948) -- 0:00:55 154000 -- (-2154.587) (-2153.836) [-2153.973] (-2156.134) * [-2152.331] (-2153.890) (-2156.669) (-2163.754) -- 0:00:54 154500 -- (-2154.125) [-2155.772] (-2153.743) (-2154.393) * [-2154.610] (-2154.916) (-2153.498) (-2159.771) -- 0:00:54 155000 -- (-2154.260) [-2153.903] (-2153.743) (-2156.466) * [-2155.138] (-2154.508) (-2153.074) (-2156.444) -- 0:00:54 Average standard deviation of split frequencies: 0.017963 155500 -- (-2157.371) [-2154.209] (-2157.403) (-2153.794) * [-2153.749] (-2156.473) (-2153.493) (-2154.269) -- 0:00:54 156000 -- (-2154.579) [-2153.551] (-2155.991) (-2153.950) * (-2155.392) [-2154.468] (-2153.501) (-2154.902) -- 0:00:54 156500 -- (-2154.944) [-2154.583] (-2154.753) (-2157.093) * (-2154.480) (-2154.282) (-2153.492) [-2154.766] -- 0:00:53 157000 -- (-2156.966) [-2154.331] (-2153.946) (-2154.910) * [-2155.986] (-2155.159) (-2153.160) (-2154.780) -- 0:00:53 157500 -- [-2155.469] (-2159.222) (-2154.108) (-2156.262) * (-2153.301) (-2157.458) (-2152.665) [-2154.775] -- 0:00:53 158000 -- (-2155.715) [-2156.758] (-2153.699) (-2154.520) * (-2156.932) (-2152.716) [-2154.831] (-2156.550) -- 0:00:58 158500 -- (-2156.254) (-2155.034) [-2153.041] (-2157.997) * (-2153.470) [-2152.710] (-2155.086) (-2154.608) -- 0:00:58 159000 -- [-2153.604] (-2157.699) (-2153.168) (-2154.050) * [-2153.198] (-2152.542) (-2155.211) (-2157.003) -- 0:00:58 159500 -- (-2153.394) (-2156.690) (-2153.185) [-2155.383] * (-2154.605) [-2154.341] (-2154.354) (-2155.344) -- 0:00:57 160000 -- [-2153.393] (-2157.462) (-2153.248) (-2153.894) * [-2154.884] (-2153.201) (-2156.382) (-2155.347) -- 0:00:57 Average standard deviation of split frequencies: 0.019612 160500 -- (-2153.188) [-2158.015] (-2153.476) (-2154.077) * (-2155.503) [-2153.137] (-2157.908) (-2155.451) -- 0:00:57 161000 -- (-2153.848) (-2159.045) (-2154.421) [-2154.077] * (-2156.717) [-2152.899] (-2160.479) (-2153.420) -- 0:00:57 161500 -- (-2153.083) (-2158.452) (-2152.882) [-2152.803] * (-2153.279) (-2152.856) (-2159.750) [-2154.020] -- 0:00:57 162000 -- (-2157.275) [-2153.066] (-2152.180) (-2154.320) * [-2154.529] (-2153.599) (-2157.099) (-2155.722) -- 0:00:56 162500 -- (-2156.326) (-2152.096) [-2155.314] (-2153.763) * (-2154.803) (-2160.294) (-2153.851) [-2154.438] -- 0:00:56 163000 -- [-2156.294] (-2153.392) (-2155.794) (-2154.507) * (-2154.420) (-2160.943) [-2153.476] (-2152.884) -- 0:00:56 163500 -- (-2155.453) (-2152.306) (-2154.134) [-2154.771] * (-2154.457) (-2159.371) [-2155.544] (-2153.294) -- 0:00:56 164000 -- (-2153.040) (-2152.298) (-2155.003) [-2154.771] * (-2157.923) (-2158.670) (-2157.199) [-2153.540] -- 0:00:56 164500 -- [-2152.948] (-2154.253) (-2155.046) (-2156.335) * [-2157.654] (-2155.187) (-2155.342) (-2154.903) -- 0:00:55 165000 -- (-2155.128) (-2155.312) (-2154.630) [-2157.948] * (-2153.957) [-2155.485] (-2158.300) (-2154.182) -- 0:00:55 Average standard deviation of split frequencies: 0.019580 165500 -- (-2153.487) (-2155.782) (-2155.622) [-2153.294] * (-2153.642) (-2154.567) [-2154.326] (-2152.589) -- 0:00:55 166000 -- [-2154.393] (-2154.250) (-2156.988) (-2152.732) * (-2153.895) (-2156.931) (-2154.485) [-2154.236] -- 0:00:55 166500 -- (-2154.866) (-2156.070) [-2156.701] (-2155.088) * (-2154.790) (-2156.920) [-2154.749] (-2155.486) -- 0:00:55 167000 -- [-2156.009] (-2152.958) (-2154.443) (-2154.405) * (-2153.497) (-2157.411) [-2154.832] (-2153.648) -- 0:00:54 167500 -- (-2152.926) [-2156.589] (-2152.950) (-2155.286) * [-2153.490] (-2158.795) (-2155.144) (-2153.143) -- 0:00:54 168000 -- [-2153.451] (-2154.745) (-2152.743) (-2154.328) * (-2153.898) [-2154.265] (-2155.817) (-2153.323) -- 0:00:54 168500 -- (-2153.500) [-2153.707] (-2153.349) (-2152.911) * (-2154.735) [-2155.935] (-2155.274) (-2154.918) -- 0:00:54 169000 -- [-2153.270] (-2153.244) (-2156.512) (-2153.062) * [-2153.752] (-2154.268) (-2154.726) (-2154.449) -- 0:00:54 169500 -- (-2153.422) (-2156.280) (-2156.719) [-2153.027] * (-2152.860) [-2154.936] (-2156.391) (-2155.004) -- 0:00:53 170000 -- (-2153.909) (-2154.463) (-2156.062) [-2153.202] * (-2155.167) (-2154.424) (-2156.297) [-2153.263] -- 0:00:53 Average standard deviation of split frequencies: 0.019473 170500 -- [-2153.990] (-2152.866) (-2157.079) (-2152.514) * (-2156.679) [-2153.173] (-2155.785) (-2152.732) -- 0:00:53 171000 -- (-2156.838) [-2154.075] (-2152.430) (-2156.710) * (-2153.704) (-2152.776) [-2155.102] (-2152.639) -- 0:00:53 171500 -- [-2155.216] (-2153.989) (-2152.490) (-2160.082) * [-2155.524] (-2153.011) (-2156.918) (-2152.470) -- 0:00:53 172000 -- (-2154.459) (-2153.219) (-2158.782) [-2153.608] * (-2155.969) [-2153.418] (-2152.587) (-2152.464) -- 0:00:52 172500 -- (-2153.765) [-2154.355] (-2153.133) (-2153.608) * [-2156.079] (-2153.418) (-2154.383) (-2153.824) -- 0:00:52 173000 -- [-2152.576] (-2153.086) (-2153.923) (-2152.790) * (-2155.541) [-2156.173] (-2153.336) (-2153.849) -- 0:00:52 173500 -- [-2153.903] (-2153.517) (-2156.346) (-2152.461) * [-2156.467] (-2153.792) (-2152.957) (-2153.519) -- 0:00:57 174000 -- [-2154.283] (-2153.747) (-2154.961) (-2152.797) * (-2157.395) [-2153.474] (-2152.977) (-2155.779) -- 0:00:56 174500 -- (-2155.022) [-2153.197] (-2157.123) (-2152.764) * [-2156.784] (-2153.651) (-2153.933) (-2166.083) -- 0:00:56 175000 -- (-2152.845) (-2153.061) (-2157.292) [-2152.946] * [-2156.177] (-2156.071) (-2153.636) (-2155.533) -- 0:00:56 Average standard deviation of split frequencies: 0.016775 175500 -- [-2152.671] (-2152.767) (-2153.679) (-2152.944) * (-2156.320) (-2157.415) [-2154.223] (-2155.765) -- 0:00:56 176000 -- (-2153.170) (-2153.803) [-2158.085] (-2153.404) * (-2155.650) (-2157.936) (-2155.747) [-2155.407] -- 0:00:56 176500 -- [-2154.262] (-2153.511) (-2156.991) (-2153.303) * (-2155.372) (-2156.517) (-2154.892) [-2155.685] -- 0:00:55 177000 -- (-2152.846) [-2153.205] (-2157.845) (-2154.135) * (-2153.640) (-2153.576) [-2154.820] (-2155.402) -- 0:00:55 177500 -- [-2153.881] (-2153.156) (-2154.223) (-2152.742) * (-2153.699) [-2153.865] (-2157.236) (-2155.387) -- 0:00:55 178000 -- (-2152.359) [-2153.156] (-2155.383) (-2152.668) * [-2154.437] (-2158.307) (-2158.519) (-2155.213) -- 0:00:55 178500 -- (-2152.404) (-2155.005) [-2155.621] (-2153.005) * (-2153.014) [-2157.485] (-2158.723) (-2155.845) -- 0:00:55 179000 -- (-2152.958) [-2153.436] (-2156.406) (-2153.635) * (-2152.905) (-2155.929) (-2157.330) [-2154.995] -- 0:00:55 179500 -- (-2155.666) [-2154.668] (-2158.930) (-2152.789) * (-2154.328) (-2156.648) [-2154.778] (-2154.832) -- 0:00:54 180000 -- (-2154.386) (-2153.555) [-2156.823] (-2153.416) * (-2163.410) [-2156.760] (-2156.382) (-2155.908) -- 0:00:54 Average standard deviation of split frequencies: 0.015134 180500 -- [-2153.919] (-2154.643) (-2154.282) (-2152.577) * (-2160.860) [-2154.522] (-2157.147) (-2157.238) -- 0:00:54 181000 -- [-2153.210] (-2154.635) (-2157.074) (-2155.666) * (-2154.587) (-2155.052) [-2155.128] (-2154.977) -- 0:00:54 181500 -- [-2153.751] (-2155.988) (-2155.405) (-2152.925) * [-2154.926] (-2153.514) (-2153.931) (-2153.324) -- 0:00:54 182000 -- (-2153.094) (-2153.488) [-2156.423] (-2153.213) * [-2154.281] (-2154.318) (-2154.012) (-2153.193) -- 0:00:53 182500 -- (-2156.392) [-2152.153] (-2153.351) (-2159.093) * (-2156.860) (-2152.532) (-2155.120) [-2153.896] -- 0:00:53 183000 -- (-2154.462) (-2153.171) (-2154.775) [-2155.598] * (-2152.647) [-2152.192] (-2156.812) (-2155.513) -- 0:00:53 183500 -- [-2157.167] (-2156.551) (-2152.413) (-2158.816) * (-2153.737) [-2152.553] (-2155.828) (-2155.595) -- 0:00:53 184000 -- (-2153.897) (-2154.855) (-2155.237) [-2157.258] * (-2154.465) [-2155.332] (-2153.567) (-2158.305) -- 0:00:53 184500 -- (-2154.595) [-2153.493] (-2155.243) (-2152.841) * (-2158.200) (-2152.309) (-2153.506) [-2159.066] -- 0:00:53 185000 -- (-2153.027) (-2153.166) (-2153.527) [-2153.513] * (-2159.161) [-2152.864] (-2152.999) (-2157.624) -- 0:00:52 Average standard deviation of split frequencies: 0.015080 185500 -- (-2153.515) (-2153.126) (-2153.134) [-2153.448] * (-2156.109) (-2154.264) [-2152.485] (-2156.632) -- 0:00:52 186000 -- (-2153.214) [-2155.265] (-2153.965) (-2152.426) * (-2160.110) (-2157.114) (-2152.496) [-2156.783] -- 0:00:52 186500 -- (-2153.214) [-2155.484] (-2153.744) (-2152.727) * [-2156.672] (-2155.789) (-2152.932) (-2156.896) -- 0:00:52 187000 -- [-2154.631] (-2155.507) (-2153.704) (-2154.922) * (-2157.408) [-2156.322] (-2152.939) (-2157.273) -- 0:00:52 187500 -- (-2154.209) (-2155.067) [-2153.366] (-2155.744) * (-2154.853) [-2159.346] (-2155.426) (-2154.006) -- 0:00:52 188000 -- (-2153.137) [-2156.394] (-2153.910) (-2154.985) * [-2154.717] (-2152.552) (-2154.575) (-2154.645) -- 0:00:51 188500 -- [-2155.236] (-2153.345) (-2155.028) (-2155.050) * (-2154.599) [-2152.554] (-2154.444) (-2154.796) -- 0:00:55 189000 -- (-2153.969) (-2156.353) (-2155.028) [-2153.594] * [-2155.531] (-2155.465) (-2155.230) (-2155.569) -- 0:00:55 189500 -- (-2154.231) (-2156.350) [-2155.263] (-2154.514) * (-2154.070) (-2158.154) (-2159.191) [-2153.758] -- 0:00:55 190000 -- (-2153.773) [-2154.604] (-2152.571) (-2153.819) * [-2152.797] (-2154.740) (-2159.624) (-2153.649) -- 0:00:55 Average standard deviation of split frequencies: 0.013793 190500 -- (-2154.109) (-2154.435) [-2153.376] (-2152.650) * (-2152.494) (-2158.904) (-2154.215) [-2155.304] -- 0:00:55 191000 -- (-2153.634) (-2157.539) (-2152.397) [-2152.367] * (-2155.718) (-2159.872) [-2153.099] (-2154.404) -- 0:00:55 191500 -- [-2153.857] (-2156.353) (-2154.035) (-2152.590) * (-2153.117) [-2159.631] (-2155.032) (-2154.424) -- 0:00:54 192000 -- (-2153.301) [-2154.035] (-2156.048) (-2152.978) * (-2152.884) (-2155.302) (-2155.500) [-2153.708] -- 0:00:54 192500 -- (-2152.715) (-2155.536) [-2154.806] (-2154.631) * (-2156.264) [-2153.223] (-2155.299) (-2153.603) -- 0:00:54 193000 -- (-2154.278) (-2153.651) [-2154.133] (-2160.086) * (-2157.209) (-2153.150) [-2154.504] (-2153.745) -- 0:00:54 193500 -- (-2153.393) (-2153.428) [-2155.833] (-2154.724) * [-2156.148] (-2154.028) (-2153.380) (-2154.158) -- 0:00:54 194000 -- (-2159.604) (-2154.894) [-2153.750] (-2153.868) * [-2157.587] (-2155.759) (-2153.380) (-2156.971) -- 0:00:54 194500 -- (-2153.746) [-2156.724] (-2154.725) (-2152.267) * (-2154.576) (-2158.578) (-2152.782) [-2154.420] -- 0:00:53 195000 -- (-2153.774) (-2155.963) (-2152.761) [-2152.260] * (-2155.884) (-2157.041) (-2154.583) [-2156.410] -- 0:00:53 Average standard deviation of split frequencies: 0.013348 195500 -- (-2152.626) (-2155.602) [-2153.492] (-2152.489) * [-2157.876] (-2154.394) (-2154.881) (-2154.595) -- 0:00:53 196000 -- [-2152.628] (-2155.466) (-2153.674) (-2154.714) * (-2153.940) [-2152.965] (-2154.912) (-2156.088) -- 0:00:53 196500 -- [-2152.982] (-2156.299) (-2154.086) (-2154.929) * (-2154.723) (-2152.995) [-2156.515] (-2156.295) -- 0:00:53 197000 -- (-2157.419) (-2156.851) (-2155.803) [-2154.279] * (-2160.958) [-2157.404] (-2155.076) (-2154.260) -- 0:00:52 197500 -- (-2157.240) [-2154.742] (-2152.927) (-2155.298) * (-2157.274) [-2156.569] (-2153.292) (-2154.632) -- 0:00:52 198000 -- (-2157.682) (-2153.338) (-2153.285) [-2155.886] * (-2154.154) (-2155.485) [-2155.016] (-2153.835) -- 0:00:52 198500 -- [-2153.623] (-2152.168) (-2153.651) (-2155.990) * (-2153.649) (-2154.107) [-2154.430] (-2153.962) -- 0:00:52 199000 -- (-2153.157) (-2155.609) [-2154.665] (-2156.590) * (-2153.708) (-2155.518) [-2152.606] (-2154.044) -- 0:00:52 199500 -- (-2153.156) (-2156.391) (-2154.329) [-2154.405] * [-2152.612] (-2155.004) (-2153.311) (-2154.065) -- 0:00:52 200000 -- (-2157.884) (-2157.848) [-2153.950] (-2153.459) * (-2152.772) (-2156.102) (-2152.941) [-2152.480] -- 0:00:51 Average standard deviation of split frequencies: 0.014713 200500 -- [-2155.744] (-2156.764) (-2153.023) (-2153.459) * (-2154.420) (-2154.956) [-2152.952] (-2153.386) -- 0:00:51 201000 -- (-2158.433) (-2156.819) (-2156.111) [-2153.264] * (-2154.545) (-2155.627) [-2152.733] (-2152.914) -- 0:00:51 201500 -- (-2155.476) [-2154.037] (-2153.161) (-2153.804) * (-2154.715) (-2156.069) (-2152.948) [-2153.848] -- 0:00:51 202000 -- [-2152.407] (-2153.233) (-2153.865) (-2153.946) * (-2153.376) (-2159.172) (-2155.438) [-2153.214] -- 0:00:51 202500 -- [-2153.974] (-2155.638) (-2153.865) (-2153.243) * (-2154.032) (-2157.651) [-2156.986] (-2155.781) -- 0:00:51 203000 -- [-2155.461] (-2154.593) (-2153.703) (-2152.702) * (-2155.184) (-2153.529) (-2155.969) [-2153.627] -- 0:00:51 203500 -- (-2152.412) (-2153.169) [-2155.304] (-2155.012) * (-2153.044) [-2153.866] (-2156.097) (-2155.206) -- 0:00:54 204000 -- (-2152.189) (-2152.867) (-2156.502) [-2152.225] * (-2157.598) [-2153.358] (-2154.792) (-2154.270) -- 0:00:54 