--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:10:15 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/11res/pyrF/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1127.90 -1130.90 2 -1127.90 -1133.60 -------------------------------------- TOTAL -1127.90 -1132.97 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892315 0.090763 0.338523 1.462625 0.857147 1501.00 1501.00 1.000 r(A<->C){all} 0.161534 0.017945 0.000014 0.432302 0.127854 158.88 228.67 1.000 r(A<->G){all} 0.164906 0.019657 0.000042 0.441750 0.128503 303.15 304.46 1.005 r(A<->T){all} 0.171679 0.021178 0.000046 0.477148 0.133492 237.92 260.59 1.001 r(C<->G){all} 0.169574 0.019557 0.000006 0.450095 0.133284 143.76 165.48 1.003 r(C<->T){all} 0.163301 0.018643 0.000010 0.440417 0.127785 215.83 226.06 1.000 r(G<->T){all} 0.169007 0.019125 0.000128 0.431895 0.134953 181.14 259.36 1.005 pi(A){all} 0.139637 0.000145 0.114057 0.160937 0.139410 1234.58 1262.37 1.000 pi(C){all} 0.276276 0.000232 0.247707 0.306626 0.276297 1355.82 1428.41 1.001 pi(G){all} 0.363857 0.000276 0.333922 0.397646 0.363939 1180.51 1241.48 1.000 pi(T){all} 0.220231 0.000202 0.193825 0.248410 0.219892 1301.16 1341.97 1.000 alpha{1,2} 0.435810 0.240904 0.000102 1.447920 0.265709 1227.97 1332.26 1.000 alpha{3} 0.462462 0.258585 0.000127 1.498656 0.299230 1292.63 1356.49 1.000 pinvar{all} 0.998222 0.000005 0.994287 0.999998 0.998914 1259.05 1279.48 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1092.610704 Model 2: PositiveSelection -1092.610562 Model 0: one-ratio -1092.610779 Model 7: beta -1092.610562 Model 8: beta&w>1 -1092.610562 Model 0 vs 1 1.5000000030340743E-4 Model 2 vs 1 2.839999997377163E-4 Model 8 vs 7 0.0
>C1 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C2 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C3 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C4 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C5 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C6 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=282 C1 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C2 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C3 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C4 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C5 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C6 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE ************************************************** C1 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C2 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C3 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C4 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C5 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C6 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG ************************************************** C1 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C2 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C3 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C4 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C5 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C6 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA ************************************************** C1 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C2 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C3 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C4 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C5 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C6 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV ************************************************** C1 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C2 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C3 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C4 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C5 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C6 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA ************************************************** C1 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C2 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C3 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C4 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C5 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C6 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV ******************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] Relaxation Summary: [8460]--->[8460] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.492 Mb, Max= 30.830 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C2 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C3 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C4 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C5 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE C6 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE ************************************************** C1 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C2 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C3 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C4 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C5 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG C6 AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG ************************************************** C1 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C2 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C3 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C4 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C5 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA C6 STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA ************************************************** C1 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C2 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C3 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C4 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C5 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV C6 STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV ************************************************** C1 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C2 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C3 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C4 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C5 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA C6 GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA ************************************************** C1 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C2 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C3 