--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:39:37 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/purM/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1488.09         -1491.80
2      -1488.13         -1491.72
--------------------------------------
TOTAL    -1488.11         -1491.76
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893211    0.086209    0.345612    1.449625    0.865707   1501.00   1501.00    1.000
r(A<->C){all}   0.175606    0.021242    0.000016    0.460985    0.139284    185.73    190.19    1.000
r(A<->G){all}   0.164708    0.020908    0.000201    0.454856    0.122363    173.39    278.49    1.006
r(A<->T){all}   0.174003    0.022168    0.000023    0.481667    0.129408    222.31    271.72    1.000
r(C<->G){all}   0.172848    0.020980    0.000077    0.463838    0.135094    140.59    187.24    1.004
r(C<->T){all}   0.164681    0.019815    0.000115    0.460278    0.124912    218.74    259.42    1.001
r(G<->T){all}   0.148155    0.016975    0.000023    0.411321    0.112309    123.84    166.70    1.001
pi(A){all}      0.193451    0.000144    0.170649    0.216352    0.192942   1255.81   1310.56    1.000
pi(C){all}      0.273621    0.000175    0.247695    0.298683    0.273644   1282.90   1291.30    1.000
pi(G){all}      0.331156    0.000202    0.305453    0.360498    0.331054   1190.45   1236.41    1.000
pi(T){all}      0.201771    0.000146    0.177558    0.224774    0.201232    954.50   1048.48    1.000
alpha{1,2}      0.420643    0.234364    0.000267    1.392337    0.249602   1360.04   1420.18    1.000
alpha{3}        0.441694    0.231293    0.000106    1.382490    0.284684   1157.21   1201.57    1.001
pinvar{all}     0.998562    0.000003    0.995398    1.000000    0.999154   1157.06   1218.52    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1433.211955
Model 2: PositiveSelection	-1433.211956
Model 0: one-ratio	-1433.212524
Model 7: beta	-1433.211955
Model 8: beta&w>1	-1433.211955


Model 0 vs 1	0.001138000000082684

Model 2 vs 1	2.000000222324161E-6

Model 8 vs 7	0.0
>C1
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C2
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C3
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C4
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C5
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C6
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=364 

C1              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C2              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C3              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C4              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C5              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C6              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
                **************************************************

C1              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C2              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C3              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C4              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C5              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C6              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
                **************************************************

C1              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C2              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C3              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C4              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C5              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C6              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
                **************************************************

C1              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C2              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C3              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C4              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C5              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C6              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
                **************************************************

C1              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C2              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C3              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C4              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C5              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C6              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
                **************************************************

C1              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C2              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C3              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C4              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C5              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C6              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
                **************************************************

C1              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C2              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C3              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C4              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C5              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C6              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
                **************************************************

C1              VGPRAKLVGQHPRF
C2              VGPRAKLVGQHPRF
C3              VGPRAKLVGQHPRF
C4              VGPRAKLVGQHPRF
C5              VGPRAKLVGQHPRF
C6              VGPRAKLVGQHPRF
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  364 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  364 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10920]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10920]--->[10920]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.524 Mb, Max= 30.938 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C2              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C3              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C4              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C5              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
C6              MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
                **************************************************

C1              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C2              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C3              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C4              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C5              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
C6              GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
                **************************************************

C1              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C2              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C3              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C4              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C5              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
C6              VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
                **************************************************

C1              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C2              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C3              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C4              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C5              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
C6              ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
                **************************************************

C1              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C2              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C3              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C4              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C5              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
C6              SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
                **************************************************

C1              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C2              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C3              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C4              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C5              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
C6              ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
                **************************************************

C1              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C2              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C3              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C4              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C5              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
C6              VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
                **************************************************

C1              VGPRAKLVGQHPRF
C2              VGPRAKLVGQHPRF
C3              VGPRAKLVGQHPRF
C4              VGPRAKLVGQHPRF
C5              VGPRAKLVGQHPRF
C6              VGPRAKLVGQHPRF
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
C2              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
C3              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
C4              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
C5              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
C6              ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
                **************************************************

C1              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
C2              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
C3              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
C4              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
C5              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
C6              CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
                **************************************************

C1              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
C2              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
C3              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
C4              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
C5              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
C6              AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
                **************************************************

C1              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
C2              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
C3              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
C4              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
C5              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
C6              GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
                **************************************************

C1              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
C2              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
C3              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
C4              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
C5              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
C6              ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
                **************************************************

C1              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
C2              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
C3              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
C4              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
C5              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
C6              CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
                **************************************************

C1              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
C2              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
C3              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
C4              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
C5              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
C6              GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
                **************************************************

C1              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
C2              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
C3              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
C4              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
C5              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
C6              CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
                **************************************************

C1              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
C2              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
C3              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
C4              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
C5              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
C6              ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
                **************************************************

C1              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
C2              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
C3              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
C4              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
C5              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
C6              GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
                **************************************************

C1              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
C2              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
C3              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
C4              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
C5              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
C6              GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
                **************************************************

C1              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
C2              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
C3              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
C4              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
C5              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
C6              GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
                **************************************************

C1              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
C2              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
C3              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
C4              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
C5              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
C6              TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
                **************************************************

C1              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
C2              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
C3              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
C4              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
C5              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
C6              GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
                **************************************************

C1              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
C2              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
C3              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
C4              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
C5              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
C6              TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
                **************************************************

C1              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
C2              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
C3              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
C4              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
C5              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
C6              GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
                **************************************************

C1              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
C2              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
C3              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
C4              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
C5              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
C6              CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
                **************************************************

C1              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
C2              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
C3              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
C4              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
C5              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
C6              GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
                **************************************************

C1              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
C2              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
C3              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
C4              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
C5              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
C6              GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
                **************************************************

C1              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
C2              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
C3              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
C4              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
C5              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
C6              CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
                **************************************************

C1              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
C2              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
C3              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
C4              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
C5              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
C6              CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
                **************************************************

C1              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
C2              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
C3              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
C4              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
C5              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
C6              GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
                ******************************************



>C1
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C2
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C3
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C4
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C5
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C6
ATGATGGATCCCGGAAAAAGCCCCGGAGGCCAGCTGGGCAATCATGGCAT
CACCTATGCGTCGACAGGGGTGGACATTGAAGCCGGTGACCGCTCGGTCG
AGTTGTTCAAGCCGATGGCAGTTAAGGCCATCAGAACCGAGGTGCTTGGA
GGTCTAGGAGGATTCGCTGGGTTGTTCGCTCTACGCAGCGGCTACCGCGA
ACCGGTGTTAGCGGCTTCCACCGACGGTGTTGGTACCAAGCTGGCAGTCG
CTCAGGCGATGGATAAGCACGACACCGTTGGCTTGGACCTGGTGGCGATG
GTGGTCGACGACCTGGTGGTCTGTGGCGCTGAGCCACTGTTTTTGCAGGA
CTACATTGCTGTCGGCCGAACGGTGCCGGAACGACTGAGCGCGATCGTCG
ACGGTATTGCCGAGGGGTGCATGCTCGCGGGCTGTGCGTTACTGGGTGGT
GAGACCGCAGAACACCCTGGTCTGATGGAAGTCGACCACTACGACATCGC
GGCGACCGGCGTCGGTGTTGTGGAAGCCGACGATACCCTGGGGCCAGATC
GTGTCAAACCCGGTGACGTAATCATCGCGCTGAGGTCTTCGGGTCTCCAT
TCCAACGGATACTCGCTGGCTCGCTCGGTCCTACTCGAGATCGATCGGAT
GAACCTGGCCGGTTATGTGGAGGAGTTCGGTCGCACCCTGGGCGAAGAGC
TATTGGAGCCCACCCGCATCTACGCCAAGGACTGTCTGGCATTGGCGGCC
GAAACTCACGTCCGTACCTTCTGTCACGTTACCGGCGGCGGGCTGGCCGG
CAATCTTCAACGCGTTATCCCACACGGATTGGTCGCCGAAGTTGACCGCG
GCACGTGGACACCTGCACCGGTGTTCGCCATGATAGCCCAGCGTGGCAGG
GTCGCGCGTGAAGAGATGGAAAAGACGTTCAACATGGGCGTCGGCATGAT
CGCCGTGGTCGCGCCTGAAGATACTGACCGTGCTTTGGCGATATTGACCG
CACGTCACTTGGACTGCTGGGTGCTGGGCACTGTCTGCAAAGGCAGCAAA
GTAGGCCCACGGGCAAAACTGGTCGGACAACACCCGAGATTC
>C1
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C2
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C3
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C4
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C5
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF
>C6
MMDPGKSPGGQLGNHGITYASTGVDIEAGDRSVELFKPMAVKAIRTEVLG
GLGGFAGLFALRSGYREPVLAASTDGVGTKLAVAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLQDYIAVGRTVPERLSAIVDGIAEGCMLAGCALLGG
ETAEHPGLMEVDHYDIAATGVGVVEADDTLGPDRVKPGDVIIALRSSGLH
SNGYSLARSVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETHVRTFCHVTGGGLAGNLQRVIPHGLVAEVDRGTWTPAPVFAMIAQRGR
VAREEMEKTFNMGVGMIAVVAPEDTDRALAILTARHLDCWVLGTVCKGSK
VGPRAKLVGQHPRF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1092 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579786686
      Setting output file names to "/data/10res/purM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1158616360
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9489433375
      Seed = 565763241
      Swapseed = 1579786686
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2443.948207 -- -24.965149
         Chain 2 -- -2443.948348 -- -24.965149
         Chain 3 -- -2443.948348 -- -24.965149
         Chain 4 -- -2443.948207 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2443.948348 -- -24.965149
         Chain 2 -- -2443.948348 -- -24.965149
         Chain 3 -- -2443.948207 -- -24.965149
         Chain 4 -- -2443.948207 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2443.948] (-2443.948) (-2443.948) (-2443.948) * [-2443.948] (-2443.948) (-2443.948) (-2443.948) 
        500 -- (-1505.554) (-1502.463) (-1514.312) [-1501.444] * (-1500.229) (-1523.454) (-1496.228) [-1512.218] -- 0:00:00
       1000 -- (-1496.265) (-1492.753) (-1512.655) [-1496.840] * [-1492.158] (-1504.931) (-1495.016) (-1503.199) -- 0:00:00
       1500 -- (-1503.537) [-1498.776] (-1507.202) (-1503.294) * [-1491.241] (-1491.477) (-1495.926) (-1503.761) -- 0:00:00
       2000 -- (-1504.022) (-1501.331) (-1498.634) [-1503.653] * (-1499.363) [-1497.675] (-1498.237) (-1501.505) -- 0:00:00
       2500 -- [-1497.118] (-1506.138) (-1508.201) (-1496.974) * [-1495.641] (-1504.494) (-1496.248) (-1500.320) -- 0:00:00
       3000 -- (-1496.884) (-1500.759) (-1505.665) [-1492.724] * (-1497.909) [-1495.671] (-1505.017) (-1492.861) -- 0:00:00
       3500 -- (-1502.262) [-1498.587] (-1497.686) (-1497.364) * [-1495.798] (-1503.512) (-1495.820) (-1498.864) -- 0:00:00
       4000 -- (-1500.774) [-1495.641] (-1505.082) (-1504.614) * (-1496.220) [-1497.086] (-1496.027) (-1495.358) -- 0:00:00
       4500 -- (-1498.239) (-1506.488) [-1493.657] (-1496.438) * (-1499.374) (-1502.061) (-1491.988) [-1493.657] -- 0:00:00
       5000 -- (-1500.873) [-1496.289] (-1501.446) (-1496.428) * (-1502.872) (-1502.428) [-1499.682] (-1496.486) -- 0:00:00

      Average standard deviation of split frequencies: 0.082309

       5500 -- (-1499.403) [-1494.875] (-1499.794) (-1504.585) * [-1499.663] (-1495.612) (-1499.281) (-1495.557) -- 0:00:00
       6000 -- [-1494.002] (-1500.483) (-1492.900) (-1505.962) * (-1495.258) (-1502.262) [-1495.647] (-1493.974) -- 0:02:45
       6500 -- (-1495.948) [-1498.671] (-1494.637) (-1502.095) * (-1497.884) [-1495.816] (-1497.104) (-1501.452) -- 0:02:32
       7000 -- (-1493.466) (-1499.763) [-1492.631] (-1500.058) * [-1500.522] (-1495.164) (-1496.423) (-1498.288) -- 0:02:21
       7500 -- (-1501.223) (-1499.291) [-1496.700] (-1499.709) * (-1501.186) [-1501.146] (-1508.474) (-1505.279) -- 0:02:12
       8000 -- (-1494.976) (-1495.579) [-1500.459] (-1500.208) * (-1496.096) (-1501.062) [-1494.048] (-1494.499) -- 0:02:04
       8500 -- [-1499.220] (-1500.704) (-1498.402) (-1497.267) * [-1494.478] (-1493.903) (-1500.008) (-1498.795) -- 0:01:56
       9000 -- (-1511.115) [-1495.275] (-1494.104) (-1506.778) * (-1499.652) (-1500.334) (-1493.161) [-1500.433] -- 0:01:50
       9500 -- (-1500.728) [-1494.436] (-1512.303) (-1499.423) * (-1496.667) (-1498.253) [-1493.385] (-1496.409) -- 0:01:44
      10000 -- (-1502.781) [-1491.873] (-1497.880) (-1502.824) * (-1501.713) (-1494.915) [-1495.525] (-1499.021) -- 0:01:39

      Average standard deviation of split frequencies: 0.059662

      10500 -- [-1494.430] (-1494.221) (-1498.039) (-1500.614) * (-1497.268) (-1496.678) [-1493.733] (-1503.974) -- 0:01:34
      11000 -- (-1495.950) (-1502.719) [-1492.918] (-1502.259) * (-1496.621) [-1494.013] (-1503.172) (-1501.568) -- 0:01:29
      11500 -- (-1499.981) (-1498.846) [-1496.462] (-1497.408) * (-1498.469) (-1499.473) (-1498.590) [-1494.261] -- 0:01:25
      12000 -- (-1500.058) [-1498.249] (-1502.035) (-1495.729) * (-1497.630) (-1493.817) [-1493.039] (-1496.979) -- 0:01:22
      12500 -- (-1496.495) (-1501.846) [-1504.064] (-1496.568) * (-1496.450) (-1505.072) [-1493.539] (-1497.825) -- 0:01:19
      13000 -- (-1496.302) (-1497.628) (-1496.630) [-1499.763] * [-1495.316] (-1498.687) (-1494.589) (-1499.084) -- 0:01:15
      13500 -- (-1488.947) (-1502.781) (-1501.856) [-1496.685] * (-1499.848) [-1493.963] (-1496.897) (-1503.862) -- 0:01:13
      14000 -- (-1488.884) (-1494.981) (-1498.994) [-1494.820] * (-1502.710) (-1501.270) (-1502.012) [-1496.755] -- 0:01:10
      14500 -- (-1491.359) (-1499.183) [-1498.330] (-1495.025) * [-1497.748] (-1494.474) (-1503.199) (-1493.177) -- 0:01:07
      15000 -- (-1489.507) (-1505.206) (-1501.995) [-1495.522] * (-1495.241) [-1492.294] (-1508.722) (-1495.416) -- 0:01:05

      Average standard deviation of split frequencies: 0.077534

      15500 -- (-1493.359) (-1497.948) (-1501.425) [-1500.525] * (-1493.027) (-1503.976) (-1490.358) [-1498.681] -- 0:01:03
      16000 -- (-1489.820) [-1494.081] (-1504.240) (-1496.653) * (-1492.718) (-1500.495) (-1489.746) [-1501.538] -- 0:01:01
      16500 -- (-1488.939) [-1499.521] (-1492.672) (-1499.090) * (-1501.732) (-1489.502) (-1488.923) [-1504.831] -- 0:00:59
      17000 -- (-1490.824) [-1493.834] (-1499.359) (-1497.987) * (-1494.003) (-1490.856) [-1487.021] (-1496.692) -- 0:00:57
      17500 -- [-1489.199] (-1510.013) (-1495.786) (-1497.091) * (-1502.023) (-1488.091) [-1491.739] (-1503.455) -- 0:00:56
      18000 -- [-1488.839] (-1502.768) (-1498.021) (-1494.909) * (-1489.739) (-1491.387) (-1489.914) [-1494.438] -- 0:00:54
      18500 -- (-1491.402) (-1503.247) (-1506.438) [-1503.378] * (-1504.368) (-1491.747) (-1490.418) [-1496.734] -- 0:00:53
      19000 -- (-1490.519) [-1498.691] (-1500.127) (-1497.971) * (-1498.882) (-1491.184) [-1487.951] (-1496.632) -- 0:00:51
      19500 -- (-1488.935) (-1502.595) (-1502.993) [-1494.974] * (-1500.885) (-1490.617) (-1486.664) [-1500.777] -- 0:00:50
      20000 -- [-1489.665] (-1503.848) (-1501.139) (-1503.410) * [-1495.921] (-1488.028) (-1488.644) (-1501.220) -- 0:00:49

      Average standard deviation of split frequencies: 0.057025

      20500 -- (-1490.466) (-1488.684) [-1497.340] (-1498.662) * (-1505.510) (-1487.742) [-1488.986] (-1497.851) -- 0:01:35
      21000 -- [-1487.520] (-1488.003) (-1504.934) (-1502.833) * (-1503.179) [-1487.542] (-1488.001) (-1497.007) -- 0:01:33
      21500 -- (-1487.965) (-1489.515) [-1493.611] (-1501.772) * (-1496.102) [-1491.500] (-1487.727) (-1498.597) -- 0:01:31
      22000 -- [-1487.417] (-1490.352) (-1496.008) (-1498.215) * (-1495.457) (-1489.611) [-1488.166] (-1503.142) -- 0:01:28
      22500 -- (-1487.273) (-1490.691) [-1494.630] (-1498.188) * [-1504.209] (-1487.599) (-1487.841) (-1497.805) -- 0:01:26
      23000 -- [-1490.364] (-1491.048) (-1495.748) (-1499.104) * (-1499.305) (-1488.719) [-1488.548] (-1499.397) -- 0:01:24
      23500 -- [-1487.702] (-1488.397) (-1496.648) (-1500.282) * (-1497.677) (-1489.777) (-1487.867) [-1489.897] -- 0:01:23
      24000 -- [-1488.978] (-1488.531) (-1500.875) (-1502.643) * [-1493.097] (-1491.449) (-1487.701) (-1489.470) -- 0:01:21
      24500 -- (-1488.199) [-1488.841] (-1501.443) (-1494.633) * (-1501.175) [-1493.823] (-1487.361) (-1493.658) -- 0:01:19
      25000 -- [-1489.990] (-1488.659) (-1495.380) (-1496.191) * (-1497.387) (-1491.772) (-1493.878) [-1489.640] -- 0:01:18

      Average standard deviation of split frequencies: 0.040795

      25500 -- (-1489.355) [-1487.584] (-1502.642) (-1497.775) * (-1497.905) [-1489.757] (-1489.371) (-1488.294) -- 0:01:16
      26000 -- (-1490.209) (-1488.652) (-1497.938) [-1496.723] * (-1504.411) (-1488.404) (-1488.588) [-1488.137] -- 0:01:14
      26500 -- (-1489.675) (-1487.575) (-1492.176) [-1494.693] * (-1506.448) (-1489.037) (-1488.219) [-1487.939] -- 0:01:13
      27000 -- (-1487.980) (-1487.314) (-1494.911) [-1496.734] * (-1495.260) (-1492.506) [-1492.700] (-1487.788) -- 0:01:12
      27500 -- (-1488.466) (-1487.569) [-1498.251] (-1499.167) * (-1498.556) (-1489.107) (-1488.106) [-1491.410] -- 0:01:10
      28000 -- (-1488.854) (-1487.569) [-1498.981] (-1496.380) * [-1498.193] (-1487.604) (-1489.004) (-1491.424) -- 0:01:09
      28500 -- (-1489.325) (-1492.113) (-1500.124) [-1496.362] * (-1497.351) (-1486.931) (-1488.207) [-1489.184] -- 0:01:08
      29000 -- (-1494.854) (-1489.194) [-1497.587] (-1501.851) * [-1488.787] (-1487.458) (-1488.821) (-1492.631) -- 0:01:06
      29500 -- (-1491.215) (-1490.208) (-1499.489) [-1499.407] * (-1489.319) (-1487.723) [-1489.776] (-1488.605) -- 0:01:05
      30000 -- [-1488.942] (-1489.536) (-1502.140) (-1498.465) * [-1487.445] (-1487.560) (-1489.023) (-1486.985) -- 0:01:04

      Average standard deviation of split frequencies: 0.033980

      30500 -- [-1489.538] (-1487.087) (-1506.180) (-1497.229) * (-1487.202) [-1488.008] (-1489.068) (-1488.644) -- 0:01:03
      31000 -- (-1489.466) [-1487.942] (-1501.278) (-1502.356) * (-1487.424) (-1488.645) [-1488.476] (-1490.655) -- 0:01:02
      31500 -- (-1487.276) [-1487.901] (-1498.207) (-1495.370) * (-1487.178) (-1490.029) (-1489.907) [-1491.787] -- 0:01:01
      32000 -- (-1487.752) (-1487.304) (-1502.947) [-1502.205] * (-1488.272) [-1490.115] (-1489.336) (-1489.299) -- 0:01:00
      32500 -- (-1487.371) [-1488.497] (-1501.973) (-1495.226) * [-1489.175] (-1486.563) (-1488.475) (-1492.401) -- 0:00:59
      33000 -- [-1487.357] (-1487.735) (-1493.814) (-1496.447) * (-1487.081) (-1488.273) (-1488.466) [-1489.872] -- 0:00:58
      33500 -- (-1488.207) [-1489.374] (-1500.942) (-1498.865) * (-1487.046) (-1488.956) [-1488.984] (-1490.749) -- 0:00:57
      34000 -- (-1487.529) (-1488.731) [-1492.944] (-1509.768) * (-1488.068) (-1488.011) (-1488.696) [-1488.817] -- 0:00:56
      34500 -- (-1490.312) (-1488.114) (-1501.125) [-1489.326] * (-1486.746) (-1489.216) (-1487.954) [-1490.389] -- 0:01:23
      35000 -- (-1490.235) (-1490.048) (-1499.845) [-1487.049] * (-1490.050) (-1492.818) [-1487.580] (-1491.299) -- 0:01:22