204500 -- [-2153.268] (-2153.060) (-2156.961) (-2155.376) * (-2154.692) (-2153.212) [-2154.852] (-2153.767) -- 0:00:54 205000 -- (-2154.164) (-2153.299) [-2154.008] (-2152.368) * [-2154.882] (-2152.911) (-2154.867) (-2154.921) -- 0:00:54 Average standard deviation of split frequencies: 0.014814 205500 -- (-2154.101) (-2154.852) [-2153.849] (-2152.934) * (-2154.982) (-2152.776) (-2153.229) [-2153.806] -- 0:00:54 206000 -- [-2152.615] (-2153.055) (-2153.518) (-2154.290) * (-2153.504) [-2155.377] (-2155.281) (-2153.160) -- 0:00:53 206500 -- (-2153.328) (-2153.123) [-2156.618] (-2152.230) * [-2152.899] (-2154.069) (-2156.914) (-2155.247) -- 0:00:53 207000 -- [-2153.360] (-2153.140) (-2153.507) (-2154.252) * (-2155.550) (-2153.471) (-2154.391) [-2153.200] -- 0:00:53 207500 -- (-2154.563) (-2152.971) [-2153.058] (-2154.002) * [-2156.766] (-2153.532) (-2158.157) (-2153.515) -- 0:00:53 208000 -- (-2155.226) [-2153.224] (-2154.196) (-2154.965) * (-2152.432) (-2152.594) (-2152.888) [-2153.780] -- 0:00:53 208500 -- (-2153.138) (-2153.069) (-2155.365) [-2155.403] * (-2153.994) (-2155.903) [-2153.574] (-2153.710) -- 0:00:53 209000 -- [-2153.138] (-2155.243) (-2153.754) (-2153.171) * (-2154.883) (-2159.077) [-2153.892] (-2152.585) -- 0:00:52 209500 -- (-2153.035) (-2153.274) [-2156.222] (-2155.196) * (-2155.457) [-2153.753] (-2157.476) (-2155.161) -- 0:00:52 210000 -- (-2155.490) (-2153.561) (-2156.203) [-2156.150] * (-2157.335) (-2154.011) [-2155.861] (-2155.343) -- 0:00:52 Average standard deviation of split frequencies: 0.014839 210500 -- (-2157.761) [-2155.060] (-2156.069) (-2153.730) * [-2154.071] (-2154.955) (-2153.653) (-2159.421) -- 0:00:52 211000 -- (-2156.077) (-2167.917) (-2155.964) [-2152.913] * (-2155.965) (-2155.675) (-2156.918) [-2156.470] -- 0:00:52 211500 -- [-2152.729] (-2154.430) (-2153.908) (-2152.364) * [-2157.120] (-2155.738) (-2154.144) (-2154.859) -- 0:00:52 212000 -- (-2152.995) [-2154.259] (-2153.501) (-2154.347) * (-2155.839) (-2156.175) [-2154.015] (-2154.196) -- 0:00:52 212500 -- [-2153.056] (-2154.377) (-2154.368) (-2152.853) * (-2156.899) (-2155.345) [-2153.163] (-2155.618) -- 0:00:51 213000 -- [-2154.870] (-2162.167) (-2157.330) (-2153.184) * (-2158.427) [-2154.114] (-2152.527) (-2155.043) -- 0:00:51 213500 -- (-2154.102) (-2158.047) (-2154.878) [-2153.877] * (-2155.240) [-2154.088] (-2152.527) (-2155.388) -- 0:00:51 214000 -- (-2154.661) (-2154.876) (-2153.832) [-2153.582] * (-2153.979) (-2154.088) [-2153.041] (-2155.234) -- 0:00:51 214500 -- (-2152.522) (-2154.902) [-2154.713] (-2153.784) * [-2155.259] (-2153.694) (-2158.839) (-2157.045) -- 0:00:51 215000 -- [-2157.551] (-2154.521) (-2153.775) (-2152.701) * (-2155.379) (-2153.978) (-2157.585) [-2157.049] -- 0:00:51 Average standard deviation of split frequencies: 0.012973 215500 -- (-2153.740) (-2157.221) (-2153.978) [-2152.359] * (-2153.918) (-2153.007) [-2155.723] (-2156.795) -- 0:00:50 216000 -- (-2153.926) (-2157.691) (-2156.303) [-2152.339] * (-2154.734) [-2152.828] (-2156.485) (-2155.444) -- 0:00:50 216500 -- (-2152.226) (-2156.958) [-2154.134] (-2153.222) * [-2152.268] (-2153.049) (-2155.339) (-2154.863) -- 0:00:50 217000 -- (-2156.370) (-2158.694) (-2157.883) [-2153.116] * [-2152.319] (-2153.672) (-2153.705) (-2159.665) -- 0:00:50 217500 -- (-2154.845) [-2156.192] (-2156.370) (-2154.212) * (-2152.341) (-2154.142) (-2154.387) [-2154.825] -- 0:00:50 218000 -- (-2153.446) (-2156.779) (-2153.797) [-2153.014] * [-2153.479] (-2156.489) (-2156.664) (-2156.645) -- 0:00:50 218500 -- [-2152.929] (-2155.111) (-2153.942) (-2152.957) * (-2156.227) [-2155.243] (-2153.961) (-2158.369) -- 0:00:53 219000 -- (-2152.757) (-2155.549) (-2153.948) [-2153.833] * (-2158.281) [-2154.470] (-2153.052) (-2154.554) -- 0:00:53 219500 -- (-2152.801) (-2155.313) (-2156.103) [-2155.784] * (-2157.354) (-2155.870) [-2155.972] (-2154.118) -- 0:00:53 220000 -- (-2154.037) [-2154.309] (-2156.495) (-2158.314) * [-2157.709] (-2153.709) (-2154.593) (-2154.485) -- 0:00:53 Average standard deviation of split frequencies: 0.013767 220500 -- (-2155.942) (-2153.943) [-2153.984] (-2158.371) * (-2154.654) [-2154.102] (-2154.827) (-2155.488) -- 0:00:53 221000 -- (-2154.170) (-2154.275) (-2156.192) [-2155.223] * (-2155.133) [-2153.331] (-2153.881) (-2153.026) -- 0:00:52 221500 -- (-2157.619) (-2153.912) [-2156.005] (-2154.791) * (-2154.747) [-2153.527] (-2153.578) (-2152.401) -- 0:00:52 222000 -- [-2153.753] (-2155.110) (-2156.178) (-2154.228) * [-2154.594] (-2158.827) (-2152.918) (-2153.236) -- 0:00:52 222500 -- (-2155.506) (-2153.374) [-2152.970] (-2156.068) * (-2154.709) (-2154.412) [-2152.937] (-2152.636) -- 0:00:52 223000 -- (-2154.411) (-2155.480) [-2152.907] (-2154.938) * [-2155.273] (-2152.578) (-2156.860) (-2153.333) -- 0:00:52 223500 -- [-2155.398] (-2155.131) (-2153.142) (-2155.022) * (-2158.680) [-2152.781] (-2154.798) (-2153.742) -- 0:00:52 224000 -- (-2157.771) (-2155.280) (-2153.847) [-2155.014] * (-2156.219) [-2152.539] (-2156.434) (-2153.889) -- 0:00:51 224500 -- (-2158.500) [-2157.035] (-2154.061) (-2156.613) * (-2155.905) (-2152.443) (-2156.448) [-2153.615] -- 0:00:51 225000 -- (-2154.405) (-2153.949) (-2153.524) [-2155.377] * (-2153.682) [-2152.433] (-2157.135) (-2153.949) -- 0:00:51 Average standard deviation of split frequencies: 0.013674 225500 -- (-2154.669) (-2153.660) (-2153.179) [-2153.947] * [-2153.367] (-2152.893) (-2154.875) (-2154.158) -- 0:00:51 226000 -- (-2155.638) (-2153.550) [-2153.058] (-2154.086) * (-2153.312) [-2152.904] (-2154.470) (-2154.122) -- 0:00:51 226500 -- (-2156.351) (-2154.106) [-2153.256] (-2153.506) * (-2153.351) (-2154.188) (-2157.570) [-2153.712] -- 0:00:51 227000 -- (-2154.880) (-2152.972) [-2152.645] (-2153.093) * [-2157.722] (-2155.248) (-2156.205) (-2159.026) -- 0:00:51 227500 -- (-2153.897) (-2152.973) (-2152.558) [-2155.799] * [-2155.546] (-2153.596) (-2153.667) (-2157.715) -- 0:00:50 228000 -- [-2155.438] (-2153.870) (-2154.052) (-2156.765) * [-2153.351] (-2154.266) (-2156.691) (-2157.074) -- 0:00:50 228500 -- (-2160.066) (-2154.086) (-2154.514) [-2155.408] * (-2153.591) (-2154.037) [-2155.028] (-2155.336) -- 0:00:50 229000 -- [-2154.752] (-2154.086) (-2153.189) (-2153.227) * (-2152.789) (-2152.444) [-2155.898] (-2155.852) -- 0:00:50 229500 -- (-2154.241) (-2154.978) [-2155.504] (-2153.931) * [-2152.815] (-2152.444) (-2153.319) (-2160.178) -- 