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C4 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C5 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV C6 VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV ******************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA C2 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA C3 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA C4 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA C5 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA C6 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA ************************************************** C1 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT C2 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT C3 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT C4 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT C5 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT C6 GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT ************************************************** C1 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG C2 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG C3 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG C4 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG C5 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG C6 TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG ************************************************** C1 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC C2 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC C3 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC C4 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC C5 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC C6 GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC ************************************************** C1 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC C2 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC C3 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC C4 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC C5 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC C6 CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC ************************************************** C1 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG C2 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG C3 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG C4 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG C5 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG C6 GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG ************************************************** C1 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC C2 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC C3 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC C4 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC C5 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC C6 TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC ************************************************** C1 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC C2 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC C3 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC C4 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC C5 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC C6 CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC ************************************************** C1 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA C2 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA C3 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA C4 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA C5 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA C6 CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA ************************************************** C1 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG C2 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG C3 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG C4 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG C5 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG C6 TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG ************************************************** C1 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG C2 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG C3 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG C4 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG C5 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG C6 TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG ************************************************** C1 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT C2 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT C3 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT C4 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT C5 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT C6 AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT ************************************************** C1 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT C2 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT C3 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT C4 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT C5 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT C6 GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT ************************************************** C1 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG C2 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG C3 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG C4 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG C5 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG C6 GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG ************************************************** C1 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG C2 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG C3 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG C4 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG C5 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG C6 AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG ************************************************** C1 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC C2 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC C3 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC C4 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC C5 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC C6 GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC ************************************************** C1 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT C2 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT C3 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT C4 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT C5 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT C6 AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT ********************************************** >C1 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C2 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C3 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C4 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C5 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C6 ATGACCGGTTTTGGCGCTCGGCTGGTCGAGGCGACGTCACGCCGCGGGCA GCTGTGTTTGGGTATAGACCCGCATCCTGAGTTGCTGCGCGCATGGGACT TGCCGACTACCGCGGACGGGCTGGCTGCGTTCTGCGACATCTGTGTGGAG GCGTTTTCCGGTTTCGCCATAGTCAAACCACAGGTGGCGTTTTTTGAAGC CTACGGCGCTGCCGGCTTCGCGGTGCTGGAGTATACCATCGCCGCGTTGC GGTCTGTCGGCGTACTGGTGTTGGCTGACGCCAAACGAGGGGATATCGGG TCGACGATGGCGGCCTACGCTGCTGCTTGGGCAGGCAATTCGCCGTTGGC CGCCGACGCGGTGACGGCCTCGCCGTATCTTGGGTTCGGCTCGTTGCGGC CGCTACTAGAAGTAGCCGCGGCACACGACCGGGGCGTGTTCGTGCTAGCA TCAACGTCCAACCTTGAGGGTGCCACCGTCCAGCGCGCCACGTTTGACGG TCGCATAGTAGCTCAACTGATTGTTGACCAGGCGGCTTTCGTCAACAGAG AAATGAACCGGTCCTTCCATCGGTCTGAGCCGGGGTGCTTGGGATATGTT GGAGTAGTCGTAGGCGCAACGGTTTTCGGGGCGCCGGATGTCAGCGCGCT GGGTGGACCGGTGTTGGTGCCCGGAGTGGGGGCGCAGGGTGGACACCCCG AGGCGCTCGGCGGCCTGGGTGGGGCGGCGCCAGGTCAGCTGTTGCCTGCG GTGTCACGTGCAGTGTTGCGCGCCGGCCCCGGTGTTTCAGAGCTGCGAGC AGCTGGCGAACAGATGCGTGATGCAGTCGCCTATCTCGCTGCTGTT >C1 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C2 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C3 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C4 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C5 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV >C6 MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVE AFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIG STMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLA STSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYV GVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPA VSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 846 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788523 Setting output file names to "/data/11res/pyrF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1613541046 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0094057365 Seed = 712062545 Swapseed = 1579788523 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1893.388550 -- -24.965149 Chain 2 -- -1893.388439 -- -24.965149 Chain 3 -- -1893.388439 -- -24.965149 Chain 4 -- -1893.388262 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1893.388262 -- -24.965149 Chain 2 -- -1893.388550 -- -24.965149 Chain 3 -- -1893.388439 -- -24.965149 Chain 4 -- -1893.388439 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1893.389] (-1893.388) (-1893.388) (-1893.388) * [-1893.388] (-1893.389) (-1893.388) (-1893.388) 500 -- [-1147.689] (-1174.321) (-1137.828) (-1161.334) * (-1162.766) (-1189.333) [-1150.142] (-1147.713) -- 0:00:00 1000 -- (-1140.843) (-1151.729) (-1137.670) [-1152.562] * [-1148.540] (-1147.458) (-1138.770) (-1144.202) -- 0:00:00 1500 -- [-1132.513] (-1145.551) (-1138.356) (-1134.118) * (-1138.022) [-1136.520] (-1135.783) (-1139.832) -- 0:00:00 2000 -- (-1141.581) (-1139.080) (-1139.809) [-1131.461] * (-1145.071) [-1134.501] (-1143.585) (-1137.387) -- 0:00:00 2500 -- (-1134.993) (-1137.556) (-1138.045) [-1138.167] * (-1135.616) [-1132.095] (-1143.179) (-1134.157) -- 0:00:00 3000 -- (-1146.578) (-1139.921) (-1134.420) [-1139.221] * (-1133.736) [-1133.059] (-1136.140) (-1141.197) -- 0:00:00 3500 -- (-1141.093) (-1136.490) (-1136.274) [-1137.098] * [-1145.691] (-1143.830) (-1136.074) (-1139.241) -- 0:00:00 4000 -- [-1140.102] (-1144.688) (-1136.698) (-1137.823) * [-1144.940] (-1137.627) (-1140.815) (-1135.602) -- 0:00:00 4500 -- (-1136.241) (-1141.150) [-1139.831] (-1143.052) * (-1140.664) [-1139.221] (-1138.860) (-1133.291) -- 0:00:00 5000 -- (-1134.957) (-1143.834) [-1135.220] (-1135.226) * (-1131.674) (-1140.424) [-1140.463] (-1133.454) -- 0:00:00 Average standard deviation of split frequencies: 0.098209 5500 -- [-1140.170] (-1132.917) (-1139.121) (-1132.629) * (-1139.738) (-1151.867) [-1135.550] (-1139.108) -- 0:00:00 6000 -- [-1135.007] (-1146.608) (-1136.866) (-1141.557) * (-1146.678) (-1135.434) [-1141.998] (-1139.122) -- 0:00:00 6500 -- (-1137.790) (-1142.434) [-1137.043] (-1139.223) * (-1137.691) (-1136.628) [-1140.244] (-1141.883) -- 0:00:00 7000 -- (-1140.756) (-1141.539) [-1135.472] (-1134.369) * (-1145.263) [-1137.818] (-1137.677) (-1133.718) -- 0:00:00 7500 -- (-1142.349) (-1139.355) (-1140.497) [-1129.726] * (-1141.238) (-1139.628) (-1136.099) [-1136.260] -- 0:00:00 8000 -- (-1134.537) [-1139.583] (-1137.556) (-1129.555) * (-1137.757) (-1139.568) [-1138.012] (-1138.265) -- 0:00:00 8500 -- (-1143.404) [-1132.411] (-1136.730) (-1130.474) * (-1141.418) [-1137.844] (-1134.796) (-1137.294) -- 0:00:00 9000 -- (-1136.316) (-1132.692) [-1136.791] (-1129.158) * (-1137.066) [-1133.271] (-1140.825) (-1148.129) -- 0:00:00 9500 -- (-1137.181) (-1138.492) (-1137.244) [-1127.386] * [-1132.893] (-1137.945) (-1143.155) (-1133.283) -- 0:00:00 10000 -- (-1146.589) (-1136.886) (-1139.991) [-1127.981] * (-1137.750) (-1138.917) (-1140.709) [-1136.779] -- 0:00:00 Average standard deviation of split frequencies: 0.076758 10500 -- (-1135.745) (-1139.341) (-1139.600) [-1130.611] * (-1146.539) [-1136.501] (-1142.528) (-1137.710) -- 0:00:00 11000 -- (-1139.302) (-1140.510) (-1133.274) [-1129.748] * [-1138.242] (-1137.224) (-1140.019) (-1134.214) -- 0:00:00 11500 -- [-1137.232] (-1137.360) (-1138.504) (-1130.131) * (-1135.709) (-1143.229) (-1142.034) [-1135.657] -- 0:00:00 12000 -- (-1139.036) (-1139.757) (-1136.592) [-1130.328] * [-1135.040] (-1144.877) (-1135.524) (-1137.039) -- 0:00:00 12500 -- (-1141.841) [-1132.652] (-1146.501) (-1129.582) * (-1137.666) [-1140.895] (-1141.302) (-1133.023) -- 0:01:19 13000 -- (-1148.489) (-1140.768) (-1132.606) [-1128.708] * (-1136.002) (-1136.842) [-1140.039] (-1139.328) -- 0:01:15 13500 -- (-1139.426) [-1134.792] (-1138.338) (-1129.080) * (-1141.772) (-1134.789) (-1144.722) [-1139.250] -- 0:01:13 14000 -- (-1135.044) (-1143.257) [-1139.615] (-1126.981) * (-1136.048) (-1135.612) (-1145.942) [-1134.306] -- 0:01:10 14500 -- (-1136.138) [-1135.058] (-1137.775) (-1127.915) * (-1140.378) [-1135.034] (-1137.883) (-1136.828) -- 0:01:07 15000 -- (-1137.835) [-1133.059] (-1144.237) (-1132.183) * (-1142.473) [-1137.676] (-1140.022) (-1143.624) -- 0:01:05 Average standard deviation of split frequencies: 0.040921 15500 -- (-1138.657) [-1135.198] (-1140.086) (-1129.806) * (-1142.246) (-1140.837) (-1139.892) [-1140.734] -- 0:01:03 16000 -- (-1137.193) [-1134.099] (-1136.036) (-1127.911) * (-1133.901) (-1152.780) (-1135.188) [-1140.691] -- 0:01:01 16500 -- (-1137.906) [-1143.539] (-1148.762) (-1128.683) * [-1129.004] (-1136.272) (-1141.641) (-1136.547) -- 0:00:59 17000 -- (-1151.757) (-1141.319) (-1135.358) [-1127.971] * (-1129.698) (-1135.528) (-1137.963) [-1137.544] -- 0:00:57 17500 -- (-1141.382) [-1132.522] (-1139.717) (-1128.581) * (-1127.856) (-1146.456) [-1136.177] (-1143.664) -- 0:00:56 18000 -- (-1135.310) (-1144.934) (-1138.658) [-1129.358] * (-1127.678) (-1138.527) [-1136.652] (-1141.155) -- 0:00:54 18500 -- (-1138.175) [-1136.512] (-1133.514) (-1129.442) * (-1130.100) [-1142.081] (-1137.600) (-1126.832) -- 0:00:53 19000 -- (-1134.926) (-1146.169) [-1138.420] (-1128.188) * (-1130.834) (-1135.975) (-1134.240) [-1135.353] -- 0:00:51 19500 -- [-1136.351] (-1136.271) (-1141.205) (-1127.990) * (-1132.336) (-1141.275) (-1137.253) [-1128.101] -- 0:00:50 20000 -- (-1144.628) (-1142.560) (-1150.936) [-1127.356] * [-1128.889] (-1141.016) (-1137.583) (-1127.854) -- 0:00:49 Average standard deviation of split frequencies: 0.043339 20500 -- (-1139.687) [-1137.016] (-1146.152) (-1128.391) * (-1126.671) (-1137.276) (-1148.976) [-1129.561] -- 0:00:47 21000 -- (-1135.218) (-1141.406) (-1138.393) [-1127.420] * (-1126.965) [-1136.447] (-1133.101) (-1129.982) -- 0:00:46 21500 -- (-1144.313) (-1145.972) (-1140.595) [-1127.360] * (-1126.663) [-1129.813] (-1130.590) (-1128.517) -- 0:00:45 22000 -- [-1134.662] (-1136.777) (-1131.853) (-1126.982) * (-1126.535) [-1128.015] (-1130.108) (-1134.938) -- 0:00:44 22500 -- (-1142.864) [-1134.002] (-1130.218) (-1126.579) * [-1127.420] (-1127.884) (-1129.684) (-1127.969) -- 0:00:43 23000 -- (-1134.736) (-1135.180) (-1130.881) [-1126.494] * (-1131.075) (-1129.077) [-1133.060] (-1132.971) -- 0:00:42 23500 -- (-1138.721) (-1137.007) [-1129.080] (-1127.226) * (-1127.140) (-1130.511) (-1128.846) [-1127.148] -- 0:00:41 24000 -- (-1153.483) (-1141.717) [-1129.378] (-1128.284) * (-1126.714) (-1130.758) (-1129.625) [-1127.715] -- 0:00:40 24500 -- (-1136.011) (-1136.067) [-1129.545] (-1127.038) * (-1126.705) (-1127.431) (-1127.367) [-1127.175] -- 0:00:39 25000 -- (-1129.416) (-1143.133) [-1128.899] (-1127.657) * [-1126.852] (-1131.816) (-1128.118) (-1128.498) -- 0:00:39 Average standard deviation of split frequencies: 0.040383 25500 -- (-1128.169) [-1134.398] (-1128.382) (-1128.596) * (-1126.651) (-1129.362) (-1128.935) [-1129.214] -- 0:00:38 26000 -- [-1127.316] (-1143.965) (-1127.390) (-1127.891) * (-1128.476) [-1129.310] (-1127.752) (-1126.913) -- 0:00:37 26500 -- [-1127.323] (-1154.268) (-1128.090) (-1127.638) * [-1127.734] (-1129.868) (-1130.184) (-1129.292) -- 0:00:36 27000 -- (-1127.312) (-1134.935) [-1129.152] (-1126.678) * (-1128.334) (-1129.749) [-1131.012] (-1128.009) -- 0:00:36 27500 -- (-1127.200) [-1132.789] (-1130.887) (-1127.605) * (-1128.495) (-1129.799) (-1127.067) [-1129.467] -- 0:00:35 28000 -- (-1127.578) (-1134.943) [-1130.387] (-1127.589) * (-1128.109) (-1130.092) (-1127.097) [-1126.921] -- 0:00:34 28500 -- (-1127.966) (-1139.574) (-1130.513) [-1131.120] * (-1127.683) [-1128.291] (-1127.918) (-1129.445) -- 0:01:08 29000 -- (-1129.662) (-1134.142) [-1130.639] (-1128.903) * (-1129.310) (-1131.287) [-1129.180] (-1131.466) -- 0:01:06 29500 -- [-1128.788] (-1140.166) (-1130.071) (-1128.259) * [-1130.246] (-1129.650) (-1131.051) (-1129.544) -- 0:01:05 30000 -- (-1128.589) (-1139.797) [-1129.119] (-1128.480) * [-1129.804] (-1130.205) (-1129.056) (-1130.441) -- 0:01:04 Average standard deviation of split frequencies: 0.039967 30500 -- (-1128.108) (-1134.629) (-1130.176) [-1128.420] * (-1129.361) [-1126.790] (-1126.962) (-1132.229) -- 0:01:03 31000 -- [-1128.783] (-1137.465) (-1128.582) (-1126.901) * (-1130.861) (-1132.897) [-1128.179] (-1129.888) -- 0:01:02 31500 -- (-1128.786) [-1140.704] (-1129.811) (-1127.771) * (-1126.666) [-1127.706] (-1128.102) (-1129.618) -- 0:01:01 32000 -- [-1128.416] (-1152.459) (-1130.448) (-1128.814) * (-1132.950) [-1129.065] (-1127.490) (-1133.126) -- 0:01:00 32500 -- (-1128.680) [-1144.256] (-1129.425) (-1128.352) * (-1127.031) (-1128.098) (-1127.481) [-1132.137] -- 0:00:59 33000 -- (-1129.648) (-1140.766) [-1128.281] (-1127.794) * (-1126.794) (-1128.599) (-1127.586) [-1129.931] -- 0:00:58 33500 -- [-1131.520] (-1137.779) (-1128.451) (-1127.544) * (-1127.779) (-1129.508) [-1129.246] (-1135.323) -- 0:00:57 34000 -- [-1131.581] (-1140.187) (-1129.588) (-1127.544) * [-1127.189] (-1127.661) (-1129.127) (-1133.942) -- 0:00:56 34500 -- (-1131.526) (-1140.006) (-1127.270) [-1130.969] * (-1127.591) [-1127.836] (-1127.991) (-1128.377) -- 0:00:55 35000 -- (-1127.651) (-1140.428) (-1130.244) [-1130.797] * (-1126.837) (-1129.070) (-1132.764) [-1127.643] -- 0:00:55 Average standard deviation of split frequencies: 0.039284 35500 -- (-1127.743) (-1142.300) (-1128.634) [-1129.054] * (-1127.146) (-1129.112) [-1128.063] (-1127.428) -- 0:00:54 36000 -- (-1128.181) (-1141.770) [-1132.320] (-1129.783) * (-1127.556) [-1129.060] (-1129.261) (-1127.580) -- 0:00:53 36500 -- (-1126.641) (-1128.343) [-1132.372] (-1130.430) * [-1127.314] (-1128.378) (-1130.472) (-1128.564) -- 0:00:52 37000 -- [-1128.159] (-1128.185) (-1128.911) (-1129.028) * (-1127.312) (-1127.828) [-1126.304] (-1130.582) -- 0:00:52 37500 -- (-1128.349) [-1128.220] (-1127.773) (-1131.240) * (-1127.454) (-1129.122) (-1131.062) [-1128.177] -- 0:00:51 38000 -- (-1127.358) (-1128.162) (-1128.920) [-1129.279] * [-1126.751] (-1129.932) (-1127.588) (-1130.575) -- 0:00:50 38500 -- [-1129.083] (-1130.093) (-1128.242) (-1129.647) * (-1127.034) [-1131.330] (-1130.771) (-1129.347) -- 0:00:49 39000 -- [-1128.647] (-1129.139) (-1131.273) (-1130.874) * [-1127.362] (-1133.229) (-1134.801) (-1129.709) -- 0:00:49 39500 -- (-1129.822) (-1126.771) (-1128.805) [-1129.461] * (-1127.365) (-1130.279) (-1131.845) [-1127.507] -- 0:00:48 40000 -- (-1127.345) (-1129.380) [-1126.812] (-1128.754) * (-1127.638) (-1129.883) (-1126.259) [-1127.605] -- 0:00:48 Average standard deviation of split frequencies: 0.041952 40500 -- (-1129.971) (-1129.083) [-1127.942] (-1130.247) * [-1128.044] (-1128.488) (-1127.672) (-1128.782) -- 0:00:47 41000 -- (-1129.925) [-1127.340] (-1129.173) (-1130.620) * (-1129.369) (-1129.010) [-1130.128] (-1129.809) -- 