      Average standard deviation of split frequencies: 0.036010

      35500 -- (-1490.271) (-1489.647) (-1496.782) [-1487.301] * [-1490.277] (-1487.504) (-1487.811) (-1488.194) -- 0:01:21
      36000 -- (-1489.346) (-1490.273) (-1499.386) [-1488.532] * (-1487.132) [-1487.498] (-1489.180) (-1491.384) -- 0:01:20
      36500 -- (-1487.720) [-1488.261] (-1507.666) (-1488.524) * (-1487.966) (-1488.063) [-1487.880] (-1489.444) -- 0:01:19
      37000 -- [-1488.915] (-1490.279) (-1496.448) (-1492.604) * [-1487.956] (-1488.500) (-1491.744) (-1488.811) -- 0:01:18
      37500 -- (-1488.463) [-1488.131] (-1498.086) (-1489.032) * (-1487.862) [-1487.450] (-1487.860) (-1489.179) -- 0:01:17
      38000 -- (-1490.452) [-1487.858] (-1499.537) (-1488.513) * [-1486.952] (-1487.452) (-1491.037) (-1493.972) -- 0:01:15
      38500 -- (-1490.409) [-1487.662] (-1499.427) (-1488.247) * (-1487.192) [-1487.443] (-1487.781) (-1488.573) -- 0:01:14
      39000 -- [-1489.356] (-1488.672) (-1498.421) (-1489.827) * [-1490.366] (-1489.127) (-1487.757) (-1492.686) -- 0:01:13
      39500 -- (-1489.466) (-1488.639) (-1498.105) [-1489.831] * (-1490.309) [-1487.730] (-1488.644) (-1489.629) -- 0:01:12
      40000 -- (-1488.253) [-1492.477] (-1497.099) (-1489.392) * (-1489.376) [-1488.261] (-1489.318) (-1489.354) -- 0:01:12

      Average standard deviation of split frequencies: 0.040572

      40500 -- (-1487.804) (-1490.059) [-1495.153] (-1492.017) * (-1490.791) [-1488.903] (-1488.567) (-1489.585) -- 0:01:11
      41000 -- (-1488.123) (-1491.538) [-1494.088] (-1489.519) * [-1489.114] (-1489.338) (-1489.150) (-1489.548) -- 0:01:10
      41500 -- (-1488.209) (-1489.229) (-1496.711) [-1490.285] * [-1489.249] (-1494.113) (-1488.266) (-1491.414) -- 0:01:09
      42000 -- (-1490.430) (-1489.224) [-1497.319] (-1489.369) * (-1488.240) (-1493.927) [-1489.219] (-1491.261) -- 0:01:08
      42500 -- (-1488.666) (-1488.195) [-1492.215] (-1489.019) * (-1491.141) (-1491.978) [-1489.723] (-1487.200) -- 0:01:07
      43000 -- (-1490.458) [-1489.592] (-1495.993) (-1489.364) * (-1492.330) [-1490.976] (-1487.429) (-1487.088) -- 0:01:06
      43500 -- (-1490.894) [-1487.519] (-1501.594) (-1489.207) * [-1491.451] (-1490.585) (-1489.654) (-1488.595) -- 0:01:05
      44000 -- (-1490.659) [-1488.247] (-1494.887) (-1488.828) * [-1492.116] (-1492.138) (-1488.805) (-1488.595) -- 0:01:05
      44500 -- [-1490.768] (-1487.753) (-1500.163) (-1489.248) * [-1492.272] (-1487.425) (-1489.148) (-1488.135) -- 0:01:04
      45000 -- [-1493.699] (-1488.396) (-1503.415) (-1488.707) * (-1492.572) (-1487.649) (-1489.859) [-1486.750] -- 0:01:03

      Average standard deviation of split frequencies: 0.026352

      45500 -- (-1494.586) (-1487.852) (-1496.928) [-1490.281] * (-1489.662) [-1487.204] (-1491.543) (-1486.791) -- 0:01:02
      46000 -- (-1488.849) [-1487.835] (-1506.433) (-1488.083) * [-1489.614] (-1488.503) (-1489.110) (-1488.042) -- 0:01:02
      46500 -- (-1488.789) [-1490.198] (-1497.589) (-1489.860) * (-1487.300) (-1489.461) (-1488.048) [-1488.008] -- 0:01:01
      47000 -- (-1489.227) (-1487.593) (-1500.736) [-1488.611] * (-1486.511) (-1487.406) (-1489.176) [-1488.235] -- 0:01:00
      47500 -- [-1487.402] (-1489.685) (-1497.669) (-1489.974) * (-1489.314) (-1489.091) (-1492.453) [-1486.889] -- 0:01:00
      48000 -- [-1487.455] (-1489.685) (-1490.110) (-1488.673) * (-1486.873) [-1489.782] (-1487.994) (-1490.111) -- 0:00:59
      48500 -- (-1487.683) (-1488.238) [-1488.671] (-1488.480) * [-1486.873] (-1490.847) (-1490.349) (-1492.964) -- 0:00:58
      49000 -- [-1491.019] (-1492.687) (-1488.620) (-1491.293) * (-1487.896) (-1490.323) (-1490.167) [-1490.727] -- 0:00:58
      49500 -- (-1490.092) (-1490.523) [-1487.257] (-1492.106) * (-1487.020) (-1490.173) (-1490.954) [-1491.312] -- 0:01:16
      50000 -- (-1490.526) (-1490.011) [-1487.513] (-1492.165) * (-1488.295) (-1487.433) [-1489.588] (-1490.629) -- 0:01:16

      Average standard deviation of split frequencies: 0.023482

      50500 -- (-1491.091) (-1490.150) [-1489.700] (-1492.805) * (-1488.842) [-1488.466] (-1492.394) (-1493.328) -- 0:01:15
      51000 -- [-1487.996] (-1488.962) (-1493.555) (-1491.306) * (-1487.734) [-1490.054] (-1487.977) (-1487.694) -- 0:01:14
      51500 -- (-1487.442) (-1488.866) [-1491.125] (-1492.095) * (-1491.320) [-1490.313] (-1487.284) (-1488.407) -- 0:01:13
      52000 -- (-1486.846) [-1487.779] (-1487.891) (-1490.577) * (-1489.967) (-1487.488) (-1487.432) [-1489.404] -- 0:01:12
      52500 -- (-1486.900) [-1490.029] (-1487.565) (-1492.121) * (-1493.899) (-1487.278) [-1488.889] (-1488.208) -- 0:01:12
      53000 -- (-1489.399) (-1490.687) (-1491.707) [-1488.100] * (-1494.439) (-1488.681) (-1489.782) [-1489.740] -- 0:01:11
      53500 -- (-1494.977) (-1487.625) (-1489.300) [-1489.758] * (-1490.379) (-1488.776) (-1490.926) [-1489.401] -- 0:01:10
      54000 -- [-1491.384] (-1487.438) (-1487.604) (-1487.926) * (-1492.953) (-1488.428) (-1489.004) [-1488.069] -- 0:01:10
      54500 -- [-1487.930] (-1487.521) (-1488.147) (-1488.905) * (-1489.781) [-1489.224] (-1489.287) (-1492.003) -- 0:01:09
      55000 -- (-1488.935) [-1487.553] (-1489.390) (-1489.404) * [-1488.166] (-1488.178) (-1488.549) (-1492.852) -- 0:01:08

      Average standard deviation of split frequencies: 0.021245

      55500 -- (-1487.487) (-1487.632) (-1490.001) [-1488.026] * (-1488.205) [-1488.592] (-1488.547) (-1488.557) -- 0:01:08
      56000 -- (-1488.633) (-1486.931) [-1488.837] (-1487.585) * (-1489.535) (-1488.631) [-1488.670] (-1490.092) -- 0:01:07
      56500 -- (-1488.049) (-1492.600) [-1488.238] (-1487.118) * (-1489.198) (-1492.084) [-1488.530] (-1489.371) -- 0:01:06
      57000 -- (-1489.485) [-1492.245] (-1490.503) (-1486.893) * (-1490.687) (-1489.059) [-1487.261] (-1489.368) -- 0:01:06
      57500 -- (-1489.533) [-1493.700] (-1490.061) (-1487.862) * (-1489.748) [-1487.586] (-1490.654) (-1486.599) -- 0:01:05
      58000 -- (-1487.072) (-1489.773) (-1487.205) [-1488.140] * (-1488.465) (-1490.263) (-1491.065) [-1487.500] -- 0:01:04
      58500 -- (-1489.454) (-1487.442) (-1487.395) [-1488.928] * (-1489.159) (-1493.628) (-1489.530) [-1489.737] -- 0:01:04
      59000 -- (-1489.049) (-1488.909) (-1486.931) [-1487.985] * (-1488.828) (-1489.725) [-1490.875] (-1489.260) -- 0:01:03
      59500 -- (-1487.920) (-1488.249) (-1488.495) [-1488.099] * (-1487.006) [-1488.703] (-1490.723) (-1491.809) -- 0:01:03
      60000 -- [-1489.766] (-1489.643) (-1489.383) (-1487.637) * (-1488.990) [-1491.976] (-1490.485) (-1488.274) -- 0:01:02

      Average standard deviation of split frequencies: 0.021757

      60500 -- (-1488.200) (-1492.881) (-1488.094) [-1489.559] * (-1488.652) (-1490.082) (-1490.136) [-1489.974] -- 0:01:02
      61000 -- (-1489.618) [-1488.829] (-1489.073) (-1489.785) * (-1487.963) (-1491.730) (-1489.537) [-1487.955] -- 0:01:01
      61500 -- (-1488.132) (-1488.360) [-1493.409] (-1489.567) * [-1487.482] (-1489.069) (-1489.941) (-1487.782) -- 0:01:01
      62000 -- (-1489.750) (-1486.966) (-1489.447) [-1488.135] * (-1490.992) [-1488.504] (-1490.689) (-1490.801) -- 0:01:00
      62500 -- (-1490.052) (-1493.508) (-1486.972) [-1489.296] * (-1488.103) (-1489.058) (-1492.237) [-1492.897] -- 0:01:00
      63000 -- (-1490.296) (-1495.040) (-1488.182) [-1490.338] * (-1488.943) (-1490.650) [-1491.700] (-1487.217) -- 0:00:59
      63500 -- (-1489.491) (-1493.268) (-1490.377) [-1487.527] * [-1487.640] (-1491.250) (-1493.643) (-1487.499) -- 0:00:58
      64000 -- [-1488.158] (-1493.138) (-1496.710) (-1489.719) * (-1489.129) [-1489.718] (-1492.686) (-1487.018) -- 0:00:58
      64500 -- (-1488.315) [-1488.659] (-1492.601) (-1487.703) * (-1487.252) [-1490.202] (-1491.894) (-1488.035) -- 0:00:58
      65000 -- [-1488.450] (-1486.638) (-1488.796) (-1487.915) * [-1487.634] (-1493.173) (-1490.989) (-1487.770) -- 0:01:11

      Average standard deviation of split frequencies: 0.020300

      65500 -- (-1490.126) (-1487.536) (-1491.885) [-1490.188] * (-1487.717) [-1487.635] (-1488.436) (-1489.491) -- 0:01:11
      66000 -- [-1488.399] (-1488.889) (-1493.817) (-1492.910) * [-1489.303] (-1490.360) (-1488.421) (-1489.233) -- 0:01:10
      66500 -- (-1489.009) [-1488.455] (-1488.903) (-1495.933) * (-1488.800) (-1492.213) (-1489.091) [-1489.360] -- 0:01:10
      67000 -- (-1491.598) (-1486.988) [-1487.395] (-1493.223) * (-1489.751) [-1489.493] (-1489.320) (-1491.185) -- 0:01:09
      67500 -- (-1487.382) (-1489.130) [-1487.257] (-1488.733) * (-1491.042) (-1489.344) [-1488.305] (-1491.909) -- 0:01:09
      68000 -- (-1489.604) (-1490.320) [-1489.739] (-1489.242) * [-1489.139] (-1490.265) (-1488.427) (-1489.202) -- 0:01:08
      68500 -- (-1488.159) (-1486.759) [-1489.139] (-1492.070) * (-1487.587) (-1489.731) (-1489.267) [-1489.389] -- 0:01:07
      69000 -- (-1487.550) (-1487.248) [-1488.033] (-1490.228) * (-1489.357) (-1491.721) [-1487.253] (-1490.504) -- 0:01:07
      69500 -- (-1489.065) (-1486.985) (-1487.397) [-1487.747] * (-1493.173) (-1488.705) [-1487.696] (-1490.301) -- 0:01:06
      70000 -- [-1489.837] (-1491.629) (-1487.941) (-1488.100) * (-1490.247) (-1489.358) [-1487.019] (-1490.049) -- 0:01:06

      Average standard deviation of split frequencies: 0.020346

      70500 -- (-1491.263) (-1489.899) (-1487.350) [-1487.604] * [-1486.676] (-1489.349) (-1489.926) (-1487.436) -- 0:01:05
      71000 -- (-1492.593) [-1489.224] (-1488.403) (-1493.190) * (-1490.437) [-1489.245] (-1491.944) (-1489.037) -- 0:01:05
      71500 -- (-1490.064) (-1492.287) [-1488.114] (-1493.197) * (-1489.897) (-1488.888) [-1490.252] (-1494.219) -- 0:01:04
      72000 -- [-1487.541] (-1488.617) (-1488.958) (-1491.218) * (-1488.422) (-1488.480) [-1488.051] (-1494.462) -- 0:01:04
      72500 -- [-1492.683] (-1487.737) (-1492.759) (-1491.257) * (-1488.888) [-1489.170] (-1487.883) (-1491.906) -- 0:01:03
      73000 -- (-1488.608) [-1488.521] (-1487.024) (-1491.187) * (-1490.736) (-1490.724) [-1488.757] (-1488.616) -- 0:01:03
      73500 -- [-1488.915] (-1487.068) (-1487.210) (-1491.040) * (-1488.367) [-1489.212] (-1489.490) (-1489.283) -- 0:01:03
      74000 -- [-1488.010] (-1489.446) (-1489.026) (-1492.147) * (-1488.374) (-1490.679) [-1488.952] (-1489.092) -- 0:01:02
      74500 -- [-1488.418] (-1488.669) (-1489.626) (-1494.376) * (-1495.887) (-1490.764) [-1491.244] (-1487.366) -- 0:01:02
      75000 -- (-1487.485) (-1488.803) (-1491.800) [-1488.623] * (-1489.212) (-1491.317) (-1491.322) [-1487.864] -- 0:01:01

      Average standard deviation of split frequencies: 0.019914

      75500 -- (-1488.037) [-1488.790] (-1488.460) (-1487.142) * (-1489.202) (-1487.055) [-1486.606] (-1486.659) -- 0:01:01
      76000 -- [-1487.943] (-1489.585) (-1487.892) (-1488.252) * (-1488.060) (-1487.958) [-1487.568] (-1486.893) -- 0:01:00
      76500 -- (-1488.118) (-1490.274) (-1489.489) [-1487.407] * (-1488.717) (-1493.159) [-1486.794] (-1490.371) -- 0:01:00
      77000 -- (-1490.233) [-1487.876] (-1489.489) (-1489.819) * (-1490.001) (-1489.868) [-1487.383] (-1488.433) -- 0:00:59
      77500 -- [-1488.247] (-1487.613) (-1487.519) (-1487.555) * (-1487.994) (-1488.398) [-1490.271] (-1491.949) -- 0:00:59
      78000 -- [-1488.504] (-1489.612) (-1487.014) (-1490.523) * (-1487.956) (-1489.731) (-1489.334) [-1488.576] -- 0:00:59
      78500 -- [-1489.934] (-1487.777) (-1487.511) (-1489.136) * [-1489.494] (-1491.001) (-1488.125) (-1487.509) -- 0:00:58
      79000 -- (-1486.827) (-1487.355) [-1488.968] (-1486.887) * [-1490.201] (-1487.669) (-1488.184) (-1488.211) -- 0:00:58
      79500 -- (-1487.180) (-1489.239) (-1487.454) [-1488.724] * (-1490.647) (-1486.854) [-1490.992] (-1487.799) -- 0:00:57
      80000 -- [-1488.189] (-1489.967) (-1488.339) (-1486.920) * (-1491.791) (-1486.796) [-1487.924] (-1487.496) -- 0:00:57

      Average standard deviation of split frequencies: 0.017239

      80500 -- [-1487.334] (-1488.241) (-1487.426) (-1487.433) * [-1489.921] (-1490.409) (-1495.386) (-1487.496) -- 0:00:57
      81000 -- (-1487.774) [-1491.066] (-1488.626) (-1488.004) * (-1488.333) (-1488.684) (-1494.533) [-1487.496] -- 0:01:08
      81500 -- (-1487.345) (-1489.031) (-1489.949) [-1487.219] * (-1491.622) (-1488.618) (-1489.667) [-1488.225] -- 0:01:07
      82000 -- [-1487.207] (-1489.015) (-1488.609) (-1487.039) * (-1491.434) (-1490.119) [-1490.241] (-1489.216) -- 0:01:07
      82500 -- (-1492.040) [-1487.969] (-1487.122) (-1486.696) * (-1488.684) (-1489.588) (-1492.062) [-1487.271] -- 0:01:06
      83000 -- (-1492.296) [-1487.994] (-1487.360) (-1487.251) * (-1489.086) (-1488.362) (-1488.765) [-1487.537] -- 0:01:06
      83500 -- (-1492.108) (-1489.943) [-1488.092] (-1490.573) * (-1490.267) [-1488.092] (-1489.019) (-1490.017) -- 0:01:05
      84000 -- (-1491.740) (-1487.559) [-1487.184] (-1487.276) * (-1489.623) [-1489.453] (-1488.046) (-1487.351) -- 0:01:05
      84500 -- (-1491.561) (-1487.089) [-1488.019] (-1488.440) * [-1487.713] (-1491.372) (-1489.150) (-1487.359) -- 0:01:05
      85000 -- (-1494.184) [-1488.341] (-1487.606) (-1488.684) * (-1488.887) [-1490.982] (-1490.705) (-1487.583) -- 0:01:04

      Average standard deviation of split frequencies: 0.017887

      85500 -- (-1495.998) [-1488.579] (-1487.214) (-1487.307) * [-1488.533] (-1490.977) (-1492.257) (-1491.214) -- 0:01:04
      86000 -- (-1495.376) (-1491.519) [-1486.639] (-1487.441) * (-1487.252) (-1489.467) (-1491.336) [-1489.163] -- 0:01:03
      86500 -- (-1490.645) (-1489.858) [-1487.198] (-1488.188) * (-1487.659) (-1488.958) [-1489.379] (-1488.597) -- 0:01:03
      87000 -- (-1488.317) (-1490.820) [-1488.221] (-1489.782) * [-1488.776] (-1487.944) (-1489.668) (-1489.193) -- 0:01:02
      87500 -- [-1488.750] (-1491.499) (-1491.704) (-1492.037) * (-1487.650) (-1487.425) [-1489.656] (-1489.960) -- 0:01:02
      88000 -- (-1488.636) [-1489.263] (-1490.313) (-1488.605) * (-1487.311) (-1487.626) [-1488.471] (-1492.362) -- 0:01:02
      88500 -- (-1487.372) (-1491.165) [-1487.883] (-1489.340) * [-1488.630] (-1487.602) (-1489.015) (-1491.955) -- 0:01:01
      89000 -- (-1487.096) (-1488.809) (-1489.009) [-1488.426] * (-1487.585) (-1489.249) [-1489.973] (-1493.227) -- 0:01:01
      89500 -- (-1487.166) (-1492.763) [-1490.399] (-1494.090) * [-1487.585] (-1488.791) (-1490.562) (-1489.916) -- 0:01:01
      90000 -- (-1487.522) (-1490.202) [-1491.760] (-1493.301) * (-1487.264) (-1490.103) [-1489.407] (-1487.809) -- 0:01:00

      Average standard deviation of split frequencies: 0.019155

      90500 -- (-1488.843) (-1488.998) [-1491.995] (-1489.829) * [-1487.138] (-1490.371) (-1488.720) (-1487.384) -- 0:01:00
      91000 -- (-1487.668) [-1487.910] (-1490.718) (-1487.764) * (-1487.682) (-1487.605) (-1488.263) [-1489.582] -- 0:00:59
      91500 -- (-1487.284) (-1487.198) [-1490.340] (-1488.455) * (-1489.941) (-1488.269) [-1489.039] (-1494.547) -- 0:00:59
      92000 -- (-1487.301) (-1490.085) (-1493.151) [-1489.640] * (-1488.609) (-1487.953) (-1486.611) [-1496.690] -- 0:00:59
      92500 -- (-1488.154) [-1494.414] (-1493.271) (-1491.930) * (-1488.174) (-1490.638) [-1487.345] (-1489.043) -- 0:00:58
      93000 -- (-1487.945) [-1488.901] (-1487.677) (-1487.440) * (-1488.517) [-1487.937] (-1490.222) (-1491.345) -- 0:00:58
      93500 -- (-1487.748) (-1489.818) [-1487.581] (-1487.383) * [-1489.328] (-1487.122) (-1490.804) (-1488.885) -- 0:00:58
      94000 -- (-1487.748) (-1490.609) (-1489.233) [-1488.466] * (-1489.485) (-1489.101) [-1488.592] (-1488.688) -- 0:00:57
      94500 -- [-1489.524] (-1490.758) (-1489.159) (-1487.778) * (-1487.430) (-1488.699) [-1487.207] (-1490.223) -- 0:00:57
      95000 -- (-1496.365) [-1490.707] (-1487.771) (-1490.713) * (-1487.286) (-1488.397) (-1487.170) [-1489.623] -- 0:00:57