0:00:50 230000 -- (-2153.488) (-2153.995) (-2156.131) [-2152.902] * (-2152.968) [-2152.786] (-2152.871) (-2155.079) -- 0:00:50 Average standard deviation of split frequencies: 0.013397 230500 -- [-2154.377] (-2154.303) (-2154.407) (-2152.285) * [-2153.812] (-2152.958) (-2153.284) (-2156.659) -- 0:00:50 231000 -- (-2157.296) (-2156.680) [-2155.270] (-2153.069) * [-2153.014] (-2153.115) (-2153.770) (-2159.838) -- 0:00:49 231500 -- (-2155.282) (-2153.489) (-2155.158) [-2152.541] * (-2154.680) [-2154.411] (-2155.411) (-2159.276) -- 0:00:49 232000 -- (-2154.754) [-2152.900] (-2157.324) (-2153.026) * (-2157.688) (-2153.569) (-2155.131) [-2161.765] -- 0:00:49 232500 -- (-2153.765) (-2156.556) [-2152.758] (-2155.521) * (-2156.547) [-2153.422] (-2152.840) (-2159.472) -- 0:00:49 233000 -- [-2154.022] (-2152.730) (-2155.448) (-2159.949) * (-2155.312) (-2153.422) [-2153.291] (-2157.946) -- 0:00:49 233500 -- (-2153.573) [-2153.861] (-2153.218) (-2159.376) * (-2155.110) [-2154.203] (-2152.607) (-2160.831) -- 0:00:52 234000 -- (-2154.281) (-2154.842) (-2154.170) [-2156.122] * [-2152.670] (-2154.142) (-2159.104) (-2156.325) -- 0:00:52 234500 -- (-2156.122) [-2153.699] (-2153.410) (-2154.133) * (-2153.016) [-2154.879] (-2158.513) (-2156.714) -- 0:00:52 235000 -- (-2155.437) (-2152.621) (-2154.248) [-2154.438] * (-2153.323) [-2155.898] (-2156.200) (-2153.686) -- 0:00:52 Average standard deviation of split frequencies: 0.013871 235500 -- (-2155.042) (-2152.526) (-2153.359) [-2155.518] * (-2157.641) (-2156.593) [-2153.974] (-2153.261) -- 0:00:51 236000 -- (-2157.860) (-2152.747) [-2153.176] (-2159.005) * (-2156.629) (-2152.884) [-2154.071] (-2153.611) -- 0:00:51 236500 -- (-2156.623) (-2152.654) (-2153.751) [-2158.843] * (-2156.567) (-2152.918) [-2155.323] (-2154.184) -- 0:00:51 237000 -- [-2153.226] (-2152.491) (-2153.585) (-2158.506) * (-2154.946) [-2155.230] (-2155.192) (-2153.431) -- 0:00:51 237500 -- (-2153.596) [-2152.360] (-2153.857) (-2165.934) * [-2154.770] (-2154.281) (-2155.325) (-2157.543) -- 0:00:51 238000 -- (-2152.754) [-2152.744] (-2154.614) (-2156.479) * (-2154.668) [-2154.676] (-2156.747) (-2154.174) -- 0:00:51 238500 -- (-2154.350) (-2153.677) [-2153.551] (-2152.932) * (-2156.386) (-2155.503) [-2155.323] (-2155.831) -- 0:00:51 239000 -- (-2154.675) (-2154.856) [-2153.796] (-2153.596) * (-2154.457) [-2153.052] (-2154.724) (-2155.748) -- 0:00:50 239500 -- [-2159.149] (-2153.332) (-2153.796) (-2153.826) * (-2153.767) (-2153.391) (-2153.510) [-2154.937] -- 0:00:50 240000 -- [-2153.803] (-2153.393) (-2154.816) (-2153.405) * (-2153.263) [-2153.995] (-2153.246) (-2155.360) -- 0:00:50 Average standard deviation of split frequencies: 0.014364 240500 -- (-2153.105) (-2154.613) [-2155.824] (-2152.965) * [-2153.610] (-2152.651) (-2152.268) (-2154.680) -- 0:00:50 241000 -- (-2153.739) [-2153.217] (-2153.476) (-2156.018) * [-2155.451] (-2153.888) (-2152.297) (-2156.551) -- 0:00:50 241500 -- (-2153.282) (-2153.857) (-2154.322) [-2153.877] * (-2156.431) [-2153.862] (-2152.297) (-2156.712) -- 0:00:50 242000 -- (-2153.623) [-2153.796] (-2152.205) (-2153.624) * (-2153.575) (-2154.015) (-2152.294) [-2154.023] -- 0:00:50 242500 -- [-2152.902] (-2153.627) (-2152.591) (-2154.193) * [-2155.484] (-2153.578) (-2153.056) (-2155.727) -- 0:00:49 243000 -- [-2152.471] (-2153.846) (-2159.021) (-2153.558) * (-2155.211) (-2153.879) [-2152.125] (-2155.057) -- 0:00:49 243500 -- (-2158.248) (-2156.235) (-2158.780) [-2154.016] * (-2153.740) [-2155.480] (-2152.125) (-2156.378) -- 0:00:49 244000 -- [-2153.209] (-2155.659) (-2153.703) (-2156.651) * (-2153.661) (-2153.167) [-2152.304] (-2153.955) -- 0:00:49 244500 -- [-2153.093] (-2153.335) (-2153.285) (-2155.747) * (-2153.584) (-2153.455) (-2152.393) [-2153.811] -- 0:00:49 245000 -- [-2152.310] (-2153.608) (-2153.285) (-2154.569) * (-2154.058) (-2153.581) (-2155.873) [-2159.854] -- 0:00:49 Average standard deviation of split frequencies: 0.014691 245500 -- [-2152.408] (-2153.803) (-2153.090) (-2156.799) * (-2153.068) (-2156.114) [-2152.634] (-2154.779) -- 0:00:49 246000 -- (-2155.761) (-2154.799) [-2154.986] (-2154.866) * (-2153.059) (-2152.853) [-2154.524] (-2154.429) -- 0:00:49 246500 -- (-2160.883) (-2154.072) (-2158.520) [-2157.376] * [-2152.923] (-2153.658) (-2154.526) (-2157.613) -- 0:00:48 247000 -- [-2153.004] (-2155.684) (-2155.892) (-2156.552) * (-2153.521) (-2152.648) [-2153.116] (-2154.142) -- 0:00:48 247500 -- [-2154.090] (-2158.777) (-2153.797) (-2155.270) * (-2153.644) (-2154.664) [-2152.995] (-2153.817) -- 0:00:48 248000 -- (-2155.514) [-2153.255] (-2153.573) (-2156.650) * (-2155.185) (-2153.467) (-2153.456) [-2154.312] -- 0:00:48 248500 -- (-2157.168) [-2154.188] (-2157.558) (-2156.985) * [-2152.455] (-2154.089) (-2153.919) (-2153.144) -- 0:00:51 249000 -- (-2154.538) [-2156.201] (-2154.146) (-2154.229) * (-2153.249) (-2152.634) [-2155.781] (-2153.144) -- 0:00:51 249500 -- (-2156.150) (-2154.841) (-2153.641) [-2152.640] * (-2153.200) (-2153.753) (-2153.409) [-2153.258] -- 0:00:51 250000 -- (-2153.622) (-2155.714) [-2153.959] (-2154.599) * [-2154.626] (-2152.453) (-2153.796) (-2153.876) -- 0:00:51 Average standard deviation of split frequencies: 0.014731 250500 -- (-2157.424) (-2159.264) [-2152.398] (-2158.429) * [-2155.897] (-2152.595) (-2153.796) (-2153.938) -- 0:00:50 251000 -- [-2156.914] (-2154.221) (-2152.940) (-2153.478) * (-2156.813) (-2154.479) (-2153.287) [-2154.054] -- 0:00:50 251500 -- [-2154.775] (-2156.562) (-2153.121) (-2155.210) * (-2152.917) (-2154.109) (-2156.050) [-2154.215] -- 0:00:50 252000 -- [-2156.299] (-2155.713) (-2153.189) (-2152.637) * [-2156.843] (-2157.497) (-2154.613) (-2156.082) -- 0:00:50 252500 -- (-2155.378) (-2154.157) (-2154.892) [-2153.516] * (-2152.805) (-2157.011) (-2153.913) [-2155.780] -- 0:00:50 253000 -- (-2159.375) (-2152.991) [-2153.067] (-2152.941) * (-2153.277) (-2157.911) [-2154.029] (-2154.244) -- 0:00:50 253500 -- (-2156.546) [-2152.902] (-2153.489) (-2153.015) * (-2153.492) (-2153.734) [-2154.021] (-2154.504) -- 0:00:50 254000 -- (-2155.639) (-2153.098) (-2152.432) [-2153.202] * (-2155.757) (-2153.088) [-2153.248] (-2154.982) -- 0:00:49 254500 -- (-2154.628) (-2155.517) [-2152.907] (-2155.483) * (-2155.517) (-2156.159) (-2154.410) [-2154.981] -- 0:00:49 255000 -- [-2154.383] (-2155.176) (-2152.805) (-2154.654) * (-2153.055) [-2157.210] (-2157.210) (-2158.045) -- 0:00:49 Average standard deviation of split frequencies: 0.014118 255500 -- (-2157.340) (-2155.277) [-2152.735] (-2154.654) * (-2153.950) (-2157.281) [-2153.011] (-2154.503) -- 0:00:49 256000 -- (-2156.409) (-2153.799) [-2153.426] (-2154.647) * [-2155.746] (-2155.936) (-2154.523) (-2155.253) -- 0:00:49 256500 -- (-2156.340) (-2154.084) [-2152.738] (-2152.980) * (-2154.746) (-2155.469) [-2154.088] (-2154.978) -- 0:00:49 257000 -- (-2154.575) (-2154.085) (-2152.650) [-2152.980] * (-2153.972) (-2155.368) [-2153.878] (-2154.090) -- 0:00:49 257500 -- [-2153.989] (-2153.234) (-2155.704) (-2152.882) * (-2159.187) (-2154.168) [-2152.804] (-2153.508) -- 0:00:49 258000 -- [-2152.795] (-2153.212) (-2163.732) (-2153.395) * (-2159.398) (-2155.678) [-2153.483] (-2153.170) -- 0:00:48 258500 -- [-2155.477] (-2154.168) (-2154.990) (-2154.567) * [-2154.350] (-2156.162) (-2153.489) (-2154.135) -- 0:00:48 259000 -- (-2157.156) [-2155.653] (-2155.260) (-2154.753) * (-2155.286) (-2156.064) [-2153.821] (-2153.964) -- 0:00:48 259500 -- (-2155.688) (-2154.011) (-2155.764) [-2154.313] * [-2154.995] (-2152.636) (-2152.657) (-2154.097) -- 0:00:48 260000 -- [-2156.236] (-2153.667) (-2153.325) (-2167.633) * (-2153.911) [-2153.481] (-2152.768) (-2153.570) -- 0:00:48 Average standard deviation of split frequencies: 0.013162 260500 -- [-2157.075] (-2152.585) (-2153.047) (-2166.295) * (-2157.681) [-2153.832] (-2152.370) (-2154.272) -- 0:00:48 261000 -- (-2156.632) (-2154.081) (-2153.607) [-2157.464] * (-2155.843) (-2154.382) (-2152.610) [-2153.710] -- 0:00:48 261500 -- (-2155.642) [-2152.729] (-2156.398) (-2161.447) * (-2153.449) [-2153.006] (-2154.230) (-2155.975) -- 0:00:48 262000 -- (-2153.756) (-2154.841) (-2156.417) [-2160.225] * [-2152.833] (-2155.314) (-2155.362) (-2154.903) -- 0:00:47 262500 -- (-2153.954) (-2153.359) (-2158.342) [-2154.190] * (-2152.830) (-2157.351) [-2157.549] (-2156.682) -- 0:00:47 263000 -- (-2155.309) (-2152.854) (-2155.360) [-2153.762] * (-2152.340) (-2154.749) (-2154.169) [-2156.775] -- 0:00:47 263500 -- [-2152.848] (-2153.819) (-2154.637) (-2153.601) * (-2154.601) [-2155.619] (-2152.146) (-2153.533) -- 0:00:50 264000 -- (-2154.472) (-2152.545) (-2153.124) [-2156.363] * (-2158.006) (-2154.468) [-2153.571] (-2156.607) -- 0:00:50 264500 -- (-2156.816) (-2156.384) (-2152.825) [-2156.300] * (-2153.277) [-2153.915] (-2152.672) (-2155.385) -- 0:00:50 265000 -- [-2153.088] (-2158.192) (-2156.640) (-2155.876) * (-2153.230) (-2155.778) (-2158.171) [-2154.914] -- 0:00:49 Average standard deviation of split frequencies: 0.012701 265500 -- (-2153.255) (-2157.853) [-2157.609] (-2155.561) * (-2153.686) (-2153.256) (-2152.908) [-2153.983] -- 0:00:49 266000 -- [-2154.247] (-2152.477) (-2153.099) (-2155.616) * (-2159.628) (-2155.686) [-2153.715] (-2158.595) -- 0:00:49 266500 -- [-2154.424] (-2152.336) (-2153.166) (-2164.819) * (-2157.878) (-2158.525) [-2154.456] (-2154.518) -- 0:00:49 267000 -- (-2154.425) (-2152.876) (-2153.663) [-2153.424] * (-2153.413) [-2155.390] (-2154.305) (-2154.330) -- 0:00:49 267500 -- [-2154.954] (-2153.618) (-2155.180) (-2158.900) * (-2153.398) [-2155.244] (-2153.836) (-2153.215) -- 0:00:49 268000 -- [-2154.345] (-2152.642) (-2158.259) (-2154.979) * (-2156.695) (-2153.192) [-2152.781] (-2153.902) -- 0:00:49 268500 -- [-2153.556] (-2154.637) (-2158.460) (-2154.979) * (-2155.555) [-2153.729] (-2152.539) (-2157.914) -- 0:00:49 269000 -- (-2154.172) [-2155.335] (-2155.547) (-2154.598) * (-2153.031) (-2153.616) [-2153.289] (-2158.072) -- 0:00:48 269500 -- (-2154.670) (-2155.313) (-2155.979) [-2154.620] * (-2152.331) (-2153.183) [-2155.260] (-2158.291) -- 0:00:48 270000 -- (-2153.555) (-2153.441) (-2157.037) [-2152.517] * (-2154.353) [-2155.233] (-2154.674) (-2158.920) -- 0:00:48 Average standard deviation of split frequencies: 0.013159 270500 -- (-2153.871) [-2154.546] (-2155.000) (-2152.568) * (-2154.355) (-2155.184) (-2154.912) [-2158.985] -- 0:00:48 271000 -- (-2153.125) (-2154.860) (-2159.140) [-2154.955] * (-2153.516) (-2152.128) (-2154.403) [-2155.094] -- 0:00:48 271500 -- (-2153.191) [-2155.578] (-2156.153) (-2152.881) * [-2152.678] (-2152.539) (-2154.565) (-2154.524) -- 0:00:48 272000 -- (-2154.042) [-2152.878] (-2153.344) (-2152.773) * (-2152.858) (-2153.301) [-2154.297] (-2158.681) -- 0:00:48 272500 -- [-2153.646] (-2154.187) (-2153.344) (-2154.694) * (-2153.511) (-2155.486) [-2155.358] (-2155.798) -- 0:00:48 273000 -- (-2154.304) (-2155.915) (-2153.628) [-2154.086] * (-2155.336) [-2153.392] (-2154.803) (-2155.698) -- 0:00:47 273500 -- (-2154.275) (-2154.327) (-2155.942) [-2154.930] * (-2158.290) (-2153.226) [-2154.552] (-2157.348) -- 0:00:47 274000 -- (-2156.809) (-2152.894) (-2153.169) [-2153.572] * (-2155.608) [-2152.271] (-2153.154) (-2154.955) -- 0:00:47 274500 -- [-2154.643] (-2152.904) (-2153.084) (-2153.921) * (-2153.347) [-2152.310] (-2153.215) (-2153.165) -- 0:00:47 275000 -- [-2157.102] (-2153.355) (-2153.155) (-2155.338) * [-2153.952] (-2152.528) (-2154.536) (-2155.355) -- 0:00:47 Average standard deviation of split frequencies: 0.012760 275500 -- (-2155.945) (-2153.187) (-2154.337) [-2158.431] * (-2156.692) (-2152.609) [-2154.270] (-2158.779) -- 0:00:47 276000 -- [-2156.673] (-2155.900) (-2154.326) (-2158.339) * (-2154.650) (-2155.305) (-2153.435) [-2153.247] -- 0:00:47 276500 -- [-2157.769] (-2154.533) (-2153.743) (-2155.433) * (-2157.122) [-2153.367] (-2153.410) (-2153.859) -- 0:00:47 277000 -- (-2158.307) (-2153.491) [-2153.050] (-2157.132) * (-2156.445) [-2153.102] (-2154.754) (-2154.239) -- 0:00:46 277500 -- [-2157.110] (-2153.748) (-2153.298) (-2155.892) * [-2152.642] (-2154.299) (-2154.585) (-2154.239) -- 0:00:46 278000 -- (-2157.813) (-2153.930) [-2153.187] (-2154.623) * (-2156.641) [-2156.174] (-2154.850) (-2152.695) -- 0:00:46 278500 -- (-2155.505) (-2153.671) (-2152.521) [-2153.511] * (-2156.140) [-2153.894] (-2152.403) (-2153.361) -- 0:00:49 279000 -- (-2154.473) (-2152.634) (-2154.952) [-2155.417] * (-2157.901) [-2153.896] (-2152.446) (-2152.808) -- 0:00:49 279500 -- [-2154.428] (-2153.319) (-2156.688) (-2155.530) * [-2155.145] (-2154.438) (-2156.097) (-2152.407) -- 0:00:48 280000 -- [-2153.568] (-2157.087) (-2154.161) (-2155.611) * [-2152.918] (-2156.348) (-2155.298) (-2154.338) -- 