0:00:46 41500 -- (-1129.636) (-1130.719) [-1129.191] (-1129.768) * (-1128.449) (-1131.218) (-1131.396) [-1129.864] -- 0:00:46 42000 -- (-1127.941) (-1129.124) [-1129.767] (-1131.070) * [-1128.410] (-1136.106) (-1130.338) (-1128.079) -- 0:00:45 42500 -- (-1127.979) (-1128.733) (-1128.567) [-1127.575] * [-1126.887] (-1127.470) (-1128.044) (-1127.765) -- 0:00:45 43000 -- (-1130.176) (-1128.649) [-1131.216] (-1128.274) * (-1129.159) (-1127.955) (-1127.281) [-1126.599] -- 0:00:44 43500 -- (-1130.262) (-1126.754) (-1130.774) [-1127.802] * (-1132.701) [-1128.111] (-1129.005) (-1128.046) -- 0:00:43 44000 -- [-1129.919] (-1127.738) (-1128.474) (-1129.403) * [-1130.141] (-1132.462) (-1127.495) (-1127.620) -- 0:00:43 44500 -- (-1128.079) (-1126.383) [-1126.831] (-1131.844) * [-1132.459] (-1128.974) (-1128.328) (-1127.381) -- 0:00:42 45000 -- (-1129.400) [-1127.776] (-1128.283) (-1129.878) * (-1129.164) (-1130.824) [-1127.302] (-1126.903) -- 0:01:03 Average standard deviation of split frequencies: 0.041480 45500 -- (-1128.501) (-1130.037) [-1127.832] (-1129.829) * (-1131.488) (-1130.657) (-1127.683) [-1127.268] -- 0:01:02 46000 -- [-1129.878] (-1128.069) (-1127.408) (-1130.867) * (-1130.101) [-1129.162] (-1126.302) (-1128.638) -- 0:01:02 46500 -- (-1129.214) (-1128.247) [-1131.006] (-1129.937) * (-1130.422) (-1126.665) (-1129.508) [-1132.966] -- 0:01:01 47000 -- (-1127.682) (-1129.066) (-1134.784) [-1127.658] * [-1133.167] (-1126.363) (-1131.185) (-1131.182) -- 0:01:00 47500 -- (-1128.727) (-1133.038) (-1135.060) [-1130.283] * [-1129.702] (-1128.958) (-1132.299) (-1132.380) -- 0:01:00 48000 -- (-1128.708) (-1137.097) (-1132.228) [-1127.895] * (-1130.331) [-1129.286] (-1128.196) (-1128.750) -- 0:00:59 48500 -- (-1130.491) (-1133.477) (-1126.829) [-1129.721] * (-1130.153) (-1127.292) [-1131.075] (-1128.678) -- 0:00:58 49000 -- (-1130.371) [-1131.250] (-1127.150) (-1130.523) * (-1131.134) [-1129.997] (-1133.142) (-1128.678) -- 0:00:58 49500 -- [-1127.370] (-1129.031) (-1127.949) (-1130.308) * [-1127.792] (-1129.050) (-1127.105) (-1127.892) -- 0:00:57 50000 -- [-1126.737] (-1129.453) (-1129.944) (-1129.391) * (-1128.695) (-1132.989) (-1132.094) [-1127.485] -- 0:00:57 Average standard deviation of split frequencies: 0.038430 50500 -- (-1126.600) (-1127.979) (-1129.012) [-1130.529] * (-1127.858) [-1129.957] (-1131.961) (-1127.407) -- 0:00:56 51000 -- (-1127.012) (-1134.992) [-1131.026] (-1129.914) * (-1128.048) (-1130.066) (-1127.744) [-1129.834] -- 0:00:55 51500 -- (-1128.042) (-1130.167) [-1129.947] (-1127.348) * (-1127.351) [-1127.030] (-1133.965) (-1131.455) -- 0:00:55 52000 -- (-1127.395) [-1130.162] (-1130.198) (-1130.078) * [-1128.418] (-1128.047) (-1127.551) (-1128.610) -- 0:00:54 52500 -- (-1126.710) (-1128.204) [-1128.255] (-1128.877) * [-1129.066] (-1127.574) (-1127.593) (-1128.203) -- 0:00:54 53000 -- [-1126.613] (-1129.310) (-1128.179) (-1127.074) * [-1130.125] (-1126.850) (-1127.576) (-1129.243) -- 0:00:53 53500 -- [-1126.946] (-1131.115) (-1130.764) (-1127.291) * (-1128.596) (-1126.577) (-1128.832) [-1129.357] -- 0:00:53 54000 -- (-1127.427) (-1129.266) (-1131.304) [-1126.289] * (-1129.010) [-1127.552] (-1128.775) (-1131.515) -- 0:00:52 54500 -- (-1129.042) (-1131.523) (-1127.865) [-1126.286] * (-1129.053) (-1128.069) (-1128.078) [-1128.011] -- 0:00:52 55000 -- [-1128.947] (-1126.491) (-1129.972) (-1127.067) * (-1128.829) [-1129.590] (-1129.236) (-1130.159) -- 0:00:51 Average standard deviation of split frequencies: 0.032068 55500 -- [-1129.564] (-1127.256) (-1132.041) (-1127.864) * [-1134.706] (-1130.209) (-1127.022) (-1133.719) -- 0:00:51 56000 -- (-1131.043) (-1127.957) [-1130.847] (-1128.262) * (-1132.335) (-1131.256) [-1126.708] (-1129.320) -- 0:00:50 56500 -- (-1127.873) (-1127.831) (-1127.335) [-1127.422] * (-1131.711) (-1130.955) [-1126.765] (-1128.204) -- 0:00:50 57000 -- [-1129.004] (-1127.525) (-1128.676) (-1128.484) * (-1131.070) [-1128.283] (-1130.910) (-1129.070) -- 0:00:49 57500 -- [-1129.344] (-1129.837) (-1129.638) (-1130.348) * (-1128.996) [-1128.140] (-1132.290) (-1127.700) -- 0:00:49 58000 -- (-1128.796) [-1126.787] (-1133.619) (-1127.898) * (-1128.470) (-1128.642) [-1129.687] (-1126.766) -- 0:00:48 58500 -- (-1128.050) [-1127.959] (-1129.004) (-1127.458) * (-1127.228) (-1129.355) (-1127.726) [-1130.176] -- 0:00:48 59000 -- (-1127.940) (-1127.904) [-1129.273] (-1129.342) * [-1128.075] (-1128.265) (-1128.435) (-1128.796) -- 0:00:47 59500 -- [-1128.881] (-1128.213) (-1127.126) (-1127.146) * (-1129.208) (-1131.365) [-1128.094] (-1128.338) -- 0:00:47 60000 -- (-1129.047) (-1129.406) (-1127.346) [-1127.084] * (-1127.019) (-1127.800) [-1129.263] (-1128.242) -- 0:00:47 Average standard deviation of split frequencies: 0.035355 60500 -- (-1127.711) [-1129.234] (-1126.826) (-1127.219) * (-1127.450) [-1128.957] (-1129.442) (-1128.647) -- 0:00:46 61000 -- (-1130.454) [-1128.421] (-1126.233) (-1131.176) * [-1128.216] (-1128.509) (-1129.630) (-1131.611) -- 0:00:46 61500 -- (-1126.602) (-1129.229) [-1128.518] (-1132.093) * (-1131.117) (-1129.940) (-1133.543) [-1131.523] -- 0:01:01 62000 -- [-1127.592] (-1127.698) (-1127.035) (-1130.248) * (-1129.219) (-1127.363) (-1131.873) [-1128.472] -- 0:01:00 62500 -- [-1129.829] (-1129.614) (-1128.489) (-1129.601) * (-1129.265) (-1128.344) (-1127.119) [-1129.570] -- 0:01:00 63000 -- (-1130.669) (-1127.736) [-1127.259] (-1126.989) * (-1129.587) [-1129.823] (-1127.899) (-1128.487) -- 0:00:59 63500 -- (-1131.212) (-1127.377) [-1127.840] (-1128.072) * (-1127.461) (-1128.995) (-1128.539) [-1136.618] -- 0:00:58 64000 -- (-1130.335) [-1127.841] (-1129.667) (-1130.846) * (-1131.609) (-1127.761) (-1128.416) [-1128.605] -- 0:00:58 64500 -- [-1130.769] (-1127.863) (-1128.810) (-1129.885) * [-1127.154] (-1127.368) (-1128.588) (-1128.074) -- 0:00:58 65000 -- (-1130.487) (-1129.654) [-1128.649] (-1127.103) * (-1131.699) (-1132.340) [-1129.970] (-1126.787) -- 0:00:57 Average standard deviation of split frequencies: 0.030611 65500 -- (-1129.847) [-1129.424] (-1128.773) (-1126.811) * (-1126.563) (-1127.223) (-1127.482) [-1128.875] -- 0:00:57 66000 -- (-1127.313) [-1129.138] (-1127.295) (-1128.344) * (-1129.845) (-1127.851) (-1129.317) [-1127.441] -- 0:00:56 66500 -- [-1128.882] (-1129.181) (-1131.338) (-1129.065) * (-1126.378) (-1127.214) [-1128.016] (-1131.850) -- 0:00:56 67000 -- (-1127.600) (-1129.407) (-1130.804) [-1127.729] * (-1129.050) [-1127.926] (-1128.766) (-1131.226) -- 0:00:55 67500 -- [-1130.953] (-1128.958) (-1133.019) (-1127.058) * [-1129.505] (-1133.396) (-1127.158) (-1133.635) -- 0:00:55 