      Average standard deviation of split frequencies: 0.021193

      95500 -- (-1494.523) [-1490.200] (-1486.951) (-1489.764) * (-1486.969) (-1487.949) (-1487.784) [-1490.871] -- 0:00:56
      96000 -- [-1488.930] (-1488.707) (-1486.772) (-1488.807) * (-1488.347) [-1487.298] (-1488.816) (-1489.729) -- 0:00:56
      96500 -- [-1493.376] (-1488.260) (-1487.452) (-1488.728) * [-1487.279] (-1488.140) (-1488.506) (-1488.850) -- 0:00:56
      97000 -- (-1491.147) (-1489.824) [-1487.126] (-1488.577) * (-1487.243) (-1487.816) (-1486.963) [-1487.381] -- 0:01:05
      97500 -- (-1490.584) [-1487.483] (-1487.469) (-1488.854) * (-1492.255) [-1490.791] (-1489.600) (-1491.173) -- 0:01:04
      98000 -- (-1489.238) (-1487.758) (-1490.130) [-1489.221] * (-1488.148) (-1488.991) (-1488.024) [-1489.044] -- 0:01:04
      98500 -- (-1489.094) (-1488.079) (-1489.950) [-1489.266] * (-1490.931) [-1488.315] (-1488.182) (-1488.565) -- 0:01:04
      99000 -- (-1491.500) [-1489.464] (-1491.451) (-1490.981) * [-1489.994] (-1487.102) (-1487.644) (-1488.401) -- 0:01:03
      99500 -- (-1488.679) (-1489.745) (-1491.199) [-1489.661] * (-1497.584) (-1487.016) [-1489.744] (-1488.178) -- 0:01:03
      100000 -- [-1488.474] (-1491.217) (-1491.109) (-1489.840) * (-1491.288) [-1491.033] (-1487.258) (-1489.306) -- 0:01:02

      Average standard deviation of split frequencies: 0.022182

      100500 -- (-1489.190) (-1493.376) (-1490.772) [-1488.454] * (-1488.326) [-1489.791] (-1487.302) (-1488.001) -- 0:01:02
      101000 -- (-1491.879) (-1491.421) [-1488.639] (-1489.044) * [-1487.968] (-1488.798) (-1487.374) (-1489.502) -- 0:01:02
      101500 -- (-1491.660) (-1488.618) (-1487.991) [-1489.265] * [-1490.829] (-1487.067) (-1488.633) (-1488.633) -- 0:01:01
      102000 -- [-1489.305] (-1490.634) (-1488.784) (-1488.187) * (-1488.791) (-1487.214) (-1489.015) [-1488.633] -- 0:01:01
      102500 -- (-1487.601) (-1493.734) (-1491.108) [-1490.086] * (-1487.435) (-1487.534) (-1489.734) [-1487.182] -- 0:01:01
      103000 -- (-1487.128) (-1497.197) (-1491.056) [-1489.088] * (-1488.590) (-1487.412) [-1491.995] (-1488.284) -- 0:01:00
      103500 -- (-1490.081) (-1496.912) (-1487.882) [-1490.730] * (-1491.413) (-1487.343) [-1489.121] (-1491.308) -- 0:01:00
      104000 -- (-1492.695) (-1496.110) (-1488.313) [-1487.916] * (-1489.932) (-1489.301) (-1490.874) [-1489.257] -- 0:01:00
      104500 -- (-1491.596) [-1487.534] (-1487.839) (-1487.597) * [-1490.013] (-1492.133) (-1490.368) (-1492.479) -- 0:00:59
      105000 -- (-1491.328) [-1490.854] (-1489.580) (-1488.573) * (-1497.516) (-1487.838) (-1490.354) [-1489.683] -- 0:00:59

      Average standard deviation of split frequencies: 0.020129

      105500 -- (-1489.885) (-1493.716) (-1489.483) [-1490.285] * (-1490.276) (-1488.391) (-1489.191) [-1490.284] -- 0:00:59
      106000 -- (-1488.473) [-1492.057] (-1490.570) (-1491.413) * (-1491.964) (-1489.027) (-1489.828) [-1489.458] -- 0:00:59
      106500 -- (-1488.098) [-1490.068] (-1489.534) (-1493.466) * (-1495.368) [-1489.412] (-1491.342) (-1489.852) -- 0:00:58
      107000 -- (-1487.844) [-1490.442] (-1490.274) (-1490.429) * [-1487.041] (-1488.016) (-1487.623) (-1489.439) -- 0:00:58
      107500 -- (-1487.224) (-1488.612) [-1488.479] (-1486.760) * [-1488.857] (-1488.085) (-1488.043) (-1489.490) -- 0:00:58
      108000 -- (-1491.429) (-1489.194) (-1487.694) [-1487.398] * [-1486.413] (-1488.025) (-1488.204) (-1489.480) -- 0:00:57
      108500 -- (-1492.068) [-1489.325] (-1487.704) (-1489.145) * (-1491.858) (-1488.450) [-1488.347] (-1493.970) -- 0:00:57
      109000 -- (-1491.399) (-1487.396) (-1488.133) [-1488.050] * [-1492.384] (-1489.261) (-1490.976) (-1489.463) -- 0:00:57
      109500 -- (-1490.191) (-1487.584) (-1487.517) [-1489.401] * (-1490.010) (-1486.752) (-1488.530) [-1490.043] -- 0:00:56
      110000 -- (-1489.670) [-1488.751] (-1487.267) (-1487.914) * [-1489.669] (-1488.644) (-1488.896) (-1487.503) -- 0:00:56

      Average standard deviation of split frequencies: 0.017711

      110500 -- (-1487.763) [-1492.415] (-1487.445) (-1487.223) * (-1488.465) (-1489.123) [-1488.543] (-1490.681) -- 0:00:56
      111000 -- (-1489.511) (-1488.313) (-1487.350) [-1488.579] * (-1487.727) (-1486.579) [-1487.614] (-1487.978) -- 0:00:56
      111500 -- [-1487.600] (-1498.764) (-1487.312) (-1487.164) * (-1489.269) (-1486.978) (-1488.568) [-1488.164] -- 0:00:55
      112000 -- (-1489.044) [-1491.935] (-1491.608) (-1487.078) * (-1488.843) (-1486.753) [-1487.924] (-1491.540) -- 0:00:55
      112500 -- [-1489.094] (-1489.927) (-1492.216) (-1487.821) * (-1489.103) (-1489.136) [-1489.454] (-1486.988) -- 0:01:03
      113000 -- (-1490.425) [-1487.568] (-1487.645) (-1489.400) * [-1486.628] (-1490.527) (-1488.293) (-1486.996) -- 0:01:02
      113500 -- (-1490.144) (-1487.377) (-1490.070) [-1487.793] * (-1487.445) (-1487.981) [-1488.291] (-1487.434) -- 0:01:02
      114000 -- (-1487.517) (-1489.288) [-1488.050] (-1493.769) * (-1488.609) [-1487.701] (-1487.670) (-1488.945) -- 0:01:02
      114500 -- (-1487.985) (-1489.518) [-1489.422] (-1491.117) * [-1487.616] (-1488.985) (-1488.310) (-1486.953) -- 0:01:01
      115000 -- (-1490.653) [-1489.569] (-1489.545) (-1490.092) * (-1487.847) (-1488.749) (-1489.245) [-1488.464] -- 0:01:01

      Average standard deviation of split frequencies: 0.016255

      115500 -- (-1490.026) (-1490.060) (-1489.528) [-1492.402] * (-1487.409) (-1488.020) [-1490.644] (-1492.064) -- 0:01:01
      116000 -- [-1488.913] (-1489.340) (-1488.055) (-1489.049) * (-1487.333) (-1487.962) [-1490.855] (-1494.446) -- 0:01:00
      116500 -- (-1489.363) (-1488.314) (-1488.332) [-1489.395] * [-1489.105] (-1488.485) (-1488.204) (-1489.620) -- 0:01:00
      117000 -- [-1487.956] (-1488.845) (-1488.457) (-1488.693) * (-1493.281) [-1492.220] (-1489.607) (-1489.639) -- 0:01:00
      117500 -- (-1487.694) (-1487.565) (-1491.479) [-1487.008] * (-1493.607) (-1489.277) (-1493.161) [-1488.425] -- 0:01:00
      118000 -- (-1488.414) (-1488.442) [-1490.480] (-1489.865) * (-1486.612) (-1489.041) (-1488.942) [-1487.636] -- 0:00:59
      118500 -- (-1487.813) (-1489.412) (-1488.917) [-1486.985] * (-1488.557) [-1492.021] (-1487.095) (-1489.208) -- 0:00:59
      119000 -- (-1487.766) [-1487.069] (-1489.421) (-1487.955) * [-1487.355] (-1487.462) (-1486.983) (-1488.797) -- 0:00:59
      119500 -- [-1488.417] (-1488.540) (-1489.474) (-1490.052) * (-1489.405) (-1488.066) (-1487.491) [-1488.466] -- 0:00:58
      120000 -- [-1487.779] (-1490.094) (-1488.418) (-1490.596) * (-1492.267) (-1487.416) [-1487.747] (-1488.175) -- 0:00:58

      Average standard deviation of split frequencies: 0.016278

      120500 -- (-1488.444) (-1487.631) [-1488.647] (-1490.064) * (-1498.025) [-1488.861] (-1493.399) (-1491.705) -- 0:00:58
      121000 -- (-1489.135) [-1488.831] (-1488.025) (-1489.785) * (-1487.352) (-1487.252) [-1489.574] (-1489.328) -- 0:00:58
      121500 -- [-1490.396] (-1489.256) (-1487.161) (-1491.502) * (-1487.488) [-1489.779] (-1489.135) (-1490.412) -- 0:00:57
      122000 -- (-1488.394) [-1490.695] (-1486.811) (-1491.020) * [-1491.743] (-1490.512) (-1491.226) (-1493.571) -- 0:00:57
      122500 -- (-1489.485) (-1488.201) [-1487.552] (-1488.926) * [-1492.681] (-1492.173) (-1488.142) (-1491.027) -- 0:00:57
      123000 -- (-1486.621) (-1488.256) (-1489.712) [-1487.837] * (-1487.936) [-1490.478] (-1487.582) (-1490.274) -- 0:00:57
      123500 -- (-1487.511) (-1489.253) [-1495.073] (-1487.973) * (-1490.626) (-1490.616) [-1487.797] (-1489.518) -- 0:00:56
      124000 -- (-1488.042) (-1494.190) [-1492.480] (-1487.845) * [-1489.138] (-1489.089) (-1488.892) (-1486.834) -- 0:00:56
      124500 -- (-1490.094) (-1490.753) (-1489.255) [-1489.048] * (-1489.205) [-1490.073] (-1487.450) (-1486.764) -- 0:00:56
      125000 -- (-1488.961) (-1491.797) (-1488.000) [-1489.607] * (-1489.230) (-1490.661) (-1487.101) [-1487.415] -- 0:00:56

      Average standard deviation of split frequencies: 0.017722

      125500 -- [-1486.881] (-1495.505) (-1487.712) (-1489.701) * (-1487.887) (-1490.194) [-1487.430] (-1487.965) -- 0:00:55
      126000 -- (-1490.859) (-1491.731) [-1487.787] (-1487.529) * (-1487.162) (-1494.574) (-1487.545) [-1487.263] -- 0:00:55
      126500 -- (-1493.749) [-1488.128] (-1490.505) (-1488.058) * (-1487.293) (-1494.232) [-1487.022] (-1489.800) -- 0:00:55
      127000 -- (-1489.934) (-1490.173) (-1487.606) [-1493.906] * (-1487.411) (-1488.406) [-1487.147] (-1489.637) -- 0:00:54
      127500 -- (-1490.755) (-1487.846) [-1489.967] (-1489.445) * (-1487.448) (-1488.146) [-1489.164] (-1488.424) -- 0:00:54
      128000 -- (-1488.658) [-1487.847] (-1493.465) (-1487.364) * (-1488.626) [-1489.386] (-1492.756) (-1488.970) -- 0:00:54
      128500 -- (-1489.176) [-1487.753] (-1488.131) (-1490.721) * (-1487.030) (-1489.835) (-1490.648) [-1488.394] -- 0:00:54
      129000 -- (-1489.110) (-1487.360) (-1489.010) [-1487.712] * (-1487.041) (-1488.023) [-1487.641] (-1491.372) -- 0:01:00
      129500 -- (-1487.843) [-1488.425] (-1489.949) (-1488.529) * (-1488.435) [-1489.012] (-1488.038) (-1488.378) -- 0:01:00
      130000 -- (-1487.719) (-1488.947) (-1488.578) [-1488.162] * (-1489.577) (-1489.348) (-1491.863) [-1489.716] -- 0:01:00

      Average standard deviation of split frequencies: 0.018608

      130500 -- (-1487.413) (-1487.864) (-1489.928) [-1487.937] * [-1487.108] (-1492.511) (-1489.410) (-1493.875) -- 0:00:59
      131000 -- (-1490.152) (-1490.234) [-1489.542] (-1488.784) * [-1487.878] (-1489.518) (-1487.352) (-1491.280) -- 0:00:59
      131500 -- (-1487.889) (-1487.341) (-1490.580) [-1488.200] * [-1488.159] (-1489.826) (-1488.489) (-1487.085) -- 0:00:59
      132000 -- (-1488.721) (-1488.045) (-1489.385) [-1489.585] * (-1490.474) (-1487.851) (-1488.144) [-1487.680] -- 0:00:59
      132500 -- (-1489.403) (-1491.856) (-1488.215) [-1488.323] * (-1487.685) (-1487.851) [-1488.470] (-1489.141) -- 0:00:58
      133000 -- (-1487.892) (-1492.001) [-1488.687] (-1488.448) * [-1487.537] (-1498.932) (-1489.693) (-1487.468) -- 0:00:58
      133500 -- (-1488.935) (-1491.147) [-1487.351] (-1488.461) * [-1489.084] (-1491.065) (-1492.894) (-1490.438) -- 0:00:58
      134000 -- (-1488.354) [-1490.389] (-1488.503) (-1489.481) * (-1489.691) (-1489.919) [-1489.569] (-1489.143) -- 0:00:58
      134500 -- (-1487.570) (-1490.517) [-1487.239] (-1488.018) * [-1490.171] (-1489.313) (-1487.601) (-1489.910) -- 0:00:57
      135000 -- (-1487.614) (-1491.022) (-1487.600) [-1488.064] * (-1488.633) (-1488.350) [-1488.088] (-1492.059) -- 0:00:57

      Average standard deviation of split frequencies: 0.018872

      135500 -- (-1487.515) (-1488.604) [-1487.620] (-1489.018) * (-1491.698) [-1490.482] (-1488.918) (-1487.203) -- 0:00:57
      136000 -- (-1489.630) (-1488.064) (-1487.620) [-1487.488] * (-1491.296) (-1489.214) [-1486.961] (-1488.044) -- 0:00:57
      136500 -- (-1488.778) (-1488.058) [-1486.865] (-1495.772) * (-1486.730) [-1489.995] (-1487.115) (-1489.467) -- 0:00:56
      137000 -- (-1487.808) (-1490.393) (-1488.635) [-1489.502] * (-1486.833) [-1489.409] (-1491.253) (-1489.226) -- 0:00:56
      137500 -- [-1487.864] (-1492.581) (-1489.448) (-1489.282) * (-1490.256) (-1492.752) (-1492.972) [-1490.812] -- 0:00:56
      138000 -- [-1487.623] (-1488.905) (-1487.979) (-1487.044) * [-1487.809] (-1487.705) (-1492.093) (-1490.581) -- 0:00:56
      138500 -- (-1487.603) [-1488.720] (-1487.629) (-1490.096) * (-1489.688) [-1487.432] (-1491.956) (-1488.941) -- 0:00:55
      139000 -- [-1487.846] (-1487.373) (-1490.097) (-1489.191) * (-1486.793) (-1487.415) [-1489.639] (-1492.484) -- 0:00:55
      139500 -- (-1488.359) (-1494.287) [-1490.688] (-1488.271) * (-1491.278) [-1487.640] (-1493.290) (-1491.151) -- 0:00:55
      140000 -- (-1491.634) (-1494.153) [-1490.935] (-1487.765) * (-1489.130) [-1487.759] (-1491.351) (-1489.174) -- 0:00:55

      Average standard deviation of split frequencies: 0.017315

      140500 -- (-1491.034) (-1491.522) [-1490.949] (-1488.182) * (-1489.813) (-1488.882) (-1489.827) [-1490.322] -- 0:00:55
      141000 -- (-1490.825) (-1490.748) (-1488.157) [-1489.327] * [-1491.979] (-1489.219) (-1490.641) (-1489.219) -- 0:00:54
      141500 -- (-1488.454) (-1489.650) (-1490.396) [-1487.243] * (-1487.715) (-1489.424) (-1489.195) [-1487.432] -- 0:00:54
      142000 -- (-1487.425) (-1487.219) [-1491.007] (-1487.812) * [-1487.715] (-1489.066) (-1489.270) (-1486.792) -- 0:00:54
      142500 -- (-1490.792) [-1487.194] (-1492.480) (-1488.528) * (-1492.600) [-1490.135] (-1489.127) (-1488.870) -- 0:00:54
      143000 -- (-1489.845) [-1488.198] (-1491.293) (-1496.803) * [-1492.278] (-1488.331) (-1489.536) (-1488.366) -- 0:00:53
      143500 -- (-1492.938) [-1487.013] (-1493.788) (-1496.074) * [-1487.484] (-1490.107) (-1488.805) (-1488.581) -- 0:00:53
      144000 -- (-1488.451) [-1487.333] (-1487.807) (-1487.923) * (-1488.929) (-1487.796) [-1490.314] (-1488.881) -- 0:00:53
      144500 -- (-1487.651) (-1489.200) [-1486.948] (-1486.798) * (-1487.673) (-1489.120) [-1489.441] (-1490.179) -- 0:00:59
      145000 -- (-1487.780) (-1487.443) (-1487.975) [-1490.017] * (-1486.941) [-1488.634] (-1489.724) (-1493.881) -- 0:00:58

      Average standard deviation of split frequencies: 0.018297

      145500 -- (-1489.743) (-1487.380) (-1488.651) [-1487.707] * (-1486.941) [-1489.761] (-1488.702) (-1487.493) -- 0:00:58
      146000 -- (-1487.628) (-1487.782) [-1488.311] (-1488.847) * (-1487.126) (-1490.942) [-1490.025] (-1487.144) -- 0:00:58
      146500 -- (-1490.294) (-1486.779) (-1488.972) [-1488.609] * (-1487.406) [-1489.123] (-1488.723) (-1487.332) -- 0:00:58
      147000 -- [-1489.881] (-1490.369) (-1491.799) (-1492.104) * [-1486.733] (-1491.117) (-1491.051) (-1487.369) -- 0:00:58
      147500 -- (-1488.801) [-1491.039] (-1488.190) (-1492.357) * (-1487.060) [-1488.039] (-1488.155) (-1488.917) -- 0:00:57
      148000 -- (-1490.445) [-1487.874] (-1488.541) (-1489.373) * (-1488.181) [-1490.463] (-1489.770) (-1486.816) -- 0:00:57
      148500 -- [-1488.745] (-1487.776) (-1486.762) (-1488.154) * (-1487.539) (-1491.106) [-1487.822] (-1486.910) -- 0:00:57
      149000 -- (-1489.092) (-1495.913) [-1487.716] (-1486.887) * [-1486.593] (-1492.014) (-1488.826) (-1487.588) -- 0:00:57
      149500 -- (-1488.210) (-1491.089) [-1489.571] (-1487.022) * [-1490.388] (-1490.898) (-1488.419) (-1492.533) -- 0:00:56
      150000 -- [-1488.666] (-1489.482) (-1488.544) (-1487.866) * (-1493.522) (-1487.875) [-1488.524] (-1493.205) -- 0:00:56

      Average standard deviation of split frequencies: 0.014985

      150500 -- (-1486.713) (-1489.878) [-1489.395] (-1489.237) * (-1488.914) (-1492.072) (-1488.946) [-1491.552] -- 0:00:56
      151000 -- (-1491.737) (-1488.958) [-1490.450] (-1487.363) * (-1491.277) (-1490.760) (-1492.067) [-1489.694] -- 0:00:56
      151500 -- [-1488.775] (-1491.318) (-1489.665) (-1489.550) * (-1491.882) [-1487.864] (-1486.763) (-1490.205) -- 0:00:56
      152000 -- [-1487.758] (-1490.317) (-1489.579) (-1488.130) * (-1490.703) (-1489.551) (-1488.590) [-1488.596] -- 0:00:55
      152500 -- (-1488.647) (-1488.815) [-1488.045] (-1487.856) * (-1494.310) [-1488.861] (-1487.682) (-1488.788) -- 0:00:55
      153000 -- (-1487.341) (-1488.525) [-1489.543] (-1488.984) * (-1490.876) (-1488.932) [-1488.449] (-1489.586) -- 0:00:55
      153500 -- (-1490.564) (-1490.393) [-1488.023] (-1487.508) * [-1489.375] (-1488.298) (-1487.421) (-1489.576) -- 0:00:55
      154000 -- (-1487.860) [-1491.853] (-1492.226) (-1488.226) * (-1487.828) [-1489.334] (-1487.422) (-1487.371) -- 0:00:54
      154500 -- (-1487.038) (-1487.474) (-1489.579) [-1487.688] * (-1490.179) [-1493.258] (-1486.439) (-1486.883) -- 0:00:54
      155000 -- (-1488.525) (-1488.257) [-1493.216] (-1487.321) * (-1492.271) (-1495.148) (-1488.900) [-1486.680] -- 0:00:54