0:00:48 Average standard deviation of split frequencies: 0.012410 280500 -- [-2153.255] (-2153.179) (-2153.517) (-2155.162) * [-2154.768] (-2157.024) (-2153.314) (-2154.498) -- 0:00:48 281000 -- [-2152.585] (-2152.586) (-2153.935) (-2155.279) * (-2156.511) (-2159.849) (-2154.715) [-2153.781] -- 0:00:48 281500 -- (-2153.025) (-2154.212) [-2153.543] (-2153.236) * [-2154.260] (-2153.396) (-2162.301) (-2153.853) -- 0:00:48 282000 -- (-2152.126) (-2153.784) [-2154.047] (-2152.170) * (-2152.575) (-2153.190) (-2158.831) [-2153.497] -- 0:00:48 282500 -- (-2152.766) [-2152.986] (-2153.447) (-2152.167) * [-2155.345] (-2153.190) (-2157.373) (-2155.274) -- 0:00:48 283000 -- (-2155.264) (-2153.602) (-2153.561) [-2152.093] * [-2154.468] (-2152.957) (-2154.972) (-2153.564) -- 0:00:48 283500 -- (-2154.468) (-2154.098) [-2153.394] (-2156.613) * [-2153.390] (-2152.884) (-2158.456) (-2155.777) -- 0:00:48 284000 -- [-2153.012] (-2156.170) (-2154.470) (-2156.351) * [-2153.420] (-2155.936) (-2154.755) (-2154.191) -- 0:00:47 284500 -- (-2153.119) (-2155.645) [-2154.371] (-2152.704) * (-2152.951) [-2154.879] (-2155.000) (-2157.371) -- 0:00:47 285000 -- (-2152.681) (-2154.395) [-2153.834] (-2152.721) * (-2153.264) (-2155.490) [-2155.330] (-2154.673) -- 0:00:47 Average standard deviation of split frequencies: 0.012319 285500 -- (-2152.952) (-2154.967) (-2152.697) [-2154.876] * (-2160.549) (-2155.518) (-2155.085) [-2159.684] -- 0:00:47 286000 -- [-2158.376] (-2155.882) (-2153.305) (-2155.418) * (-2154.206) (-2155.491) [-2154.644] (-2157.816) -- 0:00:47 286500 -- (-2152.679) [-2157.220] (-2152.938) (-2154.303) * (-2152.537) (-2154.817) (-2154.693) [-2158.527] -- 0:00:47 287000 -- (-2153.303) [-2155.006] (-2152.674) (-2154.910) * (-2152.786) (-2158.872) (-2156.674) [-2154.384] -- 0:00:47 287500 -- (-2154.612) [-2154.760] (-2153.854) (-2153.317) * (-2152.700) (-2157.167) (-2157.738) [-2153.762] -- 0:00:47 288000 -- (-2154.080) (-2154.118) [-2153.616] (-2152.619) * (-2152.947) (-2159.679) [-2154.454] (-2155.581) -- 0:00:46 288500 -- (-2153.389) (-2153.806) (-2152.374) [-2154.110] * (-2155.107) (-2160.686) [-2154.603] (-2153.066) -- 0:00:46 289000 -- (-2155.785) [-2158.638] (-2152.409) (-2158.737) * (-2157.370) (-2155.241) (-2155.031) [-2153.087] -- 0:00:46 289500 -- [-2156.038] (-2156.360) (-2152.745) (-2157.612) * (-2156.205) (-2155.461) (-2154.417) [-2153.214] -- 0:00:46 290000 -- (-2157.131) (-2156.738) (-2155.145) [-2154.399] * (-2157.721) [-2154.125] (-2153.190) (-2153.214) -- 0:00:46 Average standard deviation of split frequencies: 0.013065 290500 -- (-2158.181) (-2156.358) [-2156.841] (-2154.373) * (-2158.908) [-2152.634] (-2153.571) (-2152.587) -- 0:00:46 291000 -- (-2157.818) (-2153.530) [-2154.330] (-2156.194) * (-2157.840) (-2154.101) [-2153.248] (-2152.754) -- 0:00:46 291500 -- [-2157.008] (-2156.988) (-2154.138) (-2152.919) * (-2155.567) [-2155.236] (-2153.830) (-2153.612) -- 0:00:46 292000 -- (-2154.773) (-2156.116) (-2152.875) [-2153.014] * (-2153.488) [-2155.797] (-2154.342) (-2152.442) -- 0:00:46 292500 -- (-2153.306) (-2154.893) (-2156.318) [-2153.422] * [-2153.613] (-2155.817) (-2156.738) (-2153.668) -- 0:00:45 293000 -- (-2152.604) [-2155.022] (-2157.108) (-2154.911) * (-2153.677) (-2159.000) (-2153.969) [-2154.696] -- 0:00:45 293500 -- (-2153.026) (-2153.820) (-2155.622) [-2154.471] * (-2153.852) (-2156.531) [-2153.196] (-2152.060) -- 0:00:45 294000 -- [-2153.814] (-2152.835) (-2153.781) (-2155.155) * (-2153.967) (-2160.081) [-2153.724] (-2153.478) -- 0:00:48 294500 -- [-2155.664] (-2154.620) (-2152.696) (-2154.937) * (-2153.995) (-2160.039) [-2154.046] (-2152.758) -- 0:00:47 295000 -- (-2153.094) (-2155.764) [-2152.928] (-2157.615) * (-2155.029) [-2155.626] (-2152.956) (-2154.544) -- 0:00:47 Average standard deviation of split frequencies: 0.013360 295500 -- (-2153.335) [-2155.890] (-2153.644) (-2152.962) * (-2154.869) (-2156.061) [-2154.273] (-2156.205) -- 0:00:47 296000 -- (-2155.537) (-2157.000) (-2154.819) [-2154.672] * (-2154.073) (-2155.150) [-2154.333] (-2159.140) -- 0:00:47 296500 -- [-2154.251] (-2153.717) (-2155.236) (-2154.966) * (-2154.880) [-2155.299] (-2154.545) (-2154.483) -- 0:00:47 297000 -- (-2154.727) (-2152.866) (-2156.028) [-2156.711] * [-2154.587] (-2157.162) (-2154.684) (-2159.828) -- 0:00:47 297500 -- [-2159.674] (-2152.970) (-2153.997) (-2158.936) * (-2152.985) [-2156.455] (-2154.223) (-2158.352) -- 0:00:47 298000 -- (-2155.205) (-2155.983) (-2156.264) [-2153.708] * (-2152.205) (-2155.276) (-2153.362) [-2157.478] -- 0:00:47 298500 -- (-2154.215) (-2154.207) (-2154.039) [-2155.442] * (-2152.778) (-2156.848) [-2153.403] (-2158.015) -- 0:00:47 299000 -- (-2155.522) [-2155.400] (-2155.733) (-2154.616) * (-2153.955) [-2156.391] (-2153.873) (-2156.612) -- 0:00:46 299500 -- (-2154.737) (-2154.738) [-2156.284] (-2154.917) * [-2155.333] (-2159.136) (-2153.616) (-2154.854) -- 0:00:46 300000 -- [-2155.179] (-2152.728) (-2156.698) (-2154.866) * (-2154.521) (-2160.032) (-2152.678) [-2156.280] -- 0:00:46 Average standard deviation of split frequencies: 0.014019 300500 -- (-2156.207) [-2154.326] (-2159.991) (-2156.367) * (-2155.010) (-2156.228) [-2153.128] (-2154.813) -- 0:00:46 301000 -- (-2155.078) (-2152.678) (-2163.568) [-2153.346] * [-2152.814] (-2157.264) (-2154.731) (-2154.474) -- 0:00:46 301500 -- (-2157.202) (-2152.693) [-2155.208] (-2158.169) * (-2154.031) (-2156.260) [-2157.875] (-2154.648) -- 0:00:46 302000 -- [-2156.271] (-2154.420) (-2154.173) (-2156.415) * (-2152.944) [-2155.805] (-2157.812) (-2155.746) -- 0:00:46 302500 -- (-2153.675) (-2154.202) [-2152.950] (-2160.685) * (-2153.289) [-2156.861] (-2160.913) (-2155.107) -- 0:00:46 303000 -- (-2153.573) (-2154.503) (-2153.045) [-2153.771] * (-2153.333) (-2152.825) (-2156.180) [-2154.837] -- 0:00:46 303500 -- (-2154.186) [-2153.428] (-2155.335) (-2154.158) * (-2153.209) (-2152.825) (-2157.180) [-2157.148] -- 0:00:45 304000 -- [-2152.855] (-2153.304) (-2153.642) (-2153.987) * (-2154.398) (-2155.027) [-2155.258] (-2154.547) -- 0:00:45 304500 -- (-2152.983) (-2154.317) [-2154.151] (-2152.893) * (-2154.639) [-2154.421] (-2155.012) (-2154.537) -- 0:00:45 305000 -- (-2154.233) (-2153.384) (-2152.985) [-2153.158] * (-2152.445) (-2154.227) (-2154.964) [-2161.218] -- 0:00:45 Average standard deviation