68000 -- (-1131.677) [-1128.939] (-1133.866) (-1129.150) * (-1129.056) (-1128.755) [-1127.420] (-1128.174) -- 0:00:54 68500 -- (-1131.743) (-1130.240) [-1128.611] (-1128.980) * (-1129.060) (-1128.837) [-1128.432] (-1129.208) -- 0:00:54 69000 -- (-1128.366) (-1130.608) (-1129.676) [-1126.911] * [-1128.548] (-1129.347) (-1129.282) (-1129.845) -- 0:00:53 69500 -- (-1129.954) (-1130.035) [-1129.253] (-1127.530) * (-1126.988) (-1129.445) [-1129.296] (-1127.920) -- 0:00:53 70000 -- (-1129.451) (-1130.179) [-1127.017] (-1127.971) * [-1126.988] (-1127.170) (-1130.624) (-1126.358) -- 0:00:53 Average standard deviation of split frequencies: 0.025016 70500 -- (-1127.193) [-1128.827] (-1130.219) (-1127.636) * (-1126.545) (-1133.578) (-1127.539) [-1126.358] -- 0:00:52 71000 -- [-1129.272] (-1128.500) (-1127.395) (-1130.362) * (-1126.545) (-1130.486) [-1127.354] (-1126.946) -- 0:00:52 71500 -- [-1127.811] (-1127.179) (-1126.976) (-1131.172) * (-1128.639) [-1130.200] (-1129.606) (-1129.186) -- 0:00:51 72000 -- [-1129.606] (-1128.357) (-1131.178) (-1127.706) * (-1129.029) (-1129.535) (-1131.120) [-1129.698] -- 0:00:51 72500 -- (-1129.662) [-1128.378] (-1128.660) (-1127.705) * (-1129.410) [-1128.699] (-1134.748) (-1128.538) -- 0:00:51 73000 -- [-1129.666] (-1127.663) (-1137.500) (-1127.858) * (-1129.926) (-1126.346) (-1129.267) [-1128.106] -- 0:00:50 73500 -- (-1129.577) (-1128.644) [-1127.595] (-1126.600) * (-1128.398) (-1129.717) [-1132.850] (-1129.151) -- 0:00:50 74000 -- [-1128.829] (-1129.707) (-1127.147) (-1133.250) * [-1132.141] (-1129.556) (-1128.098) (-1134.276) -- 0:00:50 74500 -- (-1128.851) [-1126.729] (-1129.251) (-1133.655) * (-1131.094) (-1129.855) (-1127.520) [-1128.060] -- 0:00:49 75000 -- (-1131.523) (-1127.478) (-1129.340) [-1128.933] * [-1127.878] (-1130.475) (-1127.276) (-1130.446) -- 0:00:49 Average standard deviation of split frequencies: 0.027292 75500 -- (-1128.780) (-1126.516) (-1128.666) [-1130.200] * (-1130.315) (-1133.675) [-1126.816] (-1129.301) -- 0:00:48 76000 -- (-1127.464) (-1127.477) [-1128.755] (-1127.689) * (-1134.703) [-1131.986] (-1128.238) (-1129.558) -- 0:00:48 76500 -- [-1129.040] (-1126.797) (-1129.953) (-1128.209) * [-1127.646] (-1129.723) (-1129.361) (-1128.506) -- 0:00:48 77000 -- (-1129.318) [-1127.541] (-1134.772) (-1128.175) * (-1128.446) [-1132.580] (-1127.494) (-1130.586) -- 0:00:47 77500 -- [-1127.162] (-1127.131) (-1127.355) (-1128.324) * (-1129.164) (-1131.520) (-1126.735) [-1128.811] -- 0:00:47 78000 -- [-1126.808] (-1127.033) (-1126.740) (-1128.779) * (-1131.315) (-1129.739) (-1131.617) [-1130.498] -- 0:00:59 78500 -- (-1131.864) (-1127.249) (-1126.806) [-1127.649] * [-1127.292] (-1128.346) (-1128.798) (-1126.708) -- 0:00:58 79000 -- (-1131.181) (-1128.061) [-1132.282] (-1130.495) * [-1127.052] (-1129.738) (-1130.936) (-1126.887) -- 0:00:58 79500 -- [-1128.119] (-1127.493) (-1130.640) (-1130.680) * (-1128.862) (-1130.956) (-1129.550) [-1127.187] -- 0:00:57 80000 -- (-1128.069) [-1128.641] (-1128.364) (-1126.463) * (-1128.626) (-1126.441) (-1130.785) [-1127.684] -- 0:00:57 Average standard deviation of split frequencies: 0.027374 80500 -- [-1127.032] (-1129.173) (-1129.617) (-1127.346) * (-1128.652) (-1126.441) (-1133.907) [-1127.100] -- 0:00:57 81000 -- (-1130.039) (-1127.109) (-1132.213) [-1128.403] * (-1129.247) (-1126.436) [-1131.505] (-1126.735) -- 0:00:56 81500 -- (-1128.992) (-1128.325) [-1128.118] (-1127.533) * (-1128.412) [-1128.841] (-1133.492) (-1126.801) -- 0:00:56 82000 -- (-1128.929) (-1128.117) (-1128.975) [-1126.867] * (-1129.070) (-1128.499) [-1127.097] (-1127.761) -- 0:00:55 82500 -- [-1127.543] (-1129.429) (-1128.180) (-1128.136) * (-1127.900) [-1127.650] (-1127.359) (-1128.179) -- 0:00:55 83000 -- (-1129.653) (-1126.922) (-1127.751) [-1129.208] * (-1127.598) (-1128.338) (-1131.911) [-1127.571] -- 0:00:55 83500 -- (-1130.968) [-1126.849] (-1130.865) (-1131.252) * (-1127.882) (-1130.941) [-1130.712] (-1127.527) -- 0:00:54 84000 -- (-1128.504) (-1128.381) [-1131.188] (-1129.937) * (-1129.845) (-1131.447) (-1131.251) [-1128.044] -- 0:00:54 84500 -- (-1127.431) (-1126.521) [-1130.841] (-1131.098) * [-1128.832] (-1129.220) (-1128.488) (-1130.982) -- 0:00:54 85000 -- [-1126.826] (-1128.930) (-1129.075) (-1131.990) * (-1128.325) [-1128.348] (-1129.199) (-1131.417) -- 0:00:53 Average standard deviation of split frequencies: 0.025489 85500 -- [-1127.974] (-1130.685) (-1129.666) (-1129.864) * (-1126.905) [-1129.012] (-1126.980) (-1127.703) -- 0:00:53 86000 -- (-1128.308) (-1128.361) [-1127.803] (-1131.110) * (-1127.353) (-1130.397) (-1126.640) [-1126.449] -- 0:00:53 86500 -- [-1130.206] (-1127.992) (-1128.103) (-1130.171) * [-1127.030] (-1129.173) (-1129.404) (-1126.681) -- 0:00:52 87000 -- [-1127.837] (-1128.915) (-1131.776) (-1129.602) * (-1127.405) (-1128.946) (-1130.010) [-1127.662] -- 0:00:52 87500 -- (-1130.740) (-1132.938) [-1129.679] (-1129.196) * (-1127.846) (-1127.116) (-1126.591) [-1126.639] -- 0:00:52 88000 -- [-1127.355] (-1127.379) (-1130.450) (-1129.617) * (-1127.469) (-1127.950) [-1127.015] (-1126.800) -- 0:00:51 88500 -- (-1127.587) (-1127.429) [-1128.717] (-1129.266) * (-1130.154) [-1127.697] (-1126.574) (-1127.588) -- 0:00:51 89000 -- (-1126.647) (-1128.163) [-1128.003] (-1128.230) * (-1127.243) (-1128.931) (-1127.190) [-1128.008] -- 0:00:51 89500 -- (-1129.489) [-1130.983] (-1128.798) (-1130.088) * (-1128.347) [-1131.033] (-1127.210) (-1129.438) -- 0:00:50 90000 -- (-1128.808) [-1132.016] (-1129.078) (-1132.292) * (-1127.728) [-1127.460] (-1127.310) (-1128.635) -- 0:00:50 Average standard deviation of split frequencies: 0.023657 90500 -- [-1128.206] (-1133.156) (-1129.230) (-1130.589) * [-1129.183] (-1128.917) (-1129.818) (-1129.473) -- 0:00:50 91000 -- (-1127.801) (-1128.978) [-1131.475] (-1131.101) * (-1126.587) (-1129.251) [-1126.645] (-1129.275) -- 0:00:49 91500 -- (-1128.008) [-1129.539] (-1129.256) (-1131.336) * [-1127.404] (-1129.036) (-1127.931) (-1129.753) -- 0:00:49 92000 -- [-1126.987] (-1129.659) (-1129.408) (-1126.759) * (-1127.581) [-1133.902] (-1129.626) (-1130.126) -- 0:00:49 92500 -- [-1137.290] (-1129.689) (-1129.331) (-1133.069) * [-1130.815] (-1128.677) (-1128.720) (-1128.780) -- 0:00:49 93000 -- (-1127.438) (-1128.096) (-1128.522) [-1127.854] * [-1130.074] (-1128.616) (-1132.781) (-1128.513) -- 0:00:48 93500 -- (-1127.437) (-1128.211) [-1128.102] (-1129.213) * [-1127.213] (-1129.706) (-1134.897) (-1126.247) -- 0:00:48 94000 -- (-1128.766) [-1126.801] (-1132.610) (-1133.630) * [-1132.378] (-1131.319) (-1128.283) (-1131.998) -- 0:00:57 94500 -- (-1132.077) (-1130.501) (-1129.250) [-1127.683] * (-1128.463) (-1128.180) (-1129.151) [-1130.778] -- 0:00:57 95000 -- (-1129.561) (-1130.209) (-1130.235) [-1128.020] * (-1131.760) (-1126.762) [-1128.312] (-1131.210) -- 0:00:57 Average standard deviation of split frequencies: 0.025289 95500 -- (-1129.306) (-1127.288) [-1128.606] (-1128.399) * (-1131.143) [-1126.721] (-1128.070) (-1130.044) -- 0:00:56 96000 -- (-1129.379) (-1127.482) (-1127.338) [-1128.384] * (-1128.781) (-1127.543) [-1126.775] (-1130.246) -- 0:00:56 96500 -- (-1129.100) (-1127.351) [-1126.653] (-1128.128) * (-1129.310) (-1127.413) (-1129.602) [-1130.274] -- 0:00:56 97000 -- (-1129.226) (-1127.260) (-1126.793) [-1129.227] * [-1130.971] (-1128.093) (-1131.201) (-1128.853) -- 0:00:55 97500 -- (-1128.144) (-1126.652) [-1127.496] (-1128.504) * (-1128.854) (-1130.827) (-1130.087) [-1128.659] -- 0:00:55 98000 -- (-1126.824) (-1128.232) (-1128.239) [-1130.174] * (-1130.312) (-1128.600) (-1126.816) [-1129.785] -- 0:00:55 98500 -- (-1129.059) [-1128.227] (-1130.433) (-1131.709) * (-1128.284) (-1127.236) (-1128.639) [-1130.218] -- 0:00:54 99000 -- (-1129.082) [-1127.754] (-1132.980) (-1128.340) * (-1127.245) (-1127.339) [-1127.236] (-1132.259) -- 0:00:54 99500 -- [-1129.108] (-1127.329) (-1132.111) (-1128.164) * (-1128.785) [-1126.501] (-1127.710) (-1126.320) -- 0:00:54 100000 -- (-1128.190) (-1127.608) (-1130.180) [-1129.569] * (-1128.923) (-1127.016) [-1128.042] (-1128.708) -- 0:00:54 Average standard deviation of split frequencies: 0.026016 100500 -- (-1128.208) [-1127.776] (-1130.458) (-1128.809) * [-1128.845] (-1128.095) (-1129.224) (-1126.392) -- 0:00:53 101000 -- [-1127.220] (-1127.944) (-1130.892) (-1130.705) * (-1130.631) (-1128.057) [-1127.274] (-1127.002) -- 0:00:53 101500 -- (-1130.093) (-1133.146) [-1127.129] (-1127.913) * (-1131.545) (-1130.339) [-1127.278] (-1127.111) -- 0:00:53 102000 -- [-1127.729] (-1127.095) (-1129.641) (-1128.116) * (-1131.493) (-1129.798) (-1130.338) [-1127.886] -- 0:00:52 102500 -- (-1126.643) (-1126.697) (-1129.530) [-1128.460] * (-1130.480) (-1128.207) [-1127.203] (-1128.195) -- 0:00:52 103000 -- [-1126.558] (-1126.938) (-1128.629) (-1129.166) * (-1129.819) (-1126.663) (-1128.794) [-1129.731] -- 0:00:52 103500 -- [-1126.660] (-1129.070) (-1129.765) (-1126.759) * (-1130.944) (-1126.926) (-1131.801) [-1126.628] -- 0:00:51 104000 -- [-1126.811] (-1126.502) (-1128.712) (-1129.227) * (-1130.438) [-1131.838] (-1127.550) (-1127.127) -- 0:00:51 104500 -- (-1127.448) (-1128.040) [-1128.929] (-1129.938) * (-1128.415) (-1127.708) [-1128.899] (-1127.127) -- 0:00:51 105000 -- [-1127.102] (-1127.259) (-1133.139) (-1130.221) * (-1127.664) (-1128.593) (-1128.913) [-1126.378] -- 0:00:51 Average standard deviation of split frequencies: 0.026472 105500 -- [-1127.862] (-1129.502) (-1130.963) (-1131.321) * (-1131.018) (-1127.183) (-1130.782) [-1126.378] -- 0:00:50 106000 -- (-1129.619) (-1130.179) [-1130.488] (-1133.079) * (-1130.657) [-1127.453] (-1129.165) (-1127.607) -- 0:00:50 106500 -- [-1129.311] (-1128.754) (-1127.265) (-1131.889) * [-1128.637] (-1129.356) (-1128.638) (-1131.276) -- 0:00:50 107000 -- (-1130.335) (-1128.761) [-1128.486] (-1130.413) * (-1128.044) (-1134.083) (-1127.402) [-1127.176] -- 0:00:50 107500 -- (-1133.043) [-1128.433] (-1126.848) (-1130.419) * (-1129.077) (-1128.683) [-1127.207] (-1128.773) -- 0:00:49 108000 -- (-1129.434) (-1130.779) [-1128.433] (-1132.317) * (-1130.017) (-1137.515) [-1128.463] (-1126.870) -- 0:00:49 108500 -- (-1126.312) (-1127.644) [-1128.330] (-1131.988) * (-1128.366) [-1128.400] (-1128.199) (-1127.505) -- 0:00:49 109000 -- (-1127.458) (-1131.278) [-1129.550] (-1131.854) * (-1126.777) (-1128.234) [-1129.208] (-1128.313) -- 0:00:49 109500 -- (-1128.563) [-1131.075] (-1129.220) (-1129.467) * [-1128.577] (-1129.506) (-1128.182) (-1127.489) -- 0:00:48 110000 -- (-1127.129) (-1131.149) [-1129.169] (-1130.055) * (-1128.476) (-1129.629) (-1129.351) [-1127.266] -- 0:00:56 Average standard deviation of split frequencies: 0.032284 110500 -- (-1127.551) (-1131.194) [-1130.836] (-1130.301) * (-1128.900) (-1131.491) (-1132.826) [-1127.010] -- 0:00:56 111000 -- (-1128.465) (-1128.214) [-1128.277] (-1128.225) * (-1127.814) (-1134.658) [-1131.997] (-1127.981) -- 0:00:56 111500 -- (-1127.930) (-1128.756) [-1130.126] (-1126.884) * [-1128.227] (-1128.381) (-1131.989) (-1128.727) -- 0:00:55 112000 -- [-1126.447] (-1129.137) (-1129.894) (-1131.149) * (-1129.636) [-1129.825] (-1128.236) (-1127.723) -- 0:00:55 112500 -- (-1126.699) (-1129.374) [-1128.148] (-1129.798) * (-1129.529) [-1129.463] (-1128.152) (-1128.125) -- 0:00:55 113000 -- (-1126.384) (-1132.178) (-1131.776) [-1128.852] * (-1128.791) (-1131.507) (-1132.071) [-1128.265] -- 0:00:54 113500 -- (-1129.444) [-1129.011] (-1128.841) (-1130.030) * (-1130.085) (-1130.232) [-1129.692] (-1129.168) -- 0:00:54 114000 -- [-1127.079] (-1129.346) (-1128.656) (-1129.838) * (-1129.075) (-1128.170) [-1128.444] (-1130.270) -- 0:00:54 114500 -- (-1127.810) [-1129.198] (-1127.672) (-1131.595) * (-1130.118) (-1127.978) [-1131.232] (-1127.982) -- 0:00:54 115000 -- (-1127.794) [-1128.572] (-1130.300) (-1132.306) * (-1126.968) (-1129.162) [-1128.897] (-1129.379) -- 0:00:53 Average standard deviation of split frequencies: 0.030479 115500 -- [-1127.267] (-1131.420) (-1127.566) (-1132.119) * (-1128.229) (-1129.752) [-1128.970] (-1128.493) -- 0:00:53 116000 -- (-1127.645) (-1130.536) [-1127.387] (-1129.440) * [-1127.541] (-1129.849) (-1126.801) (-1128.281) -- 0:00:53 116500 -- (-1127.477) (-1128.130) [-1126.969] (-1128.101) * (-1127.154) (-1129.103) [-1128.250] (-1133.595) -- 0:00:53 117000 -- (-1127.883) (-1126.499) [-1130.263] (-1130.337) * (-1127.142) (-1128.794) [-1127.339] (-1131.256) -- 0:00:52 117500 -- (-1126.316) (-1126.516) (-1129.318) [-1130.436] * (-1128.055) (-1128.712) [-1126.741] (-1130.748) -- 0:00:52 118000 -- (-1126.241) (-1126.814) [-1131.205] (-1132.545) * (-1128.029) (-1129.404) [-1127.442] (-1129.897) -- 0:00:52 118500 -- [-1130.830] (-1126.683) (-1128.090) (-1132.117) * [-1130.986] (-1130.972) (-1131.873) (-1128.020) -- 0:00:52 119000 -- (-1129.364) (-1126.262) (-1128.264) [-1127.146] * (-1128.311) (-1130.341) [-1131.273] (-1127.915) -- 0:00:51 119500 -- [-1127.823] (-1129.491) (-1129.738) (-1131.173) * [-1131.992] (-1129.321) (-1131.426) (-1130.788) -- 0:00:51 120000 -- (-1129.482) (-1128.013) (-1127.214) [-1128.749] * (-1131.107) (-1127.399) (-1131.834) [-1126.878] -- 0:00:51 Average standard deviation of split frequencies: 0.027964 120500 -- (-1129.896) (-1127.824) (-1127.316) [-1128.484] * [-1129.845] (-1129.499) (-1129.575) (-1127.507) -- 