      Average standard deviation of split frequencies: 0.015781

      155500 -- (-1486.813) (-1490.086) (-1492.296) [-1488.057] * (-1490.018) (-1487.104) (-1488.755) [-1487.170] -- 0:00:54
      156000 -- (-1489.453) (-1489.475) (-1492.869) [-1489.258] * (-1493.959) (-1491.279) (-1487.451) [-1488.787] -- 0:00:54
      156500 -- (-1488.086) (-1487.038) (-1493.965) [-1490.255] * (-1494.291) (-1492.711) (-1489.641) [-1490.602] -- 0:00:53
      157000 -- [-1488.702] (-1486.573) (-1487.170) (-1490.460) * [-1487.488] (-1488.156) (-1489.237) (-1488.593) -- 0:00:53
      157500 -- (-1489.616) (-1491.565) (-1489.876) [-1488.090] * (-1488.668) (-1491.392) [-1489.879] (-1491.096) -- 0:00:53
      158000 -- [-1491.934] (-1487.392) (-1488.027) (-1488.989) * (-1487.692) (-1491.699) (-1489.752) [-1490.961] -- 0:00:53
      158500 -- (-1491.145) (-1489.276) [-1487.916] (-1490.701) * [-1487.437] (-1493.729) (-1489.894) (-1489.587) -- 0:00:53
      159000 -- (-1489.251) (-1488.195) [-1487.052] (-1489.311) * (-1487.877) (-1490.118) [-1487.188] (-1487.308) -- 0:00:52
      159500 -- (-1489.141) (-1487.433) [-1486.799] (-1490.444) * (-1492.136) (-1490.478) (-1487.444) [-1489.327] -- 0:00:52
      160000 -- (-1487.302) (-1487.616) [-1487.199] (-1487.815) * (-1487.893) (-1490.609) (-1487.190) [-1489.674] -- 0:00:52

      Average standard deviation of split frequencies: 0.015974

      160500 -- (-1489.444) (-1487.739) (-1488.511) [-1489.864] * (-1488.552) (-1489.910) (-1486.861) [-1488.511] -- 0:00:57
      161000 -- [-1488.985] (-1487.997) (-1488.603) (-1489.502) * (-1488.433) [-1487.954] (-1487.333) (-1494.076) -- 0:00:57
      161500 -- [-1489.502] (-1488.482) (-1491.895) (-1490.105) * (-1489.321) (-1489.918) [-1486.975] (-1493.686) -- 0:00:57
      162000 -- [-1489.212] (-1488.467) (-1493.255) (-1489.619) * (-1493.375) [-1488.108] (-1491.268) (-1495.427) -- 0:00:56
      162500 -- (-1489.578) (-1488.803) (-1489.983) [-1486.842] * (-1488.770) [-1488.333] (-1488.697) (-1490.536) -- 0:00:56
      163000 -- (-1490.714) (-1487.502) (-1490.725) [-1488.232] * [-1488.265] (-1489.164) (-1488.143) (-1492.312) -- 0:00:56
      163500 -- (-1489.012) (-1487.631) (-1487.044) [-1488.233] * (-1488.903) [-1491.150] (-1488.512) (-1490.365) -- 0:00:56
      164000 -- (-1489.837) (-1486.627) (-1490.136) [-1489.423] * [-1489.044] (-1490.621) (-1491.546) (-1488.397) -- 0:00:56
      164500 -- (-1491.450) [-1486.610] (-1489.864) (-1492.609) * [-1489.680] (-1487.944) (-1487.854) (-1489.306) -- 0:00:55
      165000 -- [-1487.945] (-1487.419) (-1493.988) (-1492.235) * (-1490.966) (-1489.304) [-1487.521] (-1486.967) -- 0:00:55

      Average standard deviation of split frequencies: 0.017935

      165500 -- [-1488.943] (-1487.058) (-1486.621) (-1488.759) * (-1490.848) (-1490.584) [-1491.579] (-1486.967) -- 0:00:55
      166000 -- [-1488.715] (-1488.503) (-1487.071) (-1490.221) * (-1490.591) (-1490.021) (-1486.878) [-1487.755] -- 0:00:55
      166500 -- (-1489.805) (-1489.717) (-1487.064) [-1489.057] * (-1488.630) [-1490.991] (-1486.748) (-1489.783) -- 0:00:55
      167000 -- (-1489.933) (-1489.810) [-1487.847] (-1492.360) * (-1490.462) [-1488.473] (-1487.070) (-1490.937) -- 0:00:54
      167500 -- [-1487.866] (-1489.810) (-1487.565) (-1489.186) * (-1490.265) (-1488.405) (-1487.759) [-1491.429] -- 0:00:54
      168000 -- (-1488.036) (-1489.038) (-1490.468) [-1488.956] * [-1489.244] (-1489.610) (-1488.237) (-1489.313) -- 0:00:54
      168500 -- (-1488.461) (-1488.868) (-1490.308) [-1489.162] * (-1487.735) (-1488.666) (-1488.237) [-1488.126] -- 0:00:54
      169000 -- (-1488.697) [-1488.314] (-1489.644) (-1494.556) * (-1486.935) (-1488.468) [-1488.228] (-1488.146) -- 0:00:54
      169500 -- (-1488.314) (-1488.541) [-1489.073] (-1491.928) * (-1488.082) [-1487.123] (-1488.676) (-1489.815) -- 0:00:53
      170000 -- [-1486.993] (-1488.911) (-1486.735) (-1491.231) * [-1489.061] (-1487.777) (-1489.578) (-1492.031) -- 0:00:53

      Average standard deviation of split frequencies: 0.020025

      170500 -- [-1487.174] (-1488.694) (-1486.821) (-1491.803) * (-1487.232) (-1487.393) (-1489.407) [-1487.286] -- 0:00:53
      171000 -- [-1488.469] (-1490.876) (-1486.381) (-1489.952) * (-1489.867) (-1487.141) [-1490.413] (-1488.261) -- 0:00:53
      171500 -- (-1488.469) [-1489.975] (-1487.389) (-1488.682) * (-1497.730) (-1489.187) [-1488.388] (-1489.954) -- 0:00:53
      172000 -- (-1486.505) (-1492.140) (-1489.007) [-1488.873] * [-1487.907] (-1492.665) (-1489.765) (-1491.912) -- 0:00:52
      172500 -- [-1488.141] (-1489.548) (-1492.445) (-1490.041) * (-1489.021) (-1490.970) (-1486.888) [-1490.252] -- 0:00:52
      173000 -- (-1487.386) [-1488.911] (-1489.504) (-1489.672) * (-1489.168) (-1490.455) (-1488.128) [-1489.510] -- 0:00:52
      173500 -- (-1487.298) (-1489.947) (-1489.700) [-1488.388] * (-1491.284) (-1486.860) [-1487.925] (-1490.385) -- 0:00:52
      174000 -- [-1487.953] (-1492.295) (-1489.302) (-1488.387) * (-1489.756) (-1487.109) [-1489.521] (-1492.891) -- 0:00:52
      174500 -- (-1488.788) (-1486.967) (-1488.743) [-1489.391] * (-1490.311) (-1490.610) (-1487.247) [-1491.435] -- 0:00:52
      175000 -- (-1490.132) (-1489.324) (-1494.219) [-1487.669] * (-1492.064) (-1489.896) [-1486.712] (-1489.759) -- 0:00:51

      Average standard deviation of split frequencies: 0.019686

      175500 -- (-1487.428) (-1489.933) (-1494.693) [-1487.645] * (-1491.976) (-1490.500) [-1489.101] (-1488.323) -- 0:00:51
      176000 -- [-1487.040] (-1488.198) (-1491.861) (-1489.933) * (-1491.235) (-1489.252) [-1487.485] (-1489.554) -- 0:00:51
      176500 -- [-1487.040] (-1488.129) (-1492.342) (-1487.584) * (-1490.270) (-1487.718) (-1487.786) [-1490.006] -- 0:00:55
      177000 -- (-1487.363) (-1488.304) [-1487.445] (-1490.168) * (-1488.127) [-1491.982] (-1489.622) (-1489.900) -- 0:00:55
      177500 -- [-1488.053] (-1488.229) (-1490.964) (-1490.769) * (-1487.181) (-1491.976) [-1489.202] (-1487.791) -- 0:00:55
      178000 -- (-1497.104) (-1488.390) (-1488.274) [-1489.886] * (-1489.103) [-1489.249] (-1489.676) (-1489.745) -- 0:00:55
      178500 -- (-1490.807) (-1487.767) [-1488.650] (-1490.401) * (-1489.560) (-1487.911) (-1486.869) [-1489.570] -- 0:00:55
      179000 -- (-1490.767) (-1492.343) [-1488.744] (-1487.663) * (-1488.909) (-1488.986) [-1487.060] (-1491.077) -- 0:00:55
      179500 -- (-1487.440) [-1487.158] (-1488.539) (-1487.924) * [-1488.290] (-1489.442) (-1487.940) (-1490.069) -- 0:00:54
      180000 -- (-1488.377) (-1489.545) [-1487.410] (-1487.140) * (-1487.547) (-1489.663) [-1496.287] (-1490.266) -- 0:00:54

      Average standard deviation of split frequencies: 0.018951

      180500 -- (-1487.982) (-1487.209) (-1488.169) [-1487.737] * (-1487.809) (-1486.935) (-1489.540) [-1492.057] -- 0:00:54
      181000 -- [-1486.556] (-1489.775) (-1494.545) (-1489.457) * [-1488.271] (-1492.398) (-1491.759) (-1489.030) -- 0:00:54
      181500 -- (-1487.458) (-1489.550) [-1497.503] (-1492.410) * (-1490.044) (-1491.364) [-1489.564] (-1492.028) -- 0:00:54
      182000 -- [-1486.505] (-1488.466) (-1489.092) (-1489.559) * (-1488.644) (-1489.003) (-1487.933) [-1487.587] -- 0:00:53
      182500 -- [-1488.283] (-1489.261) (-1488.339) (-1489.315) * (-1489.738) (-1490.666) (-1490.161) [-1488.951] -- 0:00:53
      183000 -- (-1490.983) [-1489.071] (-1488.716) (-1491.167) * (-1489.255) (-1491.383) (-1488.899) [-1491.408] -- 0:00:53
      183500 -- [-1490.343] (-1494.435) (-1491.371) (-1493.781) * (-1489.889) (-1494.837) [-1489.268] (-1489.184) -- 0:00:53
      184000 -- (-1488.448) [-1493.422] (-1488.459) (-1490.373) * [-1487.510] (-1492.422) (-1488.182) (-1491.184) -- 0:00:53
      184500 -- (-1488.448) (-1491.533) [-1488.848] (-1489.637) * (-1487.683) (-1490.459) [-1487.330] (-1494.457) -- 0:00:53
      185000 -- (-1488.612) (-1487.799) (-1489.581) [-1490.199] * (-1487.683) (-1487.854) (-1486.774) [-1488.404] -- 0:00:52

      Average standard deviation of split frequencies: 0.020416

      185500 -- [-1491.492] (-1488.319) (-1489.697) (-1491.251) * (-1489.527) (-1488.601) (-1488.962) [-1488.109] -- 0:00:52
      186000 -- (-1487.536) [-1487.559] (-1490.642) (-1490.332) * [-1488.634] (-1490.714) (-1488.960) (-1490.799) -- 0:00:52
      186500 -- (-1488.755) (-1488.056) (-1490.683) [-1487.786] * (-1487.778) (-1492.405) (-1488.470) [-1488.806] -- 0:00:52
      187000 -- (-1488.672) [-1487.410] (-1489.668) (-1488.609) * [-1488.130] (-1491.946) (-1489.744) (-1487.273) -- 0:00:52
      187500 -- (-1487.570) [-1489.782] (-1488.188) (-1488.504) * (-1489.014) (-1488.352) [-1490.373] (-1488.389) -- 0:00:52
      188000 -- [-1487.539] (-1494.759) (-1487.444) (-1487.814) * (-1489.014) (-1490.110) (-1488.934) [-1487.820] -- 0:00:51
      188500 -- (-1486.628) (-1493.523) (-1487.697) [-1488.764] * (-1491.391) (-1492.836) (-1486.918) [-1490.782] -- 0:00:51
      189000 -- (-1487.751) (-1492.511) (-1490.286) [-1490.917] * (-1489.580) (-1486.789) (-1488.583) [-1488.495] -- 0:00:51
      189500 -- (-1488.166) (-1490.721) (-1487.432) [-1487.392] * (-1489.636) (-1488.872) (-1493.070) [-1489.166] -- 0:00:51
      190000 -- [-1487.016] (-1488.123) (-1489.459) (-1487.890) * (-1489.285) (-1488.301) [-1487.922] (-1491.566) -- 0:00:51

      Average standard deviation of split frequencies: 0.019779

      190500 -- (-1489.991) [-1488.218] (-1490.962) (-1487.134) * (-1491.664) [-1488.300] (-1491.776) (-1488.834) -- 0:00:50
      191000 -- (-1490.051) (-1488.226) (-1493.765) [-1489.139] * (-1492.305) [-1487.327] (-1490.452) (-1490.753) -- 0:00:50
      191500 -- (-1488.356) (-1487.748) [-1492.210] (-1492.329) * (-1489.084) (-1489.913) (-1489.418) [-1487.785] -- 0:00:50
      192000 -- (-1489.198) (-1487.628) [-1489.934] (-1488.493) * (-1492.736) (-1488.541) (-1488.757) [-1487.805] -- 0:00:50
      192500 -- (-1488.734) [-1487.962] (-1488.832) (-1488.349) * (-1489.223) (-1490.707) [-1488.599] (-1490.725) -- 0:00:54
      193000 -- (-1490.251) (-1489.346) (-1489.203) [-1493.120] * (-1489.548) [-1490.415] (-1487.862) (-1488.615) -- 0:00:54
      193500 -- (-1488.140) [-1489.682] (-1489.463) (-1487.313) * [-1489.555] (-1487.029) (-1487.948) (-1488.246) -- 0:00:54
      194000 -- (-1489.832) (-1491.211) (-1488.822) [-1489.244] * (-1490.303) (-1487.619) [-1491.775] (-1488.854) -- 0:00:54
      194500 -- [-1488.327] (-1487.422) (-1489.334) (-1488.844) * (-1493.234) (-1487.313) (-1494.605) [-1488.071] -- 0:00:53
      195000 -- (-1488.783) [-1487.563] (-1491.231) (-1488.711) * (-1493.630) (-1488.237) (-1491.647) [-1487.094] -- 0:00:53

      Average standard deviation of split frequencies: 0.019642

      195500 -- (-1488.581) (-1487.423) (-1489.105) [-1487.584] * (-1490.172) (-1487.201) [-1491.411] (-1487.826) -- 0:00:53
      196000 -- (-1489.557) (-1488.030) [-1492.387] (-1489.085) * (-1489.617) (-1487.385) [-1489.971] (-1487.878) -- 0:00:53
      196500 -- (-1487.581) (-1488.241) (-1490.447) [-1491.137] * (-1491.135) (-1488.546) (-1489.616) [-1490.242] -- 0:00:53
      197000 -- (-1488.019) [-1488.583] (-1489.831) (-1489.896) * (-1493.853) (-1490.697) [-1488.739] (-1489.742) -- 0:00:52
      197500 -- (-1488.680) (-1489.384) (-1489.092) [-1489.843] * [-1489.029] (-1490.742) (-1488.252) (-1488.951) -- 0:00:52
      198000 -- (-1488.274) (-1488.963) (-1489.611) [-1487.629] * (-1488.592) (-1491.115) [-1487.047] (-1491.504) -- 0:00:52
      198500 -- (-1488.234) [-1489.371] (-1489.801) (-1491.530) * (-1486.464) (-1487.118) [-1486.701] (-1493.433) -- 0:00:52
      199000 -- (-1491.904) (-1490.442) (-1490.588) [-1492.190] * (-1489.197) (-1488.585) [-1486.640] (-1494.142) -- 0:00:52
      199500 -- (-1493.920) [-1492.383] (-1488.350) (-1487.814) * (-1488.209) (-1486.801) [-1490.514] (-1488.453) -- 0:00:52
      200000 -- (-1486.897) (-1493.184) (-1488.567) [-1488.085] * (-1491.565) [-1489.494] (-1488.574) (-1489.095) -- 0:00:51

      Average standard deviation of split frequencies: 0.019577

      200500 -- (-1487.395) [-1488.785] (-1489.946) (-1487.355) * (-1489.039) (-1489.224) [-1489.228] (-1490.537) -- 0:00:51
      201000 -- [-1487.860] (-1492.061) (-1490.425) (-1487.124) * (-1487.268) (-1489.045) (-1488.044) [-1487.609] -- 0:00:51
      201500 -- (-1487.816) (-1493.456) (-1487.357) [-1489.258] * (-1487.081) (-1489.963) [-1488.101] (-1487.272) -- 0:00:51
      202000 -- [-1487.379] (-1489.648) (-1487.258) (-1489.155) * (-1486.678) (-1490.309) [-1488.385] (-1488.250) -- 0:00:51
      202500 -- (-1490.961) (-1489.043) [-1490.195] (-1487.303) * (-1487.385) (-1490.166) (-1487.497) [-1487.254] -- 0:00:51
      203000 -- (-1491.313) (-1487.765) (-1489.963) [-1486.726] * (-1487.714) [-1490.903] (-1487.729) (-1487.449) -- 0:00:51
      203500 -- (-1492.278) (-1488.434) (-1491.523) [-1487.420] * (-1489.649) [-1491.974] (-1488.562) (-1488.152) -- 0:00:50
      204000 -- (-1487.558) (-1487.340) (-1489.030) [-1491.428] * (-1490.511) (-1492.216) [-1488.314] (-1487.915) -- 0:00:50
      204500 -- (-1486.787) (-1487.689) (-1491.400) [-1490.834] * (-1487.376) (-1493.988) [-1487.633] (-1487.270) -- 0:00:50
      205000 -- [-1489.278] (-1488.743) (-1491.618) (-1490.932) * (-1489.131) [-1488.084] (-1489.647) (-1488.506) -- 0:00:50

      Average standard deviation of split frequencies: 0.018789

      205500 -- (-1490.310) [-1488.874] (-1492.220) (-1491.685) * (-1487.103) (-1488.624) (-1487.520) [-1488.563] -- 0:00:50
      206000 -- (-1488.826) [-1490.702] (-1491.958) (-1488.099) * (-1488.762) [-1487.913] (-1488.482) (-1489.731) -- 0:00:50
      206500 -- (-1493.184) [-1491.044] (-1490.527) (-1489.419) * [-1489.871] (-1493.780) (-1487.579) (-1500.765) -- 0:00:49
      207000 -- (-1492.006) (-1488.945) [-1488.080] (-1488.567) * (-1490.064) [-1489.956] (-1488.126) (-1488.283) -- 0:00:49
      207500 -- (-1489.881) (-1492.437) [-1488.308] (-1488.565) * (-1490.648) (-1494.423) (-1489.044) [-1489.420] -- 0:00:49
      208000 -- (-1489.764) (-1492.322) [-1488.790] (-1489.284) * (-1490.512) (-1487.488) (-1488.156) [-1487.405] -- 0:00:49
      208500 -- (-1490.028) [-1492.072] (-1489.469) (-1491.760) * (-1491.637) (-1488.820) [-1489.347] (-1489.877) -- 0:00:53
      209000 -- (-1490.326) [-1487.496] (-1486.506) (-1491.588) * (-1489.837) (-1490.551) (-1490.388) [-1490.707] -- 0:00:52
      209500 -- (-1489.222) (-1487.252) [-1488.779] (-1489.819) * (-1492.960) (-1489.978) (-1491.669) [-1488.151] -- 0:00:52
      210000 -- (-1488.683) [-1488.179] (-1486.950) (-1494.382) * [-1489.058] (-1487.979) (-1489.674) (-1487.859) -- 0:00:52

      Average standard deviation of split frequencies: 0.019613

      210500 -- [-1487.484] (-1488.369) (-1488.407) (-1488.570) * (-1489.082) (-1490.973) [-1489.165] (-1488.482) -- 0:00:52
      211000 -- [-1487.409] (-1487.634) (-1491.182) (-1490.976) * (-1491.666) (-1487.021) (-1489.127) [-1489.089] -- 0:00:52
      211500 -- [-1487.108] (-1490.019) (-1492.016) (-1487.772) * (-1489.151) [-1487.635] (-1490.127) (-1488.893) -- 0:00:52
      212000 -- [-1489.352] (-1488.737) (-1490.095) (-1487.187) * (-1489.089) [-1487.505] (-1488.279) (-1489.267) -- 0:00:52
      212500 -- (-1493.158) [-1487.484] (-1488.200) (-1488.940) * [-1487.353] (-1487.577) (-1487.538) (-1488.789) -- 0:00:51
      213000 -- [-1488.094] (-1486.610) (-1488.373) (-1489.850) * (-1486.827) [-1488.258] (-1487.542) (-1488.458) -- 0:00:51
      213500 -- (-1488.233) (-1486.515) (-1491.688) [-1490.191] * [-1487.299] (-1486.795) (-1488.729) (-1488.180) -- 0:00:51
      214000 -- (-1494.015) (-1487.706) [-1491.706] (-1488.497) * (-1490.012) (-1489.451) [-1487.200] (-1489.028) -- 0:00:51
      214500 -- (-1488.785) (-1493.308) (-1489.500) [-1488.453] * (-1486.796) (-1489.561) [-1487.842] (-1486.580) -- 0:00:51
      215000 -- [-1489.649] (-1488.454) (-1490.661) (-1492.443) * (-1488.839) (-1490.894) [-1495.766] (-1487.503) -- 0:00:51

      Average standard deviation of split frequencies: 0.017845

      215500 -- [-1489.401] (-1488.272) (-1487.839) (-1487.802) * (-1487.448) (-1489.394) (-1489.698) [-1487.084] -- 0:00:50
      216000 -- [-1495.796] (-1488.047) (-1488.473) (-1488.459) * (-1488.563) (-1489.029) (-1490.391) [-1490.187] -- 0:00:50
      216500 -- (-1492.485) [-1487.855] (-1489.484) (-1489.869) * [-1488.919] (-1489.683) (-1488.643) (-1489.008) -- 0:00:50
      217000 -- (-1488.221) (-1488.024) [-1492.480] (-1493.407) * (-1492.910) (-1492.164) [-1487.079] (-1488.261) -- 0:00:50
      217500 -- (-1489.088) (-1487.751) [-1489.110] (-1489.401) * (-1489.922) (-1489.000) (-1490.066) [-1487.469] -- 0:00:50
      218000 -- [-1489.594] (-1490.877) (-1491.082) (-1487.759) * (-1489.138) (-1489.251) (-1489.285) [-1486.541] -- 0:00:50
      218500 -- (-1488.022) [-1491.141] (-1488.021) (-1490.294) * (-1490.622) (-1487.770) (-1489.025) [-1489.052] -- 0:00:50
      219000 -- (-1488.391) [-1486.836] (-1489.886) (-1487.943) * (-1492.030) [-1488.084] (-1489.513) (-1487.095) -- 0:00:49
      219500 -- (-1487.362) (-1488.846) (-1489.655) [-1489.970] * (-1489.584) (-1490.400) [-1491.687] (-1488.829) -- 0:00:49
      220000 -- (-1487.371) (-1486.606) (-1486.744) [-1488.335] * (-1491.854) [-1487.153] (-1488.464) (-1491.571) -- 0:00:49