of split frequencies: 0.015234 305500 -- (-2157.864) (-2152.702) (-2154.106) [-2153.205] * (-2155.843) [-2152.100] (-2160.058) (-2155.010) -- 0:00:45 306000 -- (-2154.779) (-2152.702) (-2154.901) [-2153.717] * (-2154.475) (-2154.738) [-2154.032] (-2155.267) -- 0:00:45 306500 -- (-2155.882) (-2156.015) (-2155.403) [-2155.171] * (-2153.946) (-2154.129) [-2154.023] (-2154.397) -- 0:00:45 307000 -- (-2156.311) (-2152.868) [-2154.692] (-2155.501) * (-2153.442) (-2152.657) [-2154.300] (-2153.117) -- 0:00:45 307500 -- (-2157.930) (-2153.543) [-2154.079] (-2152.541) * [-2154.689] (-2152.847) (-2153.284) (-2154.615) -- 0:00:45 308000 -- (-2158.558) (-2153.436) [-2155.949] (-2153.563) * (-2156.843) (-2153.465) (-2152.626) [-2153.124] -- 0:00:44 308500 -- (-2152.561) [-2154.711] (-2154.607) (-2154.795) * (-2156.636) [-2155.926] (-2154.429) (-2154.697) -- 0:00:44 309000 -- (-2153.161) (-2153.749) [-2154.616] (-2153.634) * (-2153.217) (-2155.942) (-2153.673) [-2152.654] -- 0:00:46 309500 -- (-2156.728) (-2153.596) (-2154.616) [-2153.119] * (-2153.557) (-2154.790) [-2153.646] (-2153.565) -- 0:00:46 310000 -- (-2156.572) [-2155.255] (-2152.585) (-2156.269) * (-2154.006) (-2155.049) (-2154.909) [-2152.501] -- 0:00:46 Average standard deviation of split frequencies: 0.015680 310500 -- (-2156.572) [-2155.720] (-2153.130) (-2155.374) * [-2153.482] (-2154.876) (-2156.935) (-2154.014) -- 0:00:46 311000 -- (-2155.417) [-2155.291] (-2153.034) (-2155.112) * (-2153.467) (-2155.404) [-2155.396] (-2155.449) -- 0:00:46 311500 -- [-2156.200] (-2155.365) (-2153.247) (-2155.733) * [-2154.144] (-2154.734) (-2160.575) (-2155.637) -- 0:00:46 312000 -- (-2158.127) (-2155.652) [-2152.980] (-2157.693) * (-2154.391) (-2153.631) (-2155.784) [-2156.623] -- 0:00:46 312500 -- (-2155.593) (-2154.472) [-2154.504] (-2154.039) * (-2154.069) [-2153.713] (-2152.399) (-2159.706) -- 0:00:46 313000 -- (-2155.153) (-2155.465) [-2155.445] (-2154.148) * (-2156.903) (-2156.621) [-2152.348] (-2157.697) -- 0:00:46 313500 -- (-2155.726) (-2154.446) (-2154.039) [-2155.676] * (-2155.093) (-2155.763) [-2153.076] (-2156.620) -- 0:00:45 314000 -- (-2153.774) (-2155.336) [-2152.807] (-2155.875) * [-2155.167] (-2156.732) (-2154.489) (-2154.940) -- 0:00:45 314500 -- [-2153.910] (-2158.385) (-2154.151) (-2155.297) * (-2154.361) (-2155.737) [-2156.380] (-2155.684) -- 0:00:45 315000 -- (-2154.668) (-2159.917) [-2152.510] (-2155.950) * (-2156.571) (-2154.272) [-2153.923] (-2158.566) -- 0:00:45 Average standard deviation of split frequencies: 0.016327 315500 -- (-2155.325) (-2160.163) (-2153.802) [-2154.969] * (-2155.316) [-2154.584] (-2156.041) (-2154.368) -- 0:00:45 316000 -- (-2154.387) (-2154.975) [-2152.568] (-2154.879) * [-2154.909] (-2153.454) (-2155.053) (-2156.992) -- 0:00:45 316500 -- (-2154.893) (-2156.043) [-2154.007] (-2156.021) * (-2157.725) (-2154.053) [-2155.769] (-2156.867) -- 0:00:45 317000 -- (-2155.414) [-2155.769] (-2153.528) (-2156.184) * (-2155.182) (-2154.053) [-2157.513] (-2154.745) -- 0:00:45 317500 -- (-2155.130) (-2156.294) [-2154.147] (-2153.534) * (-2154.986) [-2154.753] (-2158.836) (-2154.017) -- 0:00:45 318000 -- [-2153.970] (-2156.549) (-2155.741) (-2153.539) * (-2154.804) (-2160.365) (-2155.525) [-2152.654] -- 0:00:45 318500 -- (-2155.414) (-2156.937) [-2154.280] (-2155.863) * (-2155.567) (-2153.658) (-2154.207) [-2153.385] -- 0:00:44 319000 -- (-2155.839) (-2154.599) [-2154.138] (-2160.464) * (-2155.946) (-2156.620) (-2154.097) [-2155.962] -- 0:00:44 319500 -- (-2157.077) (-2153.214) [-2152.385] (-2157.474) * (-2155.614) (-2154.554) (-2159.350) [-2155.150] -- 0:00:44 320000 -- (-2157.029) (-2152.963) [-2153.494] (-2157.077) * [-2157.789] (-2153.162) (-2154.887) (-2154.821) -- 0:00:44 Average standard deviation of split frequencies: 0.015165 320500 -- (-2153.059) [-2154.301] (-2153.050) (-2158.115) * (-2155.008) (-2153.169) (-2158.198) [-2157.269] -- 0:00:44 321000 -- (-2153.491) (-2153.542) (-2153.226) [-2153.378] * (-2153.194) (-2153.875) (-2154.039) [-2153.298] -- 0:00:44 321500 -- (-2157.690) (-2153.758) [-2153.146] (-2153.601) * (-2152.853) (-2153.455) [-2155.379] (-2153.526) -- 0:00:44 322000 -- [-2152.780] (-2153.756) (-2152.772) (-2153.326) * (-2156.161) [-2153.454] (-2156.865) (-2158.136) -- 0:00:44 322500 -- (-2153.096) [-2153.430] (-2152.981) (-2153.574) * (-2153.515) [-2155.579] (-2152.944) (-2154.916) -- 0:00:44 323000 -- [-2152.888] (-2153.295) (-2152.872) (-2153.634) * (-2152.678) (-2154.098) (-2152.242) [-2152.958] -- 0:00:44 323500 -- [-2152.508] (-2152.593) (-2153.039) (-2155.144) * (-2154.885) (-2153.260) [-2152.240] (-2155.028) -- 0:00:43 324000 -- (-2153.304) (-2155.724) (-2158.113) [-2154.791] * (-2154.517) (-2153.024) (-2154.600) [-2153.299] -- 0:00:45 324500 -- (-2153.093) (-2153.714) [-2154.023] (-2156.217) * [-2152.791] (-2152.316) (-2152.942) (-2155.221) -- 0:00:45 325000 -- (-2152.848) [-2153.274] (-2153.649) (-2160.072) * (-2152.386) [-2153.797] (-2152.529) (-2156.552) -- 0:00:45 Average standard deviation of split frequencies: 0.015297 325500 -- (-2155.762) [-2153.834] (-2153.671) (-2155.090) * [-2154.391] (-2159.842) (-2152.749) (-2155.385) -- 0:00:45 326000 -- (-2154.830) [-2153.640] (-2154.151) (-2154.508) * [-2153.338] (-2160.256) (-2154.029) (-2157.427) -- 0:00:45 326500 -- [-2152.939] (-2152.791) (-2153.571) (-2153.832) * (-2158.820) (-2157.432) [-2152.741] (-2158.270) -- 0:00:45 327000 -- (-2155.755) [-2153.302] (-2154.703) (-2153.682) * [-2156.562] (-2156.019) (-2154.632) (-2156.515) -- 0:00:45 327500 -- (-2156.021) (-2154.865) (-2156.721) [-2153.568] * (-2157.790) (-2157.442) [-2152.838] (-2157.719) -- 0:00:45 328000 -- (-2156.069) (-2153.859) (-2156.035) [-2153.908] * (-2155.961) [-2155.154] (-2156.414) (-2158.211) -- 0:00:45 328500 -- [-2153.741] (-2155.390) (-2156.045) (-2153.810) * (-2154.994) (-2155.265) (-2154.652) [-2155.164] -- 0:00:44 329000 -- (-2155.588) (-2158.065) (-2153.542) [-2152.824] * (-2154.447) [-2154.202] (-2154.001) (-2155.433) -- 0:00:44 329500 -- (-2156.027) (-2153.452) (-2153.104) [-2153.028] * (-2155.371) [-2153.081] (-2153.403) (-2155.522) -- 0:00:44 330000 -- [-2156.431] (-2153.493) (-2152.791) (-2154.714) * (-2154.807) (-2154.537) (-2155.616) [-2153.146] -- 0:00:44 Average standard deviation of split frequencies: 0.016132 330500 -- [-2154.337] (-2153.697) (-2153.076) (-2153.927) * (-2157.240) [-2153.407] (-2154.764) (-2153.197) -- 0:00:44 331000 -- (-2157.373) [-2153.697] (-2152.937) (-2155.089) * [-2156.422] (-2154.944) (-2155.807) (-2154.145) -- 0:00:44 331500 -- (-2156.944) [-2156.066] (-2154.984) (-2156.452) * (-2154.306) (-2155.092) (-2154.763) [-2153.713] -- 0:00:44 332000 -- (-2155.379) [-2152.816] (-2156.386) (-2157.728) * [-2154.378] (-2155.939) (-2155.237) (-2154.600) -- 0:00:44 332500 -- (-2153.977) (-2152.816) [-2157.066] (-2154.645) * (-2155.857) (-2152.899) [-2153.830] (-2153.266) -- 0:00:44 333000 -- (-2153.609) (-2152.345) [-2153.839] (-2160.075) * (-2153.122) (-2152.566) (-2153.823) [-2153.061] -- 0:00:44 333500 -- (-2152.647) (-2152.770) (-2155.689) [-2154.945] * [-2154.297] (-2152.963) (-2153.819) (-2155.056) -- 0:00:43 334000 -- (-2153.327) (-2154.773) [-2156.515] (-2154.577) * (-2153.173) (-2157.030) (-2152.293) [-2154.871] -- 0:00:43 334500 -- [-2154.014] (-2154.580) (-2155.145) (-2153.642) * (-2154.647) (-2156.176) [-2152.923] (-2153.207) -- 0:00:43 335000 -- (-2153.191) (-2155.613) [-2153.834] (-2153.669) * (-2154.459) (-2158.844) (-2153.336) [-2153.189] -- 0:00:43 Average standard deviation of split frequencies: 0.015802 335500 -- [-2153.657] (-2154.172) (-2154.601) (-2155.873) * (-2153.519) [-2152.137] (-2156.122) (-2156.063) -- 0:00:43 336000 -- (-2153.934) [-2154.840] (-2156.427) (-2159.217) * (-2155.461) (-2152.384) (-2156.175) [-2152.775] -- 0:00:43 336500 -- (-2153.704) (-2153.869) [-2157.917] (-2155.355) * (-2155.621) (-2156.581) (-2159.935) [-2152.933] -- 0:00:43 337000 -- (-2152.526) [-2156.042] (-2158.893) (-2155.007) * [-2153.341] (-2154.571) (-2157.572) (-2153.257) -- 0:00:43 337500 -- (-2152.475) (-2154.954) [-2154.416] (-2154.386) * (-2155.811) [-2153.787] (-2155.293) (-2154.939) -- 0:00:43 338000 -- (-2153.645) (-2154.116) [-2154.047] (-2155.965) * (-2153.479) [-2154.090] (-2155.444) (-2154.659) -- 0:00:43 338500 -- (-2155.240) [-2154.060] (-2153.545) (-2154.893) * (-2153.572) [-2154.434] (-2153.903) (-2154.290) -- 0:00:42 339000 -- (-2154.100) [-2155.290] (-2154.331) (-2155.394) * (-2152.520) [-2156.304] (-2153.156) (-2154.912) -- 0:00:44 339500 -- (-2154.100) (-2154.586) (-2153.572) [-2155.662] * (-2152.520) (-2155.314) (-2153.156) [-2154.964] -- 0:00:44 340000 -- (-2154.016) [-2155.435] (-2155.367) (-2156.234) * [-2152.400] (-2155.620) (-2154.261) (-2154.272) -- 0:00:44 Average standard deviation of split frequencies: 0.015877 340500 -- (-2154.791) (-2154.698) [-2153.148] (-2154.018) * (-2155.401) (-2159.251) (-2153.431) [-2153.700] -- 0:00:44 341000 -- [-2154.459] (-2154.045) (-2152.679) (-2161.178) * (-2154.275) [-2153.446] (-2153.743) (-2156.014) -- 0:00:44 341500 -- (-2157.034) (-2152.857) [-2153.489] (-2156.872) * (-2154.997) (-2153.462) [-2154.684] (-2157.533) -- 0:00:44 342000 -- (-2158.578) (-2153.846) [-2155.639] (-2153.770) * [-2153.366] (-2157.480) (-2153.402) (-2152.622) -- 0:00:44 342500 -- (-2157.286) (-2155.827) [-2154.109] (-2153.678) * (-2155.216) (-2154.500) (-2155.144) [-2152.749] -- 0:00:44 343000 -- (-2157.217) (-2153.058) (-2156.668) [-2153.678] * (-2154.790) [-2153.258] (-2152.293) (-2158.542) -- 0:00:44 343500 -- (-2158.263) [-2152.525] (-2158.469) (-2153.600) * [-2154.734] (-2153.598) (-2153.527) (-2152.736) -- 0:00:43 344000 -- [-2157.565] (-2155.137) (-2156.477) (-2153.976) * (-2154.084) [-2153.340] (-2156.518) (-2153.052) -- 0:00:43 344500 -- (-2154.877) [-2158.791] (-2160.909) (-2153.769) * (-2154.136) (-2155.622) [-2154.876] (-2153.037) -- 0:00:43 345000 -- [-2155.650] (-2155.819) (-2153.550) (-2153.994) * (-2155.955) (-2155.881) [-2153.881] (-2154.862) -- 0:00:43 Average standard deviation of split frequencies: 0.015417 345500 -- (-2154.902) (-2156.782) (-2156.126) [-2154.161] * [-2155.277] (-2154.689) (-2155.706) (-2152.669) -- 0:00:43 346000 -- [-2155.892] (-2155.367) (-2159.787) (-2155.773) * [-2155.465] (-2153.704) (-2152.965) (-2152.794) -- 0:00:43 346500 -- [-2155.522] (-2153.148) (-2154.262) (-2155.297) * (-2153.596) (-2153.386) [-2154.178] (-2154.910) -- 0:00:43 347000 -- (-2155.474) (-2153.064) [-2155.442] (-2152.422) * (-2152.845) (-2154.101) (-2152.632) [-2157.373] -- 0:00:43 347500 -- (-2157.467) (-2152.838) (-2154.212) [-2152.581] * (-2152.454) [-2154.686] (-2155.469) (-2155.435) -- 0:00:43 348000 -- (-2153.515) [-2152.297] (-2153.621) (-2152.365) * (-2153.765) (-2152.719) (-2153.513) [-2153.674] -- 0:00:43 348500 -- (-2154.208) (-2153.255) (-2155.204) [-2154.605] * (-2154.247) (-2154.549) [-2153.358] (-2152.946) -- 0:00:42 349000 -- (-2154.233) (-2152.843) (-2156.383) [-2153.591] * (-2154.407) [-2152.998] (-2158.656) (-2153.058) -- 0:00:42 349500 -- (-2153.544) (-2153.145) (-2154.073) [-2153.365] * [-2155.103] (-2153.063) (-2157.956) (-2153.472) -- 0:00:42 350000 -- (-2153.901) (-2153.248) (-2154.489) [-2152.632] * (-2153.326) [-2153.150] (-2159.702) (-2155.438) -- 0:00:42 Average standard deviation of split frequencies: 0.015236 350500 -- [-2152.608] (-2154.083) (-2154.980) (-2152.942) * [-2153.536] (-2154.369) (-2155.231) (-2153.373) -- 0:00:42 351000 -- [-2153.940] (-2153.607) (-2154.152) (-2153.205) * (-2156.386) (-2154.084) (-2153.505) [-2155.112] -- 0:00:42 351500 -- (-2154.558) [-2153.052] (-2153.560) (-2154.152) * (-2154.911) [-2156.310] (-2155.300) (-2157.955) -- 0:00:42 352000 -- [-2152.578] (-2152.792) (-2155.697) (-2156.251) * (-2154.374) (-2153.715) [-2154.631] (-2157.260) -- 0:00:42 352500 -- [-2154.416] (-2152.057) (-2155.036) (-2152.671) * [-2152.684] (-2155.000) (-2154.249) (-2155.427) -- 0:00:42 353000 -- [-2153.136] (-2152.057) (-2152.444) (-2153.514) * (-2157.055) [-2152.935] (-2154.523) (-2156.474) -- 0:00:42 353500 -- [-2153.044] (-2154.338) (-2154.800) (-2155.562) * (-2153.405) [-2154.090] (-2154.634) (-2154.070) -- 0:00:42 354000 -- (-2153.628) (-2153.526) (-2154.319) [-2154.116] * (-2155.275) (-2155.489) (-2156.455) [-2160.839] -- 0:00:43 354500 -- [-2154.829] (-2159.135) (-2152.606) (-2155.173) * (-2153.357) (-2155.485) [-2155.195] (-2156.378) -- 0:00:43 355000 -- (-2155.694) (-2155.570) (-2154.565) [-2153.660] * (-2153.350) (-2154.653) [-2154.140] (-2153.597) -- 0:00:43 Average standard deviation of split frequencies: 0.014566 355500 -- [-2156.533] (-2153.925) (-2153.712) (-2153.689) * (-2152.333) (-2155.007) [-2155.853] (-215