      Average standard deviation of split frequencies: 0.017090

      220500 -- (-1488.685) (-1491.093) (-1489.758) [-1489.142] * (-1487.583) (-1490.647) [-1492.727] (-1489.163) -- 0:00:49
      221000 -- [-1488.430] (-1490.332) (-1486.789) (-1489.183) * [-1487.861] (-1493.551) (-1487.884) (-1488.679) -- 0:00:49
      221500 -- [-1487.169] (-1489.971) (-1488.061) (-1489.418) * (-1491.048) (-1496.138) (-1488.007) [-1487.914] -- 0:00:49
      222000 -- (-1486.757) (-1488.406) (-1495.452) [-1488.586] * (-1488.161) (-1490.926) [-1487.882] (-1491.468) -- 0:00:49
      222500 -- (-1488.051) (-1491.164) (-1489.501) [-1488.932] * (-1492.542) (-1488.864) (-1488.123) [-1490.345] -- 0:00:48
      223000 -- (-1493.818) (-1487.336) (-1488.907) [-1489.811] * (-1493.218) (-1487.316) [-1490.200] (-1490.453) -- 0:00:48
      223500 -- [-1489.496] (-1488.395) (-1487.375) (-1489.308) * [-1487.075] (-1487.599) (-1490.577) (-1492.769) -- 0:00:48
      224000 -- (-1488.195) (-1491.649) [-1487.999] (-1488.493) * (-1488.636) (-1488.877) [-1489.382] (-1497.478) -- 0:00:51
      224500 -- (-1488.671) (-1490.063) (-1488.505) [-1488.228] * (-1489.892) [-1487.973] (-1488.125) (-1493.590) -- 0:00:51
      225000 -- (-1487.842) (-1492.169) [-1489.267] (-1487.898) * (-1487.769) [-1487.765] (-1487.072) (-1489.878) -- 0:00:51

      Average standard deviation of split frequencies: 0.017730

      225500 -- (-1490.498) (-1493.334) [-1487.310] (-1488.443) * (-1487.844) [-1487.052] (-1488.968) (-1488.367) -- 0:00:51
      226000 -- [-1486.866] (-1489.774) (-1487.711) (-1488.007) * (-1487.711) (-1487.739) [-1490.356] (-1488.732) -- 0:00:51
      226500 -- (-1491.354) [-1489.351] (-1489.414) (-1487.245) * [-1486.830] (-1487.893) (-1487.953) (-1493.368) -- 0:00:51
      227000 -- (-1488.345) (-1489.077) (-1488.005) [-1486.661] * (-1487.874) (-1487.202) [-1489.409] (-1492.756) -- 0:00:51
      227500 -- [-1489.659] (-1489.775) (-1488.507) (-1486.618) * (-1488.312) (-1487.187) [-1488.772] (-1488.783) -- 0:00:50
      228000 -- (-1489.499) (-1492.724) (-1488.495) [-1489.015] * (-1488.974) (-1487.187) (-1489.734) [-1491.639] -- 0:00:50
      228500 -- (-1490.523) [-1489.669] (-1487.573) (-1487.907) * [-1489.284] (-1487.230) (-1489.108) (-1488.142) -- 0:00:50
      229000 -- (-1491.146) (-1494.100) [-1490.115] (-1489.287) * (-1487.606) [-1486.763] (-1488.601) (-1489.140) -- 0:00:50
      229500 -- (-1488.950) [-1490.222] (-1491.109) (-1487.724) * [-1487.689] (-1487.608) (-1489.721) (-1491.492) -- 0:00:50
      230000 -- (-1489.140) (-1488.445) [-1488.201] (-1488.002) * [-1487.614] (-1486.474) (-1489.231) (-1489.136) -- 0:00:50

      Average standard deviation of split frequencies: 0.018166

      230500 -- (-1488.051) (-1489.844) [-1487.899] (-1488.401) * [-1487.829] (-1488.516) (-1488.710) (-1487.718) -- 0:00:50
      231000 -- [-1488.779] (-1492.999) (-1488.139) (-1489.698) * [-1487.523] (-1488.483) (-1487.939) (-1488.889) -- 0:00:49
      231500 -- (-1487.925) (-1490.271) [-1487.666] (-1490.082) * (-1487.627) (-1489.418) (-1491.764) [-1488.126] -- 0:00:49
      232000 -- (-1486.812) (-1489.499) (-1487.130) [-1488.133] * (-1487.235) (-1489.782) (-1489.692) [-1487.949] -- 0:00:49
      232500 -- (-1488.260) (-1491.606) [-1487.043] (-1487.780) * (-1487.948) (-1489.153) [-1487.814] (-1488.004) -- 0:00:49
      233000 -- (-1489.274) (-1493.489) [-1487.419] (-1489.108) * (-1489.211) (-1488.063) [-1487.823] (-1488.615) -- 0:00:49
      233500 -- [-1489.081] (-1489.464) (-1487.904) (-1489.145) * (-1488.917) (-1489.897) [-1487.748] (-1487.644) -- 0:00:49
      234000 -- [-1490.754] (-1487.516) (-1489.986) (-1488.324) * (-1488.703) (-1489.608) (-1488.392) [-1487.688] -- 0:00:49
      234500 -- [-1487.000] (-1491.943) (-1489.631) (-1488.047) * [-1489.315] (-1494.156) (-1491.109) (-1487.582) -- 0:00:48
      235000 -- (-1488.519) (-1488.294) [-1490.119] (-1487.180) * (-1490.871) (-1489.180) [-1488.680] (-1487.791) -- 0:00:48

      Average standard deviation of split frequencies: 0.017755

      235500 -- [-1488.856] (-1487.880) (-1489.054) (-1487.270) * (-1489.395) (-1490.447) (-1494.884) [-1489.525] -- 0:00:48
      236000 -- [-1490.461] (-1488.285) (-1490.233) (-1487.120) * (-1487.735) (-1490.372) (-1492.251) [-1489.547] -- 0:00:48
      236500 -- (-1493.015) (-1488.983) (-1488.791) [-1493.455] * (-1489.649) (-1489.839) [-1489.063] (-1488.163) -- 0:00:48
      237000 -- (-1487.516) (-1488.067) [-1488.567] (-1490.194) * [-1490.543] (-1486.915) (-1492.937) (-1488.608) -- 0:00:48
      237500 -- (-1486.987) (-1488.908) (-1489.318) [-1492.537] * (-1488.513) (-1486.891) (-1489.469) [-1488.755] -- 0:00:48
      238000 -- (-1486.958) (-1486.716) (-1489.521) [-1487.029] * (-1490.140) (-1487.902) (-1488.142) [-1487.462] -- 0:00:48
      238500 -- (-1487.366) (-1487.091) [-1489.520] (-1487.425) * [-1490.065] (-1488.072) (-1487.708) (-1486.803) -- 0:00:47
      239000 -- [-1486.888] (-1487.149) (-1488.388) (-1488.870) * (-1488.072) [-1488.686] (-1489.701) (-1489.003) -- 0:00:47
      239500 -- (-1488.895) [-1486.906] (-1488.231) (-1489.784) * [-1490.381] (-1488.585) (-1489.143) (-1488.295) -- 0:00:47
      240000 -- (-1487.375) [-1486.906] (-1492.958) (-1489.623) * (-1489.990) (-1489.565) [-1488.074] (-1487.491) -- 0:00:50

      Average standard deviation of split frequencies: 0.017411

      240500 -- [-1486.768] (-1487.548) (-1490.628) (-1487.522) * (-1489.901) (-1487.629) [-1486.660] (-1487.489) -- 0:00:50
      241000 -- (-1490.596) (-1489.404) [-1493.172] (-1489.151) * [-1487.168] (-1489.292) (-1486.689) (-1488.417) -- 0:00:50
      241500 -- (-1490.749) [-1487.615] (-1489.458) (-1491.275) * [-1487.086] (-1490.189) (-1487.484) (-1487.720) -- 0:00:50
      242000 -- (-1487.667) (-1487.821) [-1491.305] (-1489.266) * [-1487.315] (-1487.726) (-1487.456) (-1490.335) -- 0:00:50
      242500 -- (-1491.729) (-1490.252) (-1488.449) [-1487.188] * (-1488.996) (-1489.170) [-1487.502] (-1489.075) -- 0:00:49
      243000 -- (-1487.488) (-1488.325) [-1487.401] (-1490.500) * (-1493.708) (-1487.843) (-1487.472) [-1490.588] -- 0:00:49
      243500 -- [-1488.659] (-1488.284) (-1487.945) (-1488.629) * (-1488.137) (-1488.346) (-1488.772) [-1491.887] -- 0:00:49
      244000 -- (-1488.642) [-1486.802] (-1487.205) (-1489.278) * (-1489.254) [-1489.586] (-1488.710) (-1489.792) -- 0:00:49
      244500 -- [-1486.839] (-1490.392) (-1487.647) (-1489.435) * (-1487.611) (-1490.079) (-1487.705) [-1487.276] -- 0:00:49
      245000 -- (-1487.660) (-1487.650) (-1491.760) [-1487.251] * (-1495.646) (-1487.993) (-1487.291) [-1488.769] -- 0:00:49

      Average standard deviation of split frequencies: 0.017672

      245500 -- (-1488.635) (-1491.529) [-1487.425] (-1487.386) * (-1490.022) [-1488.778] (-1486.857) (-1492.844) -- 0:00:49
      246000 -- (-1490.931) (-1487.963) [-1488.071] (-1487.821) * [-1492.206] (-1488.796) (-1486.806) (-1491.512) -- 0:00:49
      246500 -- (-1491.962) (-1487.529) (-1489.883) [-1489.971] * (-1487.828) (-1491.922) (-1487.933) [-1493.460] -- 0:00:48
      247000 -- (-1489.374) (-1487.528) [-1489.273] (-1486.737) * (-1493.089) (-1487.476) [-1486.767] (-1490.627) -- 0:00:48
      247500 -- [-1490.382] (-1486.678) (-1492.539) (-1488.046) * [-1489.199] (-1489.208) (-1491.216) (-1487.843) -- 0:00:48
      248000 -- (-1488.704) (-1487.360) (-1488.678) [-1487.387] * [-1488.364] (-1488.332) (-1488.268) (-1487.765) -- 0:00:48
      248500 -- (-1486.657) (-1490.781) (-1489.094) [-1487.205] * [-1486.806] (-1487.006) (-1488.569) (-1487.353) -- 0:00:48
      249000 -- (-1489.881) [-1489.813] (-1488.383) (-1487.358) * (-1487.459) [-1488.410] (-1489.474) (-1488.462) -- 0:00:48
      249500 -- (-1489.403) (-1494.135) (-1490.251) [-1488.134] * [-1489.685] (-1488.056) (-1489.232) (-1487.442) -- 0:00:48
      250000 -- (-1493.520) (-1487.382) (-1490.491) [-1487.834] * [-1489.844] (-1488.301) (-1490.083) (-1487.354) -- 0:00:48

      Average standard deviation of split frequencies: 0.016483

      250500 -- [-1492.931] (-1488.367) (-1495.223) (-1487.886) * (-1486.864) [-1489.676] (-1488.199) (-1487.490) -- 0:00:47
      251000 -- [-1492.409] (-1489.838) (-1487.909) (-1489.968) * (-1492.768) (-1489.146) (-1493.276) [-1488.631] -- 0:00:47
      251500 -- (-1487.749) (-1488.763) (-1491.411) [-1489.592] * (-1494.054) (-1488.141) (-1495.055) [-1489.511] -- 0:00:47
      252000 -- (-1491.515) (-1490.607) (-1491.488) [-1489.644] * [-1492.752] (-1488.716) (-1488.552) (-1490.868) -- 0:00:47
      252500 -- (-1487.867) (-1486.617) [-1487.929] (-1488.733) * (-1491.406) (-1492.460) [-1490.272] (-1489.234) -- 0:00:47
      253000 -- (-1487.637) (-1486.988) [-1487.835] (-1487.670) * (-1490.457) (-1492.516) (-1492.536) [-1489.763] -- 0:00:47
      253500 -- (-1487.324) [-1486.783] (-1486.922) (-1490.669) * (-1491.327) (-1492.714) [-1487.737] (-1487.054) -- 0:00:47
      254000 -- [-1492.467] (-1488.445) (-1487.276) (-1487.667) * (-1488.235) [-1491.124] (-1489.287) (-1487.932) -- 0:00:46
      254500 -- (-1487.963) [-1489.823] (-1488.338) (-1487.963) * (-1487.227) (-1487.508) [-1488.267] (-1490.582) -- 0:00:46
      255000 -- (-1487.498) (-1489.054) [-1486.811] (-1487.658) * (-1486.989) [-1490.050] (-1490.384) (-1490.209) -- 0:00:46

      Average standard deviation of split frequencies: 0.017033

      255500 -- (-1487.716) (-1488.046) [-1488.014] (-1487.058) * [-1487.998] (-1491.139) (-1490.688) (-1492.099) -- 0:00:46
      256000 -- (-1487.850) (-1490.103) [-1486.767] (-1490.772) * (-1487.905) [-1488.605] (-1488.023) (-1488.498) -- 0:00:49
      256500 -- [-1487.101] (-1491.098) (-1489.845) (-1489.020) * (-1489.271) (-1489.264) [-1490.950] (-1488.256) -- 0:00:49
      257000 -- [-1487.292] (-1490.574) (-1490.531) (-1489.526) * (-1489.570) [-1488.170] (-1499.827) (-1488.478) -- 0:00:49
      257500 -- (-1489.311) (-1490.057) (-1492.518) [-1488.701] * (-1487.872) (-1488.361) (-1491.447) [-1489.357] -- 0:00:49
      258000 -- [-1487.468] (-1488.634) (-1487.815) (-1488.728) * [-1487.923] (-1487.661) (-1491.058) (-1494.919) -- 0:00:48
      258500 -- (-1487.541) [-1488.328] (-1486.964) (-1487.491) * (-1488.017) (-1488.387) [-1488.934] (-1496.406) -- 0:00:48
      259000 -- (-1486.916) [-1490.253] (-1486.961) (-1493.387) * (-1489.507) [-1487.457] (-1490.811) (-1497.020) -- 0:00:48
      259500 -- (-1487.468) [-1488.558] (-1488.896) (-1492.241) * (-1493.563) [-1487.047] (-1490.887) (-1490.949) -- 0:00:48
      260000 -- (-1487.680) [-1487.328] (-1488.968) (-1492.162) * (-1489.928) [-1487.112] (-1489.580) (-1487.699) -- 0:00:48

      Average standard deviation of split frequencies: 0.015937

      260500 -- (-1487.883) (-1487.201) [-1487.023] (-1487.053) * (-1489.682) [-1487.450] (-1488.303) (-1488.231) -- 0:00:48
      261000 -- (-1489.309) (-1487.156) [-1487.405] (-1487.639) * (-1487.786) (-1493.520) [-1487.146] (-1491.245) -- 0:00:48
      261500 -- [-1496.463] (-1487.350) (-1489.679) (-1490.775) * (-1487.891) [-1491.051] (-1487.146) (-1489.250) -- 0:00:48
      262000 -- (-1494.419) (-1489.839) (-1492.605) [-1486.793] * (-1486.984) (-1490.961) [-1486.825] (-1489.090) -- 0:00:47
      262500 -- (-1490.009) [-1492.053] (-1489.159) (-1488.106) * (-1488.068) (-1492.694) [-1486.931] (-1490.734) -- 0:00:47
      263000 -- (-1488.301) (-1494.513) (-1489.038) [-1489.981] * (-1495.796) (-1487.727) (-1488.958) [-1492.242] -- 0:00:47
      263500 -- (-1489.254) (-1495.337) [-1488.625] (-1487.371) * (-1488.362) (-1491.213) [-1490.294] (-1494.445) -- 0:00:47
      264000 -- [-1489.639] (-1487.368) (-1488.575) (-1487.762) * (-1491.471) (-1492.134) (-1489.288) [-1486.990] -- 0:00:47
      264500 -- (-1488.031) (-1487.387) (-1489.995) [-1490.110] * [-1490.813] (-1488.516) (-1487.634) (-1488.059) -- 0:00:47
      265000 -- (-1487.826) (-1490.166) [-1487.918] (-1493.750) * (-1488.238) [-1489.037] (-1487.641) (-1488.951) -- 0:00:47

      Average standard deviation of split frequencies: 0.015324

      265500 -- (-1489.003) (-1491.506) [-1487.836] (-1489.190) * (-1487.003) (-1488.408) (-1489.735) [-1489.169] -- 0:00:47
      266000 -- (-1490.385) [-1491.076] (-1488.249) (-1489.158) * (-1489.570) (-1487.024) (-1489.743) [-1486.823] -- 0:00:46
      266500 -- (-1488.155) [-1487.949] (-1489.382) (-1489.067) * (-1490.432) (-1488.196) (-1489.916) [-1487.891] -- 0:00:46
      267000 -- (-1487.851) [-1488.049] (-1489.544) (-1491.269) * [-1487.323] (-1490.139) (-1487.055) (-1487.788) -- 0:00:46
      267500 -- [-1486.619] (-1487.717) (-1488.166) (-1490.341) * [-1492.096] (-1487.371) (-1487.145) (-1490.365) -- 0:00:46
      268000 -- [-1489.144] (-1488.275) (-1489.121) (-1491.591) * (-1488.848) (-1488.293) [-1488.379] (-1489.828) -- 0:00:46
      268500 -- [-1487.996] (-1491.091) (-1488.536) (-1488.936) * (-1489.964) (-1489.975) [-1491.561] (-1487.897) -- 0:00:46
      269000 -- [-1488.460] (-1487.506) (-1488.990) (-1493.623) * (-1489.551) (-1490.430) (-1489.540) [-1489.804] -- 0:00:46
      269500 -- (-1489.016) (-1489.070) [-1487.968] (-1489.233) * (-1488.937) (-1487.816) [-1489.959] (-1488.061) -- 0:00:46
      270000 -- (-1489.364) (-1490.976) (-1488.661) [-1489.469] * (-1489.237) (-1491.134) (-1490.859) [-1487.930] -- 0:00:45

      Average standard deviation of split frequencies: 0.013626

      270500 -- (-1490.085) [-1486.938] (-1488.950) (-1493.593) * (-1490.062) [-1489.484] (-1488.414) (-1487.238) -- 0:00:45
      271000 -- [-1489.293] (-1486.938) (-1492.851) (-1489.212) * (-1491.984) (-1489.090) (-1488.936) [-1487.484] -- 0:00:45
      271500 -- [-1488.552] (-1487.052) (-1493.817) (-1488.000) * (-1492.112) [-1487.703] (-1487.893) (-1488.515) -- 0:00:45
      272000 -- (-1492.095) (-1489.120) (-1488.609) [-1490.654] * (-1489.028) (-1487.703) [-1488.014] (-1488.185) -- 0:00:48
      272500 -- (-1490.018) (-1488.773) [-1489.659] (-1489.676) * (-1491.515) [-1487.348] (-1487.272) (-1489.153) -- 0:00:48
      273000 -- (-1487.354) (-1488.782) (-1488.157) [-1488.756] * (-1487.808) (-1488.965) [-1487.000] (-1490.221) -- 0:00:47
      273500 -- (-1487.378) (-1489.772) [-1488.863] (-1487.913) * (-1488.058) (-1489.551) [-1488.448] (-1491.374) -- 0:00:47
      274000 -- [-1489.071] (-1490.298) (-1490.961) (-1488.413) * (-1488.212) (-1489.579) (-1487.730) [-1489.926] -- 0:00:47
      274500 -- (-1488.732) (-1490.873) [-1492.544] (-1490.413) * (-1490.338) [-1490.482] (-1489.431) (-1489.866) -- 0:00:47
      275000 -- (-1487.783) (-1490.838) (-1487.616) [-1488.037] * (-1489.077) [-1487.616] (-1487.465) (-1489.201) -- 0:00:47

      Average standard deviation of split frequencies: 0.012860

      275500 -- (-1487.269) (-1489.569) (-1487.616) [-1488.772] * (-1489.070) (-1488.275) [-1489.224] (-1490.903) -- 0:00:47
      276000 -- (-1486.823) (-1489.589) [-1487.387] (-1490.439) * (-1490.316) [-1488.675] (-1487.661) (-1490.008) -- 0:00:47
      276500 -- [-1488.363] (-1489.269) (-1487.060) (-1488.229) * (-1488.942) [-1488.486] (-1491.674) (-1489.789) -- 0:00:47
      277000 -- (-1488.713) (-1488.698) (-1490.597) [-1488.375] * [-1488.476] (-1489.876) (-1493.350) (-1489.013) -- 0:00:46
      277500 -- [-1489.396] (-1488.362) (-1488.254) (-1489.309) * [-1488.396] (-1489.871) (-1490.899) (-1490.699) -- 0:00:46
      278000 -- [-1488.757] (-1487.873) (-1487.676) (-1488.981) * [-1490.535] (-1490.353) (-1488.597) (-1490.757) -- 0:00:46
      278500 -- (-1490.243) [-1489.152] (-1488.512) (-1487.247) * (-1489.716) (-1490.284) [-1488.636] (-1488.966) -- 0:00:46
      279000 -- [-1486.700] (-1489.223) (-1487.570) (-1491.591) * (-1487.836) [-1487.695] (-1487.337) (-1489.469) -- 0:00:46
      279500 -- (-1490.637) (-1490.088) [-1489.804] (-1489.650) * (-1492.780) (-1487.678) (-1487.220) [-1490.633] -- 0:00:46
      280000 -- (-1492.194) [-1489.653] (-1487.318) (-1487.862) * [-1490.848] (-1490.828) (-1488.419) (-1490.080) -- 0:00:46

      Average standard deviation of split frequencies: 0.011164

      280500 -- (-1493.464) (-1492.005) (-1487.087) [-1487.734] * [-1489.743] (-1488.530) (-1488.504) (-1490.262) -- 0:00:46
      281000 -- (-1488.020) (-1488.499) (-1487.073) [-1489.743] * (-1489.192) [-1490.223] (-1488.847) (-1495.456) -- 0:00:46
      281500 -- [-1487.459] (-1491.463) (-1486.845) (-1487.805) * (-1489.396) [-1491.436] (-1486.878) (-1489.697) -- 0:00:45
      282000 -- (-1487.852) (-1493.265) (-1486.976) [-1487.724] * (-1486.665) (-1486.674) (-1488.682) [-1487.736] -- 0:00:45
      282500 -- (-1488.230) (-1488.884) [-1486.968] (-1504.168) * (-1489.277) [-1486.733] (-1488.279) (-1488.630) -- 0:00:45
      283000 -- [-1488.431] (-1491.359) (-1487.460) (-1496.973) * (-1489.277) (-1492.774) (-1492.118) [-1489.113] -- 0:00:45
      283500 -- (-1487.674) [-1487.134] (-1486.444) (-1492.363) * (-1488.380) (-1491.469) (-1493.431) [-1490.929] -- 0:00:45
      284000 -- (-1487.620) [-1488.160] (-1487.779) (-1492.593) * (-1488.914) (-1488.923) (-1489.866) [-1490.742] -- 0:00:45
      284500 -- [-1488.150] (-1490.352) (-1487.076) (-1488.765) * (-1490.330) [-1489.322] (-1487.753) (-1489.822) -- 0:00:45
      285000 -- (-1491.323) (-1488.142) (-1487.532) [-1489.100] * (-1489.672) (-1488.214) (-1491.597) [-1489.854] -- 0:00:45

      Average standard deviation of split frequencies: 0.012454

      285500 -- (-1493.142) [-1487.798] (-1487.029) (-1488.643) * (-1489.317) [-1488.979] (-1488.547) (-1488.787) -- 0:00:45
      286000 -- (-1489.575) [-1490.288] (-1491.422) (-1490.724) * (-1488.380) [-1488.725] (-1488.477) (-1487.727) -- 0:00:44
      286500 -- (-1493.680) [-1488.635] (-1490.343) (-1491.131) * (-1489.460) [-1488.351] (-1489.331) (-1487.791) -- 0:00:44
      287000 -- (-1490.504) (-1489.738) [-1487.832] (-1487.589) * (-1494.269) [-1487.716] (-1488.085) (-1492.411) -- 0:00:44
      287500 -- [-1491.092] (-1488.555) (-1494.149) (-1488.105) * (-1490.516) [-1489.152] (-1488.798) (-1489.291) -- 0:00:44
      288000 -- (-1490.435) [-1488.592] (-1489.367) (-1488.577) * (-1490.273) (-1487.943) (-1489.817) [-1488.064] -- 0:00:44
      288500 -- (-1492.933) (-1488.019) (-1489.484) [-1490.368] * (-1492.218) (-1487.404) (-1487.620) [-1489.244] -- 0:00:46
      289000 -- (-1490.469) (-1487.817) [-1487.748] (-1488.902) * (-1492.507) [-1488.458] (-1487.569) (-1487.040) -- 0:00:46
      289500 -- (-1491.578) [-1487.085] (-1488.403) (-1488.749) * (-1490.841) (-1490.629) (-1488.000) [-1490.146] -- 0:00:46
      290000 -- (-1487.616) [-1487.447] (-1488.124) (-1486.975) * (-1488.144) [-1487.062] (-1490.686) (-1489.415) -- 0:00:46

      Average standard deviation of split frequencies: 0.010780

      290500 -- (-1489.437) (-1487.340) (-1488.310) [-1488.039] * (-1489.217) [-1487.425] (-1494.824) (-1489.432) -- 0:00:46
      291000 -- (-1488.653) (-1488.037) [-1491.333] (-1490.941) * (-1489.514) [-1489.755] (-1493.625) (-1489.832) -- 0:00:46
      291500 -- (-1488.104) [-1488.114] (-1490.817) (-1492.726) * (-1488.436) (-1487.841) [-1488.250] (-1489.420) -- 0:00:46
      292000 -- (-1487.385) (-1487.450) [-1486.956] (-1487.796) * (-1493.574) (-1487.273) [-1488.182] (-1489.856) -- 0:00:46
      292500 -- [-1491.612] (-1489.816) (-1486.902) (-1491.081) * (-1489.512) [-1487.044] (-1490.583) (-1489.139) -- 0:00:45
      293000 -- (-1492.710) (-1487.917) (-1490.953) [-1487.491] * [-1488.730] (-1487.066) (-1488.135) (-1489.296) -- 0:00:45
      293500 -- (-1488.626) (-1488.584) [-1492.053] (-1488.152) * (-1490.970) (-1490.567) [-1487.986] (-1489.268) -- 0:00:45
      294000 -- (-1493.725) (-1492.887) (-1493.817) [-1489.683] * (-1488.162) [-1486.919] (-1487.951) (-1488.968) -- 0:00:45
      294500 -- (-1488.904) (-1490.521) (-1489.735) [-1495.130] * (-1488.062) (-1488.667) [-1488.164] (-1489.840) -- 0:00:45
      295000 -- (-1490.330) [-1489.459] (-1488.833) (-1489.495) * [-1488.187] (-1488.220) (-1487.987) (-1487.313) -- 0:00:45

      Average standard deviation of split frequencies: 0.010867

      295500 -- (-1488.775) (-1491.420) [-1488.833] (-1489.574) * (-1487.307) (-1488.070) (-1487.679) [-1488.617] -- 0:00:45
      296000 -- (-1492.286) [-1487.805] (-1488.192) (-1491.568) * (-1488.489) (-1487.181) [-1486.900] (-1487.373) -- 0:00:45
      296500 -- [-1488.387] (-1488.080) (-1488.458) (-1488.007) * (-1489.091) (-1486.547) (-1486.631) [-1487.647] -- 0:00:45
      297000 -- (-1491.251) (-1488.190) [-1487.722] (-1488.835) * (-1489.304) (-1487.205) (-1487.774) [-1488.277] -- 0:00:44
      297500 -- (-1492.374) [-1487.791] (-1488.497) (-1487.417) * (-1487.522) (-1487.205) (-1487.781) [-1491.052] -- 0:00:44
      298000 -- (-1488.200) (-1489.731) [-1492.707] (-1491.014) * (-1491.545) (-1488.278) (-1489.517) [-1489.865] -- 0:00:44
      298500 -- (-1489.904) (-1489.041) (-1493.093) [-1487.964] * (-1487.403) [-1488.339] (-1487.214) (-1492.170) -- 0:00:44
      299000 -- (-1487.742) (-1489.246) [-1493.144] (-1487.014) * (-1488.642) [-1487.598] (-1488.447) (-1489.370) -- 0:00:44
      299500 -- (-1488.067) [-1489.443] (-1491.544) (-1486.981) * (-1489.251) (-1491.664) (-1492.542) [-1488.043] -- 0:00:44
      300000 -- (-1488.038) (-1488.511) [-1490.363] (-1488.129) * [-1487.680] (-1491.192) (-1491.838) (-1490.370) -- 0:00:44

      Average standard deviation of split frequencies: 0.009799

      300500 -- [-1487.496] (-1489.749) (-1489.799) (-1487.557) * (-1488.646) (-1488.439) [-1489.052] (-1488.756) -- 0:00:44
      301000 -- (-1487.573) (-1491.503) [-1489.969] (-1487.197) * [-1487.570] (-1488.099) (-1486.556) (-1486.927) -- 0:00:44
      301500 -- [-1487.735] (-1487.600) (-1488.490) (-1489.889) * (-1488.470) [-1488.027] (-1486.727) (-1488.006) -- 0:00:44
      302000 -- (-1490.068) (-1489.500) [-1488.875] (-1492.356) * (-1490.131) (-1488.602) [-1486.727] (-1487.055) -- 0:00:43
      302500 -- [-1486.673] (-1487.678) (-1487.414) (-1491.451) * (-1491.231) [-1488.315] (-1486.988) (-1487.102) -- 0:00:43
      303000 -- (-1489.105) (-1488.133) [-1489.827] (-1489.500) * (-1488.814) (-1488.866) (-1487.604) [-1486.986] -- 0:00:43
      303500 -- (-1488.495) [-1487.072] (-1490.516) (-1488.435) * (-1488.776) (-1488.515) [-1489.422] (-1487.727) -- 0:00:43
      304000 -- (-1487.931) [-1487.500] (-1489.509) (-1487.362) * (-1488.759) (-1496.792) [-1489.404] (-1487.902) -- 0:00:45
      304500 -- (-1488.990) (-1487.963) [-1491.206] (-1487.493) * (-1488.041) (-1489.268) [-1487.991] (-1488.781) -- 0:00:45
      305000 -- [-1487.793] (-1488.845) (-1487.771) (-1490.992) * (-1488.746) [-1494.034] (-1487.002) (-1487.897) -- 0:00:45

      Average standard deviation of split frequencies: 0.010784

      305500 -- (-1491.334) [-1487.564] (-1488.442) (-1491.576) * [-1488.173] (-1490.074) (-1488.124) (-1488.285) -- 0:00:45
      306000 -- (-1489.218) (-1487.251) [-1488.339] (-1491.018) * (-1491.220) [-1493.527] (-1489.408) (-1490.593) -- 0:00:45
      306500 -- (-1492.703) (-1491.064) (-1494.118) [-1488.320] * (-1487.705) (-1496.340) (-1487.899) [-1488.573] -- 0:00:45
      307000 -- (-1491.471) (-1490.239) [-1490.742] (-1487.909) * (-1486.908) (-1493.047) (-1488.429) [-1489.277] -- 0:00:45
      307500 -- [-1488.923] (-1494.086) (-1490.505) (-1489.125) * [-1486.909] (-1493.720) (-1491.885) (-1489.513) -- 0:00:45
      308000 -- (-1487.598) (-1492.062) (-1491.894) [-1489.588] * (-1490.206) (-1492.419) (-1489.438) [-1488.223] -- 0:00:44
      308500 -- [-1486.856] (-1491.134) (-1488.513) (-1488.683) * (-1490.035) (-1488.148) (-1488.710) [-1487.599] -- 0:00:44
      309000 -- (-1487.027) (-1491.011) (-1488.486) [-1488.319] * (-1490.382) (-1489.363) [-1488.671] (-1489.688) -- 0:00:44
      309500 -- (-1489.767) (-1489.639) [-1487.310] (-1492.239) * (-1488.959) (-1487.639) (-1488.397) [-1488.674] -- 0:00:44
      310000 -- [-1488.623] (-1488.002) (-1487.530) (-1497.997) * (-1489.997) (-1489.426) [-1488.108] (-1490.380) -- 0:00:44

      Average standard deviation of split frequencies: 0.009640

      310500 -- (-1490.253) (-1487.977) [-1488.205] (-1488.756) * (-1488.947) (-1491.531) (-1490.046) [-1488.438] -- 0:00:44
      311000 -- [-1488.083] (-1487.980) (-1488.127) (-1487.942) * (-1490.456) [-1489.525] (-1490.378) (-1487.958) -- 0:00:44
      311500 -- (-1487.062) (-1487.149) (-1488.316) [-1488.183] * (-1489.433) (-1494.721) [-1486.954] (-1487.634) -- 0:00:44
      312000 -- (-1492.074) (-1489.210) (-1487.501) [-1491.948] * (-1489.590) (-1488.432) [-1487.776] (-1488.157) -- 0:00:44
      312500 -- (-1488.543) (-1489.693) [-1487.210] (-1498.775) * (-1488.484) (-1487.546) [-1488.502] (-1488.285) -- 0:00:44
      313000 -- [-1488.906] (-1489.154) (-1487.053) (-1488.978) * (-1488.868) (-1487.981) [-1487.994] (-1487.875) -- 0:00:43
      313500 -- (-1487.330) [-1492.967] (-1488.383) (-1489.549) * (-1491.106) (-1487.697) (-1491.110) [-1493.238] -- 0:00:43
      314000 -- [-1486.743] (-1493.020) (-1488.340) (-1487.421) * [-1488.745] (-1487.861) (-1488.306) (-1488.944) -- 0:00:43
      314500 -- (-1488.566) (-1489.360) [-1488.374] (-1487.126) * (-1488.895) (-1490.802) (-1488.694) [-1488.351] -- 0:00:43
      315000 -- (-1487.495) (-1488.511) [-1489.156] (-1488.842) * (-1488.992) (-1490.564) [-1488.283] (-1488.383) -- 0:00:43

      Average standard deviation of split frequencies: 0.009477

      315500 -- (-1494.100) [-1487.855] (-1487.344) (-1488.211) * [-1487.837] (-1487.863) (-1488.448) (-1488.151) -- 0:00:43
      316000 -- (-1489.605) [-1487.471] (-1487.779) (-1495.924) * [-1488.589] (-1487.699) (-1489.544) (-1491.698) -- 0:00:43
      316500 -- (-1487.816) (-1487.571) (-1488.470) [-1489.434] * (-1493.300) [-1488.571] (-1487.374) (-1490.544) -- 0:00:43
      317000 -- [-1489.946] (-1486.950) (-1489.189) (-1488.775) * (-1489.267) (-1487.655) (-1488.934) [-1491.330] -- 0:00:43
      317500 -- [-1488.110] (-1488.370) (-1490.530) (-1489.343) * [-1488.761] (-1488.813) (-1487.734) (-1489.567) -- 0:00:42
      318000 -- [-1492.964] (-1489.054) (-1494.576) (-1487.516) * [-1489.421] (-1488.535) (-1490.433) (-1489.321) -- 0:00:42
      318500 -- (-1498.345) (-1488.169) [-1488.234] (-1488.217) * (-1493.078) (-1488.245) (-1488.964) [-1489.956] -- 0:00:42
      319000 -- (-1491.853) (-1490.035) (-1487.499) [-1488.743] * (-1490.058) (-1493.043) [-1488.567] (-1488.497) -- 0:00:42
      319500 -- [-1488.253] (-1488.558) (-1491.856) (-1487.297) * (-1491.938) (-1488.325) [-1488.379] (-1489.891) -- 0:00:42
      320000 -- [-1488.047] (-1490.450) (-1495.336) (-1487.457) * (-1490.775) [-1487.155] (-1489.135) (-1491.464) -- 0:00:44

      Average standard deviation of split frequencies: 0.009945

      320500 -- (-1489.264) (-1488.633) (-1493.989) [-1487.440] * (-1490.138) (-1488.449) (-1489.161) [-1488.783] -- 0:00:44
      321000 -- [-1488.790] (-1488.252) (-1489.781) (-1490.884) * (-1491.538) (-1487.439) (-1488.352) [-1487.182] -- 0:00:44
      321500 -- (-1492.693) [-1489.608] (-1488.787) (-1487.978) * [-1488.541] (-1488.081) (-1486.897) (-1488.286) -- 0:00:44
      322000 -- (-1488.927) (-1490.625) [-1488.406] (-1490.083) * [-1487.932] (-1486.536) (-1488.142) (-1488.260) -- 0:00:44
      322500 -- [-1489.595] (-1488.297) (-1488.526) (-1488.173) * (-1495.054) (-1486.876) [-1488.004] (-1486.684) -- 0:00:44
      323000 -- (-1488.499) (-1488.215) [-1486.961] (-1488.321) * (-1490.959) (-1487.797) (-1488.605) [-1486.684] -- 0:00:44
      323500 -- [-1488.802] (-1489.817) (-1489.504) (-1487.982) * [-1488.577] (-1489.955) (-1490.981) (-1489.288) -- 0:00:43
      324000 -- [-1490.163] (-1492.916) (-1490.523) (-1492.678) * (-1489.412) (-1488.912) (-1490.052) [-1486.994] -- 0:00:43
      324500 -- (-1493.046) (-1487.776) [-1487.139] (-1490.666) * (-1489.584) [-1487.964] (-1490.265) (-1486.994) -- 0:00:43
      325000 -- (-1489.344) (-1487.851) (-1491.507) [-1491.382] * (-1488.913) [-1487.152] (-1487.986) (-1486.994) -- 0:00:43

      Average standard deviation of split frequencies: 0.010037

      325500 -- (-1488.170) (-1487.655) [-1489.195] (-1488.622) * (-1487.830) [-1488.042] (-1489.617) (-1488.414) -- 0:00:43
      326000 -- (-1487.467) (-1487.244) (-1489.472) [-1488.691] * (-1489.932) [-1486.764] (-1487.500) (-1490.248) -- 0:00:43
      326500 -- (-1487.411) (-1488.146) (-1489.452) [-1487.966] * (-1495.093) [-1487.561] (-1486.978) (-1488.042) -- 0:00:43
      327000 -- (-1489.518) [-1488.129] (-1489.748) (-1488.456) * (-1496.866) (-1486.972) (-1488.184) [-1488.965] -- 0:00:43
      327500 -- (-1486.728) (-1489.757) (-1491.064) [-1488.642] * (-1490.218) [-1488.276] (-1488.900) (-1489.053) -- 0:00:43
      328000 -- (-1486.732) (-1489.283) (-1486.993) [-1489.280] * (-1487.799) (-1488.059) (-1486.967) [-1487.929] -- 0:00:43
      328500 -- (-1486.727) (-1487.061) [-1487.076] (-1487.986) * (-1489.156) (-1493.381) [-1486.973] (-1489.143) -- 0:00:42
      329000 -- (-1486.732) (-1487.059) [-1486.521] (-1493.144) * [-1491.426] (-1491.719) (-1486.979) (-1490.107) -- 0:00:42
      329500 -- [-1486.732] (-1489.233) (-1487.998) (-1487.952) * (-1488.662) (-1490.857) [-1487.081] (-1490.291) -- 0:00:42
      330000 -- (-1489.511) (-1489.356) [-1488.403] (-1487.738) * (-1487.250) (-1489.846) [-1487.607] (-1489.853) -- 0:00:42

      Average standard deviation of split frequencies: 0.010147

      330500 -- [-1487.347] (-1489.211) (-1487.801) (-1489.234) * (-1487.805) (-1490.431) [-1493.179] (-1488.244) -- 0:00:42
      331000 -- (-1488.122) (-1490.406) [-1491.856] (-1487.980) * (-1487.781) (-1489.953) (-1492.178) [-1487.732] -- 0:00:42
      331500 -- (-1487.432) (-1493.090) [-1490.272] (-1489.272) * (-1488.289) [-1489.966] (-1492.178) (-1488.163) -- 0:00:42
      332000 -- (-1487.032) (-1489.707) [-1487.528] (-1487.899) * (-1489.235) [-1487.866] (-1487.411) (-1488.524) -- 0:00:42
      332500 -- (-1490.243) (-1488.688) (-1488.149) [-1488.652] * (-1487.805) [-1488.693] (-1488.022) (-1489.676) -- 0:00:42
      333000 -- (-1489.130) (-1489.299) [-1488.413] (-1489.673) * [-1489.824] (-1487.714) (-1489.151) (-1490.268) -- 0:00:42
      333500 -- (-1488.708) [-1487.338] (-1489.586) (-1489.224) * (-1490.010) (-1489.578) (-1487.550) [-1489.173] -- 0:00:41
      334000 -- (-1487.878) (-1487.366) [-1486.726] (-1489.576) * (-1492.354) (-1490.149) [-1489.494] (-1488.813) -- 0:00:41
      334500 -- (-1487.420) (-1487.076) [-1486.707] (-1490.903) * (-1492.984) (-1491.665) [-1487.590] (-1489.905) -- 0:00:41
      335000 -- [-1487.586] (-1488.292) (-1487.045) (-1489.124) * (-1489.047) [-1491.163] (-1488.996) (-1490.232) -- 0:00:41

      Average standard deviation of split frequencies: 0.010646

      335500 -- (-1488.217) (-1488.207) (-1487.689) [-1487.746] * (-1490.666) (-1491.121) [-1488.357] (-1488.569) -- 0:00:41
      336000 -- [-1488.240] (-1487.410) (-1486.683) (-1490.250) * (-1487.556) (-1489.105) (-1491.251) [-1492.268] -- 0:00:43
      336500 -- (-1487.682) (-1492.090) [-1486.641] (-1487.935) * (-1489.981) (-1487.603) [-1490.560] (-1492.074) -- 0:00:43
      337000 -- (-1488.021) [-1489.588] (-1490.539) (-1489.752) * (-1493.386) (-1487.465) (-1487.473) [-1492.879] -- 0:00:43
      337500 -- (-1488.279) (-1489.846) (-1491.797) [-1489.716] * (-1492.894) (-1486.976) [-1491.495] (-1490.916) -- 0:00:43
      338000 -- (-1488.917) [-1487.977] (-1494.633) (-1488.556) * (-1489.164) [-1488.590] (-1491.006) (-1489.127) -- 0:00:43
      338500 -- (-1489.617) (-1488.656) (-1489.885) [-1488.195] * (-1488.262) (-1488.897) (-1488.363) [-1487.683] -- 0:00:42
      339000 -- (-1487.566) (-1495.120) (-1487.988) [-1489.653] * (-1487.617) (-1491.493) [-1487.348] (-1488.544) -- 0:00:42
      339500 -- (-1487.566) (-1493.991) (-1488.049) [-1488.366] * (-1489.754) [-1492.034] (-1488.635) (-1489.172) -- 0:00:42
      340000 -- [-1490.278] (-1490.184) (-1486.926) (-1489.872) * (-1493.804) (-1489.735) (-1488.915) [-1486.884] -- 0:00:42

      Average standard deviation of split frequencies: 0.011966

      340500 -- (-1487.933) [-1489.691] (-1490.237) (-1490.520) * (-1491.934) (-1489.722) (-1492.459) [-1488.685] -- 0:00:42
      341000 -- (-1487.505) [-1488.519] (-1489.833) (-1494.231) * (-1490.200) (-1492.475) (-1488.124) [-1488.454] -- 0:00:42
      341500 -- (-1493.859) (-1491.083) [-1490.986] (-1489.633) * (-1488.746) [-1486.727] (-1490.958) (-1488.493) -- 0:00:42
      342000 -- (-1494.201) (-1488.497) (-1489.336) [-1486.657] * (-1487.507) [-1486.849] (-1494.464) (-1488.235) -- 0:00:42
      342500 -- [-1487.150] (-1488.524) (-1488.281) (-1490.388) * (-1490.644) (-1486.831) (-1491.452) [-1488.828] -- 0:00:42
      343000 -- (-1487.911) (-1488.602) (-1490.490) [-1490.049] * (-1489.512) (-1488.095) (-1491.877) [-1489.418] -- 0:00:42
      343500 -- (-1490.601) (-1489.024) (-1489.699) [-1486.970] * (-1492.448) [-1489.348] (-1493.132) (-1489.553) -- 0:00:42
      344000 -- (-1491.515) (-1488.264) (-1490.424) [-1488.457] * (-1487.733) [-1489.652] (-1488.022) (-1492.771) -- 0:00:41
      344500 -- (-1487.247) (-1487.520) (-1490.104) [-1488.235] * [-1489.251] (-1488.995) (-1490.406) (-1488.439) -- 0:00:41
      345000 -- [-1489.018] (-1489.453) (-1488.202) (-1490.962) * (-1490.051) (-1491.689) (-1498.953) [-1490.866] -- 0:00:41

      Average standard deviation of split frequencies: 0.012823

      345500 -- (-1487.669) (-1487.531) [-1490.876] (-1487.669) * (-1491.734) (-1489.498) (-1494.059) [-1489.834] -- 0:00:41
      346000 -- (-1489.666) [-1487.380] (-1489.562) (-1489.273) * (-1488.937) [-1489.480] (-1491.940) (-1488.104) -- 0:00:41
      346500 -- (-1488.725) (-1490.416) (-1488.452) [-1487.168] * (-1489.056) [-1490.567] (-1488.076) (-1488.899) -- 0:00:41
      347000 -- [-1489.603] (-1488.044) (-1487.570) (-1489.438) * [-1488.718] (-1487.994) (-1487.015) (-1486.715) -- 0:00:41
      347500 -- (-1490.275) (-1488.465) (-1489.408) [-1488.027] * (-1488.445) (-1487.537) [-1487.035] (-1488.718) -- 0:00:41
      348000 -- (-1490.712) (-1488.833) (-1490.409) [-1488.950] * (-1488.699) (-1488.326) [-1487.041] (-1489.042) -- 0:00:41
      348500 -- (-1490.699) [-1490.829] (-1494.058) (-1489.497) * (-1490.466) (-1491.583) (-1487.042) [-1487.789] -- 0:00:41
      349000 -- (-1488.300) [-1489.726] (-1488.539) (-1492.442) * (-1489.666) [-1487.550] (-1489.191) (-1488.509) -- 0:00:41
      349500 -- (-1488.251) [-1487.623] (-1491.728) (-1493.060) * [-1490.238] (-1491.840) (-1488.980) (-1486.713) -- 0:00:40
      350000 -- (-1493.504) (-1489.689) (-1487.790) [-1486.973] * (-1491.705) [-1492.324] (-1490.439) (-1487.502) -- 0:00:40

      Average standard deviation of split frequencies: 0.012995

      350500 -- (-1488.884) [-1487.943] (-1487.666) (-1487.789) * (-1488.564) [-1488.146] (-1489.830) (-1487.398) -- 0:00:40
      351000 -- (-1487.974) (-1487.502) (-1487.531) [-1489.379] * (-1489.662) (-1488.580) (-1489.661) [-1489.459] -- 0:00:40
      351500 -- (-1490.242) [-1486.781] (-1487.900) (-1488.733) * (-1487.595) [-1487.091] (-1489.509) (-1489.242) -- 0:00:40
      352000 -- (-1489.797) [-1489.200] (-1488.224) (-1491.698) * (-1487.119) (-1486.765) [-1489.056] (-1489.156) -- 0:00:42
      352500 -- [-1488.872] (-1489.901) (-1491.179) (-1492.117) * (-1490.778) [-1487.617] (-1488.542) (-1490.684) -- 0:00:42
      353000 -- (-1491.737) (-1489.180) [-1486.784] (-1488.882) * [-1487.548] (-1487.452) (-1489.040) (-1490.096) -- 0:00:42
      353500 -- [-1490.166] (-1486.880) (-1487.934) (-1487.327) * (-1489.095) [-1487.574] (-1494.732) (-1487.238) -- 0:00:42
      354000 -- (-1488.705) [-1486.605] (-1492.257) (-1487.617) * [-1489.788] (-1488.794) (-1490.252) (-1489.611) -- 0:00:41
      354500 -- (-1488.530) (-1489.928) [-1488.300] (-1487.424) * (-1487.764) (-1487.766) (-1489.805) [-1489.919] -- 0:00:41
      355000 -- [-1491.017] (-1486.914) (-1488.254) (-1486.888) * [-1489.694] (-1492.981) (-1487.517) (-1491.410) -- 0:00:41

      Average standard deviation of split frequencies: 0.012947

      355500 -- (-1493.296) (-1489.527) (-1492.570) [-1488.741] * (-1488.984) (-1491.530) [-1487.994] (-1491.504) -- 0:00:41
      356000 -- (-1492.283) (-1487.901) (-1490.882) [-1493.933] * (-1491.431) (-1492.538) (-1488.039) [-1488.883] -- 0:00:41
      356500 -- (-1488.609) [-1488.110] (-1490.353) (-1490.389) * [-1487.835] (-1490.405) (-1489.260) (-1491.088) -- 0:00:41
      357000 -- (-1488.386) [-1490.166] (-1487.559) (-1487.918) * [-1488.374] (-1489.988) (-1486.804) (-1490.872) -- 0:00:41
      357500 -- (-1488.566) (-1490.132) (-1489.621) [-1489.840] * (-1488.570) (-1491.191) [-1487.174] (-1488.038) -- 0:00:41
      358000 -- [-1486.861] (-1491.211) (-1490.018) (-1489.234) * (-1489.686) [-1489.329] (-1487.797) (-1486.986) -- 0:00:41
      358500 -- (-1487.414) (-1493.322) (-1489.791) [-1489.707] * (-1487.544) (-1486.842) [-1490.170] (-1489.879) -- 0:00:41
      359000 -- (-1488.379) (-1494.534) [-1490.136] (-1487.716) * [-1487.899] (-1486.810) (-1490.930) (-1489.973) -- 0:00:41
      359500 -- (-1489.429) [-1495.829] (-1491.215) (-1488.772) * [-1487.295] (-1487.896) (-1488.931) (-1493.957) -- 0:00:40
      360000 -- (-1489.419) [-1488.620] (-1489.332) (-1488.325) * (-1487.775) (-1489.046) [-1488.540] (-1490.507) -- 0:00:40

      Average standard deviation of split frequencies: 0.012532

      360500 -- (-1490.717) (-1489.382) [-1487.745] (-1488.293) * [-1488.015] (-1490.074) (-1489.089) (-1489.862) -- 0:00:40
      361000 -- (-1496.409) (-1492.723) [-1488.679] (-1492.372) * (-1489.524) (-1491.746) [-1488.994] (-1492.546) -- 0:00:40
      361500 -- [-1489.477] (-1491.642) (-1487.753) (-1489.159) * (-1491.411) (-1488.154) (-1490.587) [-1493.092] -- 0:00:40
      362000 -- (-1489.978) [-1487.595] (-1490.714) (-1488.702) * (-1493.610) [-1487.739] (-1489.609) (-1489.470) -- 0:00:40
      362500 -- (-1487.984) (-1489.546) (-1490.449) [-1489.639] * (-1487.712) (-1489.928) [-1487.816] (-1488.358) -- 0:00:40
      363000 -- (-1490.550) [-1490.976] (-1489.970) (-1489.035) * (-1491.875) (-1489.545) [-1488.795] (-1489.706) -- 0:00:40
      363500 -- [-1487.040] (-1487.257) (-1488.601) (-1492.125) * (-1487.461) (-1491.094) [-1489.217] (-1488.436) -- 0:00:40
      364000 -- (-1487.090) (-1489.699) (-1489.571) [-1491.807] * [-1489.284] (-1491.784) (-1487.761) (-1492.181) -- 0:00:40
      364500 -- (-1487.858) (-1490.154) (-1488.232) [-1488.134] * [-1488.106] (-1488.794) (-1491.770) (-1496.848) -- 0:00:40
      365000 -- [-1486.731] (-1488.178) (-1487.442) (-1487.566) * (-1486.744) [-1488.739] (-1489.349) (-1495.633) -- 0:00:40

      Average standard deviation of split frequencies: 0.012577

      365500 -- (-1486.857) (-1488.871) (-1486.736) [-1487.841] * [-1487.552] (-1489.266) (-1491.589) (-1492.782) -- 0:00:39
      366000 -- (-1488.368) [-1488.802] (-1488.834) (-1490.852) * (-1487.135) (-1490.109) [-1491.573] (-1493.833) -- 0:00:39
      366500 -- (-1488.520) [-1487.312] (-1486.851) (-1489.387) * [-1488.371] (-1489.030) (-1488.138) (-1492.884) -- 0:00:39
      367000 -- (-1487.189) [-1487.441] (-1486.904) (-1493.283) * [-1488.149] (-1493.500) (-1488.834) (-1488.285) -- 0:00:39
      367500 -- (-1492.673) [-1487.566] (-1490.309) (-1489.119) * (-1492.914) (-1487.774) [-1488.867] (-1488.169) -- 0:00:39
      368000 -- (-1489.212) (-1488.606) [-1488.007] (-1492.325) * (-1490.499) [-1487.796] (-1488.305) (-1489.110) -- 0:00:41
      368500 -- (-1488.928) (-1488.272) [-1487.242] (-1489.055) * (-1490.757) (-1487.472) [-1487.177] (-1488.830) -- 0:00:41
      369000 -- [-1489.027] (-1488.333) (-1487.648) (-1490.115) * (-1489.357) [-1487.628] (-1487.089) (-1490.846) -- 0:00:41
      369500 -- (-1489.467) [-1488.312] (-1487.881) (-1491.757) * (-1492.234) [-1487.277] (-1487.183) (-1489.695) -- 0:00:40
      370000 -- (-1488.690) (-1493.896) [-1487.076] (-1493.447) * (-1493.866) [-1487.470] (-1487.355) (-1488.747) -- 0:00:40

      Average standard deviation of split frequencies: 0.012119

      370500 -- (-1488.761) (-1488.004) (-1489.222) [-1493.477] * (-1493.137) (-1487.385) [-1489.692] (-1487.681) -- 0:00:40
      371000 -- [-1487.304] (-1490.004) (-1490.658) (-1488.388) * (-1491.459) [-1488.505] (-1490.631) (-1487.656) -- 0:00:40
      371500 -- [-1487.243] (-1493.013) (-1489.577) (-1492.048) * (-1490.302) (-1489.090) [-1491.084] (-1487.574) -- 0:00:40
      372000 -- (-1489.307) [-1489.626] (-1488.573) (-1488.474) * [-1488.249] (-1489.961) (-1490.710) (-1488.218) -- 0:00:40
      372500 -- (-1488.197) [-1490.379] (-1487.322) (-1488.703) * (-1488.035) (-1490.147) (-1487.501) [-1488.427] -- 0:00:40
      373000 -- (-1488.197) [-1489.650] (-1487.304) (-1488.770) * (-1489.591) (-1487.428) (-1492.783) [-1491.640] -- 0:00:40
      373500 -- [-1489.445] (-1491.834) (-1488.253) (-1487.273) * [-1488.462] (-1488.183) (-1488.246) (-1488.267) -- 0:00:40
      374000 -- (-1488.048) (-1488.674) (-1486.897) [-1487.352] * (-1487.064) (-1488.319) [-1487.454] (-1488.931) -- 0:00:40
      374500 -- (-1488.543) [-1486.932] (-1491.174) (-1487.512) * (-1488.125) [-1487.629] (-1488.645) (-1487.157) -- 0:00:40
      375000 -- (-1487.963) (-1487.369) (-1490.569) [-1488.274] * (-1490.961) (-1490.165) (-1491.173) [-1486.878] -- 0:00:40

      Average standard deviation of split frequencies: 0.011431

      375500 -- (-1486.595) [-1489.848] (-1490.500) (-1492.051) * (-1489.139) [-1487.498] (-1487.057) (-1488.191) -- 0:00:39
      376000 -- (-1490.744) (-1491.817) (-1489.486) [-1491.706] * [-1486.784] (-1488.118) (-1493.091) (-1487.237) -- 0:00:39
      376500 -- (-1488.264) (-1488.766) (-1489.929) [-1488.667] * (-1488.301) (-1495.906) [-1491.511] (-1488.581) -- 0:00:39
      377000 -- (-1490.099) (-1487.218) [-1489.313] (-1491.277) * (-1494.759) [-1488.913] (-1492.825) (-1488.225) -- 0:00:39
      377500 -- (-1488.807) [-1486.838] (-1489.846) (-1490.937) * (-1489.074) [-1489.169] (-1492.304) (-1489.452) -- 0:00:39
      378000 -- (-1487.236) (-1486.669) [-1490.224] (-1489.639) * (-1487.733) (-1489.691) [-1495.459] (-1490.180) -- 0:00:39
      378500 -- (-1486.866) (-1489.034) [-1490.508] (-1489.657) * [-1489.741] (-1488.105) (-1493.790) (-1488.839) -- 0:00:39
      379000 -- [-1488.107] (-1490.356) (-1488.930) (-1493.451) * [-1487.573] (-1487.675) (-1495.218) (-1488.296) -- 0:00:39
      379500 -- [-1488.094] (-1488.038) (-1490.952) (-1489.082) * (-1491.166) [-1488.235] (-1488.475) (-1488.238) -- 0:00:39
      380000 -- (-1487.977) (-1488.008) (-1490.068) [-1490.159] * (-1494.911) (-1487.019) (-1490.030) [-1487.655] -- 0:00:39

      Average standard deviation of split frequencies: 0.011437

      380500 -- (-1492.296) (-1488.271) (-1489.065) [-1489.042] * (-1488.318) (-1487.019) [-1488.739] (-1488.578) -- 0:00:39
      381000 -- (-1496.001) (-1487.914) (-1488.277) [-1488.363] * (-1488.323) (-1486.986) (-1491.235) [-1487.640] -- 0:00:38
      381500 -- (-1492.621) [-1488.363] (-1489.059) (-1488.769) * [-1486.987] (-1491.527) (-1490.020) (-1490.239) -- 0:00:38
      382000 -- (-1490.635) (-1491.449) (-1489.059) [-1487.559] * (-1488.230) (-1489.221) [-1491.560] (-1488.743) -- 0:00:38
      382500 -- [-1489.814] (-1491.797) (-1488.936) (-1488.752) * [-1488.213] (-1491.345) (-1488.841) (-1489.895) -- 0:00:38
      383000 -- (-1488.386) (-1487.087) (-1489.690) [-1487.496] * (-1490.096) (-1490.059) [-1489.237] (-1489.880) -- 0:00:38
      383500 -- (-1488.046) [-1487.750] (-1489.582) (-1488.664) * (-1486.764) (-1487.477) (-1489.613) [-1490.103] -- 0:00:40
      384000 -- [-1487.520] (-1489.468) (-1490.168) (-1487.992) * (-1486.820) [-1487.453] (-1491.172) (-1488.982) -- 0:00:40
      384500 -- [-1486.906] (-1489.615) (-1486.865) (-1488.161) * (-1486.732) (-1487.769) [-1488.265] (-1490.586) -- 0:00:40
      385000 -- (-1489.441) (-1490.490) (-1489.812) [-1489.369] * (-1490.521) (-1487.023) (-1487.645) [-1490.421] -- 0:00:39

      Average standard deviation of split frequencies: 0.011710

      385500 -- (-1491.574) [-1491.876] (-1487.130) (-1489.369) * (-1488.738) (-1487.350) (-1487.574) [-1487.450] -- 0:00:39
      386000 -- [-1490.766] (-1488.451) (-1487.069) (-1487.482) * (-1487.433) (-1488.115) (-1487.568) [-1488.938] -- 0:00:39
      386500 -- [-1491.311] (-1488.273) (-1487.703) (-1488.694) * (-1491.803) (-1488.060) (-1490.511) [-1490.063] -- 0:00:39
      387000 -- (-1489.495) (-1486.616) [-1487.138] (-1488.685) * (-1491.248) (-1488.297) (-1488.597) [-1487.926] -- 0:00:39
      387500 -- (-1490.445) (-1487.267) [-1486.873] (-1489.969) * (-1488.438) (-1488.297) [-1488.971] (-1487.014) -- 0:00:39
      388000 -- (-1491.957) [-1489.318] (-1487.022) (-1492.416) * (-1489.245) (-1486.826) (-1491.681) [-1487.824] -- 0:00:39
      388500 -- (-1493.950) [-1488.808] (-1487.754) (-1492.187) * (-1490.781) (-1487.068) [-1492.505] (-1487.573) -- 0:00:39
      389000 -- (-1488.886) (-1488.240) (-1488.912) [-1489.892] * (-1489.494) (-1489.807) [-1490.282] (-1487.966) -- 0:00:39
      389500 -- [-1489.558] (-1487.963) (-1487.346) (-1488.410) * (-1492.006) [-1487.399] (-1490.667) (-1488.869) -- 0:00:39
      390000 -- (-1487.044) [-1487.877] (-1487.434) (-1488.183) * [-1488.272] (-1488.156) (-1492.145) (-1490.718) -- 0:00:39

      Average standard deviation of split frequencies: 0.011996

      390500 -- (-1487.512) (-1489.052) (-1487.200) [-1491.844] * (-1488.416) (-1487.944) (-1489.215) [-1487.786] -- 0:00:39
      391000 -- (-1488.036) (-1490.155) (-1487.041) [-1487.321] * [-1489.447] (-1489.166) (-1488.990) (-1489.233) -- 0:00:38
      391500 -- (-1488.469) (-1491.286) [-1487.021] (-1488.690) * (-1491.122) (-1487.224) [-1489.656] (-1490.839) -- 0:00:38
      392000 -- (-1487.849) (-1493.146) [-1487.307] (-1486.815) * (-1489.255) (-1490.668) [-1489.115] (-1488.341) -- 0:00:38
      392500 -- [-1487.022] (-1489.374) (-1492.641) (-1488.004) * (-1488.072) (-1491.954) (-1487.949) [-1488.709] -- 0:00:38
      393000 -- (-1489.026) [-1487.763] (-1492.128) (-1488.553) * (-1492.421) [-1491.753] (-1488.332) (-1489.782) -- 0:00:38
      393500 -- (-1491.739) (-1490.101) (-1490.649) [-1489.227] * (-1494.338) (-1489.762) [-1487.196] (-1487.037) -- 0:00:38
      394000 -- [-1491.396] (-1488.014) (-1488.710) (-1489.989) * (-1491.593) (-1489.074) [-1487.456] (-1490.131) -- 0:00:38
      394500 -- [-1498.132] (-1487.996) (-1488.024) (-1490.797) * (-1488.339) (-1491.788) [-1487.834] (-1486.992) -- 0:00:38
      395000 -- (-1491.277) (-1489.093) [-1488.908] (-1487.587) * (-1487.493) (-1487.337) (-1487.293) [-1487.638] -- 0:00:38

      Average standard deviation of split frequencies: 0.011904

      395500 -- (-1491.599) [-1488.444] (-1488.476) (-1495.853) * (-1489.987) (-1489.509) (-1490.865) [-1489.789] -- 0:00:38
      396000 -- (-1488.313) (-1487.345) [-1490.378] (-1494.574) * (-1489.239) (-1489.258) [-1489.924] (-1490.997) -- 0:00:38
      396500 -- [-1488.599] (-1487.637) (-1489.900) (-1490.591) * (-1487.003) (-1491.198) (-1489.673) [-1489.425] -- 0:00:38
      397000 -- (-1488.061) [-1486.999] (-1486.856) (-1491.285) * (-1488.923) (-1488.210) (-1487.623) [-1488.047] -- 0:00:37
      397500 -- [-1488.977] (-1487.187) (-1490.284) (-1490.602) * (-1490.772) (-1488.273) (-1486.852) [-1488.139] -- 0:00:37
      398000 -- (-1489.136) (-1487.291) [-1488.329] (-1488.605) * (-1493.004) (-1488.235) (-1489.674) [-1487.555] -- 0:00:37
      398500 -- [-1488.041] (-1488.754) (-1486.817) (-1488.715) * (-1492.559) (-1489.709) [-1487.392] (-1488.845) -- 0:00:37
      399000 -- (-1489.824) (-1489.211) (-1486.991) [-1489.325] * (-1487.239) (-1490.257) [-1491.232] (-1488.412) -- 0:00:37
      399500 -- (-1490.454) [-1486.456] (-1486.967) (-1489.537) * (-1495.315) [-1489.937] (-1489.162) (-1487.531) -- 0:00:39
      400000 -- [-1489.494] (-1491.202) (-1487.402) (-1488.110) * (-1487.280) [-1490.493] (-1488.814) (-1491.329) -- 0:00:39

      Average standard deviation of split frequencies: 0.011766

      400500 -- [-1487.360] (-1490.942) (-1492.302) (-1492.688) * (-1488.545) (-1488.166) (-1488.786) [-1488.116] -- 0:00:38
      401000 -- (-1486.945) (-1491.762) (-1488.523) [-1488.566] * (-1487.852) [-1488.229] (-1487.391) (-1489.442) -- 0:00:38
      401500 -- (-1488.023) [-1489.019] (-1487.173) (-1488.595) * (-1488.811) (-1486.699) [-1489.970] (-1489.806) -- 0:00:38
      402000 -- (-1489.809) [-1489.013] (-1487.366) (-1490.881) * (-1489.937) (-1486.883) [-1486.631] (-1487.479) -- 0:00:38
      402500 -- (-1488.803) (-1491.300) [-1487.262] (-1490.980) * (-1490.310) (-1489.300) (-1486.599) [-1491.007] -- 0:00:38
      403000 -- (-1491.830) [-1491.812] (-1490.560) (-1487.145) * (-1489.124) (-1490.573) (-1486.807) [-1487.719] -- 0:00:38
      403500 -- (-1488.876) (-1488.300) (-1490.574) [-1487.539] * (-1488.036) (-1488.810) (-1487.128) [-1489.293] -- 0:00:38
      404000 -- (-1491.292) (-1491.500) [-1490.000] (-1487.810) * (-1488.513) [-1487.407] (-1489.399) (-1487.429) -- 0:00:38
      404500 -- (-1487.036) [-1490.408] (-1490.390) (-1487.651) * (-1488.182) (-1490.778) [-1488.452] (-1487.283) -- 0:00:38
      405000 -- [-1488.269] (-1488.049) (-1486.762) (-1492.654) * (-1487.466) (-1489.393) (-1495.666) [-1487.499] -- 0:00:38

      Average standard deviation of split frequencies: 0.011611

      405500 -- (-1487.431) (-1487.232) [-1486.774] (-1487.444) * [-1488.140] (-1488.838) (-1496.907) (-1489.133) -- 0:00:38
      406000 -- (-1487.481) (-1490.722) (-1487.401) [-1488.200] * (-1487.579) (-1490.869) (-1495.803) [-1486.693] -- 0:00:38
      406500 -- (-1487.555) [-1490.882] (-1490.561) (-1489.392) * [-1486.916] (-1490.960) (-1492.861) (-1486.945) -- 0:00:37
      407000 -- (-1488.293) [-1490.081] (-1489.612) (-1489.486) * (-1492.678) [-1487.560] (-1489.655) (-1491.740) -- 0:00:37
      407500 -- [-1490.230] (-1489.136) (-1487.851) (-1496.699) * (-1488.869) (-1487.403) (-1487.281) [-1489.435] -- 0:00:37
      408000 -- (-1487.617) (-1489.326) (-1488.200) [-1488.518] * [-1488.400] (-1488.167) (-1492.481) (-1493.316) -- 0:00:37
      408500 -- [-1487.602] (-1494.788) (-1489.406) (-1490.240) * [-1487.298] (-1493.062) (-1490.771) (-1490.417) -- 0:00:37
      409000 -- [-1489.234] (-1489.465) (-1486.671) (-1488.824) * [-1487.495] (-1489.229) (-1493.613) (-1488.635) -- 0:00:37
      409500 -- (-1489.535) (-1487.346) (-1486.947) [-1489.878] * [-1488.779] (-1487.768) (-1490.807) (-1490.129) -- 0:00:37
      410000 -- (-1487.414) (-1487.389) [-1488.870] (-1489.549) * (-1489.516) [-1487.387] (-1489.793) (-1487.592) -- 0:00:37

      Average standard deviation of split frequencies: 0.010804

      410500 -- (-1488.184) (-1487.398) (-1487.550) [-1495.130] * (-1490.755) (-1487.547) (-1487.566) [-1490.569] -- 0:00:37
      411000 -- [-1488.397] (-1488.720) (-1489.881) (-1489.534) * (-1487.117) [-1491.604] (-1492.542) (-1489.201) -- 0:00:37
      411500 -- (-1487.630) (-1489.429) (-1488.075) [-1488.909] * [-1487.888] (-1487.454) (-1489.986) (-1491.492) -- 0:00:37
      412000 -- [-1487.957] (-1489.137) (-1489.068) (-1490.346) * (-1490.060) [-1489.824] (-1487.840) (-1490.592) -- 0:00:37
      412500 -- [-1489.156] (-1489.490) (-1489.088) (-1487.345) * [-1489.030] (-1488.730) (-1487.661) (-1488.884) -- 0:00:37
      413000 -- (-1488.985) (-1491.661) (-1488.603) [-1487.347] * (-1493.662) [-1489.744] (-1487.547) (-1486.792) -- 0:00:36
      413500 -- (-1489.039) (-1491.388) [-1489.272] (-1488.487) * (-1492.664) (-1487.333) (-1492.290) [-1489.781] -- 0:00:36
      414000 -- (-1489.279) [-1494.827] (-1487.521) (-1488.322) * (-1493.482) [-1487.344] (-1494.649) (-1489.233) -- 0:00:36
      414500 -- (-1490.569) (-1490.778) (-1488.008) [-1490.618] * (-1490.805) (-1488.478) (-1487.392) [-1487.275] -- 0:00:36
      415000 -- (-1488.339) [-1487.822] (-1488.320) (-1491.478) * [-1488.381] (-1488.888) (-1488.106) (-1488.967) -- 0:00:36

      Average standard deviation of split frequencies: 0.011398

      415500 -- (-1486.689) [-1487.384] (-1488.577) (-1489.493) * (-1487.215) [-1490.622] (-1488.121) (-1490.445) -- 0:00:37
      416000 -- (-1491.627) (-1488.714) (-1490.218) [-1487.229] * (-1493.485) (-1487.447) [-1487.895] (-1487.822) -- 0:00:37
      416500 -- (-1495.148) (-1487.561) (-1491.443) [-1487.960] * [-1488.962] (-1487.713) (-1487.726) (-1492.045) -- 0:00:37
      417000 -- (-1488.051) (-1486.707) [-1488.410] (-1488.291) * (-1488.212) (-1487.937) [-1490.568] (-1488.662) -- 0:00:37
      417500 -- (-1488.178) (-1490.544) (-1487.715) [-1488.807] * [-1489.999] (-1487.489) (-1489.454) (-1487.923) -- 0:00:37
      418000 -- (-1487.470) (-1489.624) (-1487.453) [-1488.295] * [-1490.418] (-1486.646) (-1487.926) (-1488.306) -- 0:00:37
      418500 -- [-1489.386] (-1491.454) (-1487.110) (-1488.503) * (-1489.086) [-1486.941] (-1489.633) (-1491.640) -- 0:00:37
      419000 -- (-1489.620) (-1489.463) (-1487.495) [-1487.140] * (-1488.776) (-1492.665) [-1490.443] (-1488.039) -- 0:00:37
      419500 -- (-1490.982) (-1495.094) (-1487.714) [-1489.305] * [-1492.808] (-1492.080) (-1490.163) (-1488.399) -- 0:00:37
      420000 -- (-1490.047) (-1488.323) [-1488.825] (-1488.313) * (-1486.888) (-1490.210) (-1492.763) [-1489.379] -- 0:00:37

      Average standard deviation of split frequencies: 0.011470

      420500 -- (-1489.152) [-1490.336] (-1492.759) (-1487.995) * (-1488.322) [-1487.829] (-1488.797) (-1489.834) -- 0:00:37
      421000 -- (-1486.668) (-1489.032) (-1491.554) [-1489.059] * [-1488.649] (-1488.173) (-1488.742) (-1492.670) -- 0:00:37
      421500 -- (-1487.083) (-1488.634) [-1490.547] (-1488.458) * (-1487.561) [-1486.947] (-1487.825) (-1491.093) -- 0:00:37
      422000 -- (-1486.890) (-1489.889) (-1495.605) [-1489.712] * (-1487.039) (-1487.589) [-1488.616] (-1490.890) -- 0:00:36
      422500 -- (-1488.614) (-1489.827) (-1491.153) [-1490.360] * (-1489.007) (-1487.656) (-1491.173) [-1494.501] -- 0:00:36
      423000 -- (-1487.873) (-1494.301) [-1494.175] (-1488.269) * (-1487.592) (-1489.232) (-1489.762) [-1486.958] -- 0:00:36
      423500 -- (-1489.146) [-1488.278] (-1491.018) (-1489.962) * [-1487.538] (-1491.860) (-1490.044) (-1489.635) -- 0:00:36
      424000 -- (-1493.969) [-1487.220] (-1492.842) (-1491.066) * (-1487.694) [-1489.164] (-1492.840) (-1487.458) -- 0:00:36
      424500 -- [-1490.697] (-1487.799) (-1488.884) (-1487.633) * (-1490.228) [-1488.406] (-1492.409) (-1490.949) -- 0:00:36
      425000 -- (-1487.607) [-1491.426] (-1492.521) (-1488.340) * [-1494.283] (-1488.045) (-1491.147) (-1492.570) -- 0:00:36

      Average standard deviation of split frequencies: 0.011912

      425500 -- [-1488.366] (-1492.149) (-1489.352) (-1489.320) * [-1487.674] (-1491.328) (-1487.998) (-1491.001) -- 0:00:36
      426000 -- (-1492.312) [-1488.870] (-1487.795) (-1488.605) * [-1488.214] (-1490.898) (-1488.060) (-1488.037) -- 0:00:36
      426500 -- (-1490.830) [-1490.430] (-1487.632) (-1487.015) * [-1488.110] (-1491.402) (-1488.243) (-1488.980) -- 0:00:36
      427000 -- (-1491.195) (-1490.122) (-1493.228) [-1486.728] * (-1487.881) (-1489.257) [-1488.102] (-1492.064) -- 0:00:36
      427500 -- (-1492.650) (-1493.434) [-1495.489] (-1487.528) * (-1487.902) (-1489.738) (-1486.951) [-1488.750] -- 0:00:36
      428000 -- (-1493.105) (-1489.404) (-1490.173) [-1491.271] * (-1488.342) [-1488.331] (-1487.111) (-1495.781) -- 0:00:36
      428500 -- [-1492.839] (-1487.635) (-1488.247) (-1486.425) * [-1488.669] (-1490.506) (-1487.625) (-1497.130) -- 0:00:36
      429000 -- [-1488.927] (-1491.143) (-1487.724) (-1489.352) * (-1490.427) (-1489.869) [-1492.153] (-1491.656) -- 0:00:35
      429500 -- (-1488.697) (-1488.517) (-1489.201) [-1487.771] * (-1488.183) (-1489.621) (-1495.637) [-1490.932] -- 0:00:35
      430000 -- [-1487.625] (-1487.474) (-1494.028) (-1487.621) * (-1489.629) [-1489.911] (-1491.559) (-1490.852) -- 0:00:35

      Average standard deviation of split frequencies: 0.012362

      430500 -- (-1488.097) (-1486.868) (-1496.517) [-1487.740] * [-1490.081] (-1491.368) (-1489.478) (-1489.039) -- 0:00:35
      431000 -- (-1490.074) (-1489.640) (-1490.821) [-1487.400] * (-1491.608) [-1488.386] (-1490.565) (-1488.071) -- 0:00:35
      431500 -- (-1490.820) (-1488.895) (-1486.991) [-1487.421] * (-1489.480) [-1487.053] (-1490.910) (-1487.446) -- 0:00:36
      432000 -- [-1489.188] (-1489.201) (-1486.658) (-1490.309) * (-1490.094) (-1487.053) (-1490.272) [-1487.653] -- 0:00:36
      432500 -- (-1488.014) (-1488.230) [-1488.480] (-1490.540) * (-1488.116) [-1487.065] (-1490.313) (-1489.915) -- 0:00:36
      433000 -- (-1489.733) (-1489.529) [-1494.298] (-1490.528) * [-1491.031] (-1487.148) (-1487.743) (-1487.976) -- 0:00:36
      433500 -- (-1490.688) (-1491.158) (-1488.828) [-1488.910] * (-1491.069) (-1488.477) (-1487.365) [-1489.094] -- 0:00:36
      434000 -- (-1489.277) [-1488.467] (-1488.540) (-1492.156) * (-1490.542) (-1488.537) [-1490.367] (-1487.570) -- 0:00:36
      434500 -- (-1487.573) (-1489.242) (-1494.913) [-1491.813] * [-1489.564] (-1487.981) (-1488.946) (-1490.772) -- 0:00:36
      435000 -- (-1487.147) [-1488.007] (-1494.180) (-1489.829) * (-1490.081) [-1488.852] (-1491.499) (-1489.232) -- 0:00:36

      Average standard deviation of split frequencies: 0.012211

      435500 -- (-1487.139) (-1489.256) [-1490.334] (-1489.016) * (-1487.924) (-1487.738) [-1488.987] (-1490.350) -- 0:00:36
      436000 -- [-1492.296] (-1488.118) (-1490.526) (-1490.055) * (-1488.907) (-1488.623) (-1489.127) [-1487.099] -- 0:00:36
      436500 -- [-1490.244] (-1487.016) (-1488.744) (-1487.177) * (-1487.845) (-1493.943) (-1491.087) [-1490.237] -- 0:00:36
      437000 -- (-1490.511) (-1489.042) (-1487.641) [-1490.283] * [-1487.883] (-1490.876) (-1488.813) (-1488.329) -- 0:00:36
      437500 -- (-1489.262) (-1487.434) (-1488.047) [-1488.505] * (-1487.529) (-1488.851) (-1489.426) [-1486.988] -- 0:00:36
      438000 -- (-1489.392) (-1486.812) (-1487.331) [-1488.407] * (-1487.202) (-1490.013) [-1488.400] (-1486.988) -- 0:00:35
      438500 -- (-1488.292) [-1488.499] (-1487.240) (-1491.366) * [-1493.818] (-1490.901) (-1487.881) (-1487.222) -- 0:00:35
      439000 -- [-1488.719] (-1491.830) (-1486.845) (-1489.254) * (-1491.452) (-1489.270) [-1489.085] (-1486.781) -- 0:00:35
      439500 -- [-1488.589] (-1487.091) (-1487.264) (-1490.120) * (-1490.074) (-1490.281) [-1487.198] (-1490.276) -- 0:00:35
      440000 -- (-1490.813) (-1487.293) [-1490.537] (-1488.032) * (-1487.755) (-1488.562) [-1488.182] (-1489.476) -- 0:00:35

      Average standard deviation of split frequencies: 0.011516

      440500 -- [-1488.337] (-1487.979) (-1490.095) (-1486.970) * (-1488.513) (-1487.511) [-1493.626] (-1489.860) -- 0:00:35
      441000 -- (-1487.523) (-1488.624) (-1487.125) [-1487.232] * (-1491.653) (-1492.186) (-1492.923) [-1487.655] -- 0:00:35
      441500 -- (-1488.336) (-1489.685) (-1487.821) [-1487.988] * [-1487.551] (-1492.221) (-1488.027) (-1487.131) -- 0:00:35
      442000 -- [-1489.078] (-1488.328) (-1488.451) (-1486.877) * [-1488.042] (-1493.864) (-1488.040) (-1489.743) -- 0:00:35
      442500 -- (-1490.188) [-1488.063] (-1487.882) (-1487.793) * [-1487.389] (-1488.702) (-1488.503) (-1489.352) -- 0:00:35
      443000 -- (-1488.371) (-1487.504) [-1487.914] (-1487.067) * (-1486.950) (-1489.184) [-1487.694] (-1492.325) -- 0:00:35
      443500 -- (-1487.597) [-1488.365] (-1487.822) (-1489.943) * (-1487.445) [-1488.093] (-1487.648) (-1488.862) -- 0:00:35
      444000 -- (-1489.768) [-1487.957] (-1487.814) (-1487.488) * [-1486.940] (-1488.589) (-1487.584) (-1487.261) -- 0:00:35
      444500 -- [-1487.804] (-1489.643) (-1487.541) (-1492.104) * [-1487.854] (-1488.400) (-1487.573) (-1489.765) -- 0:00:34
      445000 -- [-1487.990] (-1489.375) (-1489.298) (-1490.397) * (-1487.883) (-1488.172) [-1490.450] (-1489.220) -- 0:00:34

      Average standard deviation of split frequencies: 0.010570

      445500 -- (-1490.351) (-1488.118) (-1491.046) [-1489.298] * (-1488.857) [-1488.868] (-1488.220) (-1491.637) -- 0:00:36
      446000 -- [-1487.031] (-1491.314) (-1492.461) (-1488.172) * (-1488.029) (-1491.852) [-1488.666] (-1491.428) -- 0:00:36
      446500 -- (-1487.048) (-1489.476) (-1491.371) [-1489.017] * (-1489.001) [-1492.235] (-1489.210) (-1490.678) -- 0:00:35
      447000 -- (-1492.412) (-1489.560) [-1490.644] (-1487.082) * (-1489.845) (-1492.557) (-1491.937) [-1490.360] -- 0:00:35
      447500 -- (-1490.870) (-1489.271) [-1488.900] (-1487.346) * (-1490.673) (-1490.296) (-1488.642) [-1489.005] -- 0:00:35
      448000 -- (-1490.952) (-1486.960) [-1489.144] (-1487.603) * (-1493.898) (-1488.163) [-1487.941] (-1489.901) -- 0:00:35
      448500 -- (-1489.308) (-1488.393) [-1488.654] (-1488.504) * (-1495.245) (-1489.934) [-1488.162] (-1488.219) -- 0:00:35
      449000 -- (-1493.389) (-1490.216) (-1490.363) [-1488.203] * (-1493.328) (-1495.594) [-1487.269] (-1489.098) -- 0:00:35
      449500 -- (-1489.472) (-1486.872) [-1490.525] (-1488.542) * (-1487.283) (-1490.831) (-1490.477) [-1487.804] -- 0:00:35
      450000 -- [-1488.396] (-1492.444) (-1487.845) (-1491.116) * (-1486.889) (-1491.237) [-1489.463] (-1487.737) -- 0:00:35

      Average standard deviation of split frequencies: 0.010460

      450500 -- (-1488.916) [-1488.095] (-1487.601) (-1490.931) * (-1488.463) (-1488.832) [-1489.635] (-1487.821) -- 0:00:35
      451000 -- (-1488.566) (-1487.199) (-1489.440) [-1489.228] * (-1487.073) [-1489.743] (-1488.383) (-1494.504) -- 0:00:35
      451500 -- (-1487.805) [-1487.389] (-1488.297) (-1490.816) * [-1487.738] (-1489.326) (-1487.450) (-1488.014) -- 0:00:35
      452000 -- (-1499.314) [-1487.350] (-1493.797) (-1491.942) * (-1488.609) (-1487.792) (-1488.384) [-1489.493] -- 0:00:35
      452500 -- (-1491.090) [-1487.377] (-1489.895) (-1492.941) * (-1487.506) [-1489.434] (-1488.039) (-1490.661) -- 0:00:35
      453000 -- (-1492.456) (-1490.633) [-1491.052] (-1489.796) * [-1487.840] (-1489.713) (-1487.917) (-1492.019) -- 0:00:35
      453500 -- (-1488.223) (-1490.837) [-1491.001] (-1487.499) * (-1490.936) (-1489.331) (-1487.761) [-1488.095] -- 0:00:34
      454000 -- (-1489.150) [-1490.808] (-1489.717) (-1486.833) * (-1491.064) (-1492.766) [-1488.744] (-1488.975) -- 0:00:34
      454500 -- (-1490.253) [-1492.249] (-1491.655) (-1487.585) * (-1492.293) (-1487.693) [-1488.830] (-1489.779) -- 0:00:34
      455000 -- [-1488.942] (-1494.906) (-1487.215) (-1487.467) * (-1493.594) (-1489.686) [-1488.452] (-1488.177) -- 0:00:34

      Average standard deviation of split frequencies: 0.010155

      455500 -- (-1490.347) (-1493.249) [-1487.539] (-1487.827) * (-1496.275) (-1487.815) (-1487.797) [-1487.068] -- 0:00:34
      456000 -- (-1488.087) (-1489.340) (-1487.278) [-1487.570] * (-1492.109) (-1488.963) (-1489.557) [-1487.041] -- 0:00:34
      456500 -- (-1487.502) (-1487.884) (-1488.615) [-1487.873] * (-1491.530) (-1487.917) [-1489.581] (-1487.685) -- 0:00:34
      457000 -- [-1487.492] (-1488.588) (-1491.257) (-1487.580) * (-1491.510) [-1488.440] (-1488.008) (-1489.167) -- 0:00:34
      457500 -- (-1495.475) (-1489.711) [-1491.878] (-1487.531) * [-1491.451] (-1487.541) (-1487.625) (-1489.140) -- 0:00:34
      458000 -- (-1489.099) (-1489.727) (-1488.144) [-1487.617] * (-1490.194) (-1490.066) (-1489.222) [-1489.750] -- 0:00:34
      458500 -- (-1489.792) [-1489.153] (-1488.058) (-1491.852) * [-1488.877] (-1488.404) (-1487.254) (-1489.383) -- 0:00:34
      459000 -- (-1489.336) (-1491.735) [-1490.040] (-1492.378) * (-1488.280) [-1488.431] (-1488.345) (-1491.864) -- 0:00:34
      459500 -- [-1490.220] (-1491.393) (-1487.431) (-1490.424) * (-1491.610) (-1488.264) (-1487.796) [-1491.915] -- 0:00:34
      460000 -- (-1490.157) (-1494.153) (-1487.392) [-1487.430] * [-1490.279] (-1490.867) (-1494.795) (-1488.832) -- 0:00:34

      Average standard deviation of split frequencies: 0.009932

      460500 -- (-1488.456) (-1491.070) [-1489.154] (-1487.602) * (-1488.842) (-1490.413) (-1487.303) [-1487.774] -- 0:00:33
      461000 -- (-1490.361) (-1489.294) [-1490.252] (-1486.986) * (-1488.311) (-1487.241) (-1491.223) [-1489.784] -- 0:00:35
      461500 -- (-1488.566) (-1489.399) (-1489.680) [-1487.520] * (-1491.284) (-1487.127) [-1488.705] (-1489.884) -- 0:00:35
      462000 -- [-1490.780] (-1492.492) (-1491.180) (-1488.527) * [-1492.028] (-1489.474) (-1488.327) (-1490.259) -- 0:00:34
      462500 -- [-1487.929] (-1488.342) (-1486.741) (-1487.524) * [-1488.714] (-1489.623) (-1489.668) (-1488.095) -- 0:00:34
      463000 -- (-1488.377) (-1488.538) [-1486.741] (-1488.227) * (-1486.725) (-1491.881) [-1488.278] (-1489.503) -- 0:00:34
      463500 -- (-1488.635) (-1490.332) (-1488.358) [-1488.400] * (-1487.503) [-1491.412] (-1487.644) (-1489.686) -- 0:00:34
      464000 -- (-1489.432) [-1490.148] (-1487.494) (-1487.231) * (-1489.549) (-1487.149) (-1489.934) [-1488.355] -- 0:00:3