0:00:51 121000 -- (-1126.959) (-1130.533) (-1127.316) [-1126.922] * (-1131.629) (-1129.424) (-1128.091) [-1126.842] -- 0:00:50 121500 -- (-1128.077) (-1131.360) [-1128.022] (-1127.544) * (-1129.400) [-1128.725] (-1128.063) (-1128.124) -- 0:00:50 122000 -- (-1126.948) (-1129.953) [-1127.112] (-1127.329) * (-1129.112) [-1130.540] (-1128.622) (-1127.944) -- 0:00:50 122500 -- (-1127.075) (-1129.109) (-1129.028) [-1129.660] * [-1131.365] (-1127.246) (-1129.014) (-1132.591) -- 0:00:50 123000 -- (-1128.074) (-1129.372) [-1129.754] (-1130.784) * [-1128.066] (-1127.218) (-1130.121) (-1131.215) -- 0:00:49 123500 -- (-1127.698) [-1127.110] (-1126.806) (-1128.497) * (-1127.709) (-1127.063) [-1129.809] (-1133.088) -- 0:00:49 124000 -- [-1128.509] (-1131.780) (-1129.132) (-1129.482) * [-1127.888] (-1129.099) (-1127.711) (-1132.449) -- 0:00:49 124500 -- (-1128.800) (-1127.774) [-1129.425] (-1132.594) * (-1127.470) [-1129.317] (-1127.182) (-1126.692) -- 0:00:49 125000 -- (-1126.931) [-1126.792] (-1129.689) (-1127.519) * (-1127.488) [-1128.174] (-1127.396) (-1126.785) -- 0:00:49 Average standard deviation of split frequencies: 0.026376 125500 -- (-1130.712) [-1127.700] (-1133.167) (-1129.149) * [-1132.826] (-1129.313) (-1129.713) (-1126.498) -- 0:00:48 126000 -- (-1135.034) (-1127.471) (-1137.395) [-1126.675] * [-1128.011] (-1127.175) (-1129.957) (-1127.234) -- 0:00:55 126500 -- (-1132.177) (-1128.353) (-1129.489) [-1127.433] * (-1128.421) (-1127.210) [-1127.675] (-1127.158) -- 0:00:55 127000 -- [-1130.169] (-1135.267) (-1128.792) (-1126.836) * (-1128.526) (-1126.976) (-1127.363) [-1127.412] -- 0:00:54 127500 -- (-1129.335) (-1135.536) [-1129.685] (-1127.400) * (-1127.961) [-1126.988] (-1127.978) (-1128.512) -- 0:00:54 128000 -- [-1129.393] (-1128.704) (-1131.126) (-1130.397) * [-1129.207] (-1129.814) (-1127.243) (-1126.767) -- 0:00:54 128500 -- (-1128.998) (-1128.215) (-1137.564) [-1128.180] * (-1130.468) (-1129.869) [-1127.424] (-1126.925) -- 0:00:54 129000 -- [-1132.853] (-1130.091) (-1128.208) (-1129.530) * (-1129.826) [-1129.755] (-1127.163) (-1129.396) -- 0:00:54 129500 -- [-1129.078] (-1130.655) (-1131.675) (-1130.966) * (-1126.920) (-1132.873) (-1129.692) [-1129.361] -- 0:00:53 130000 -- (-1127.404) (-1131.413) [-1127.207] (-1129.957) * (-1127.603) (-1133.316) [-1133.598] (-1134.250) -- 0:00:53 Average standard deviation of split frequencies: 0.026773 130500 -- (-1129.761) (-1130.592) [-1127.421] (-1128.135) * [-1132.259] (-1134.897) (-1130.044) (-1128.920) -- 0:00:53 131000 -- (-1128.518) (-1128.672) [-1127.876] (-1132.763) * [-1129.705] (-1127.074) (-1133.871) (-1126.770) -- 0:00:53 131500 -- (-1129.397) (-1127.999) [-1134.238] (-1130.206) * (-1128.773) [-1129.731] (-1132.729) (-1128.638) -- 0:00:52 132000 -- [-1129.812] (-1127.305) (-1131.311) (-1130.689) * (-1127.557) (-1128.915) [-1134.645] (-1129.585) -- 0:00:52 132500 -- (-1134.102) [-1129.916] (-1130.780) (-1131.105) * (-1128.212) [-1128.155] (-1126.389) (-1128.084) -- 0:00:52 133000 -- (-1128.852) [-1128.376] (-1130.748) (-1128.372) * [-1128.619] (-1130.649) (-1127.099) (-1127.260) -- 0:00:52 133500 -- [-1130.454] (-1128.467) (-1128.596) (-1130.810) * (-1129.029) (-1129.408) [-1126.303] (-1131.035) -- 0:00:51 134000 -- (-1130.306) (-1128.311) [-1132.074] (-1129.328) * (-1126.841) (-1131.094) [-1129.462] (-1129.213) -- 0:00:51 134500 -- [-1130.247] (-1130.263) (-1129.878) (-1131.409) * [-1128.681] (-1134.974) (-1127.895) (-1127.279) -- 0:00:51 135000 -- (-1131.621) (-1128.974) [-1127.904] (-1127.213) * (-1133.271) (-1132.981) [-1127.581] (-1127.656) -- 0:00:51 Average standard deviation of split frequencies: 0.024610 135500 -- [-1129.837] (-1130.862) (-1131.632) (-1127.258) * (-1136.864) (-1130.121) (-1128.576) [-1127.849] -- 0:00:51 136000 -- (-1128.570) (-1129.021) (-1128.844) [-1127.092] * (-1135.522) [-1129.198] (-1129.513) (-1128.088) -- 0:00:50 136500 -- (-1128.476) (-1127.273) (-1127.641) [-1129.841] * (-1137.283) (-1130.118) (-1132.294) [-1127.383] -- 0:00:50 137000 -- (-1132.893) [-1128.215] (-1127.363) (-1130.916) * (-1128.253) (-1127.352) [-1128.302] (-1131.427) -- 0:00:50 137500 -- (-1130.175) [-1130.145] (-1128.468) (-1132.252) * (-1127.955) (-1127.892) (-1127.330) [-1131.241] -- 0:00:50 138000 -- (-1131.383) (-1126.871) (-1127.495) [-1128.272] * (-1132.197) (-1132.647) [-1127.325] (-1131.402) -- 0:00:49 138500 -- (-1133.807) (-1135.750) [-1127.569] (-1131.191) * [-1127.352] (-1131.938) (-1127.328) (-1129.830) -- 0:00:49 139000 -- (-1130.009) (-1127.280) (-1127.775) [-1126.778] * (-1127.331) [-1130.092] (-1127.240) (-1133.666) -- 0:00:49 139500 -- (-1129.408) (-1128.209) [-1128.069] (-1128.251) * (-1127.283) (-1130.476) [-1131.242] (-1128.331) -- 0:00:49 140000 -- (-1127.864) [-1127.291] (-1129.168) (-1128.718) * [-1127.750] (-1128.795) (-1130.844) (-1128.889) -- 0:00:49 Average standard deviation of split frequencies: 0.022224 140500 -- [-1127.864] (-1127.905) (-1126.998) (-1127.665) * (-1126.773) (-1128.885) [-1129.155] (-1127.197) -- 0:00:48 141000 -- [-1127.714] (-1127.643) (-1129.117) (-1128.124) * [-1127.998] (-1129.247) (-1128.858) (-1126.661) -- 0:00:48 141500 -- (-1129.730) [-1127.443] (-1130.079) (-1127.934) * (-1129.589) (-1128.768) (-1128.598) [-1128.335] -- 0:00:48 142000 -- (-1126.754) [-1127.430] (-1127.793) (-1126.596) * (-1127.466) [-1128.525] (-1127.223) (-1130.353) -- 0:00:54 142500 -- (-1128.329) (-1130.015) (-1127.794) [-1127.064] * (-1127.506) [-1127.019] (-1126.748) (-1128.435) -- 0:00:54 143000 -- [-1129.531] (-1129.209) (-1128.541) (-1128.261) * (-1128.894) [-1126.966] (-1126.486) (-1131.778) -- 0:00:53 143500 -- (-1128.918) [-1131.210] (-1128.318) (-1127.703) * (-1128.987) (-1128.617) [-1127.325] (-1131.159) -- 0:00:53 144000 -- (-1128.354) [-1130.951] (-1128.247) (-1130.477) * [-1127.508] (-1128.213) (-1129.227) (-1130.152) -- 0:00:53 144500 -- [-1126.555] (-1128.514) (-1128.525) (-1130.189) * (-1129.844) (-1130.665) (-1127.884) [-1129.203] -- 0:00:53 145000 -- (-1126.514) (-1129.673) (-1128.526) [-1128.421] * (-1127.591) (-1131.634) [-1128.059] (-1128.226) -- 0:00:53 Average standard deviation of split frequencies: 0.021072 145500 -- (-1128.406) [-1127.993] (-1133.810) (-1130.190) * (-1128.894) [-1130.001] (-1126.681) (-1132.182) -- 0:00:52 146000 -- (-1130.658) (-1129.681) (-1130.046) [-1128.272] * [-1127.639] (-1127.353) (-1127.308) (-1132.657) -- 0:00:52 146500 -- (-1130.169) (-1131.461) (-1130.420) [-1127.072] * [-1128.935] (-1127.941) (-1127.612) (-1129.425) -- 0:00:52 147000 -- (-1128.926) (-1127.402) (-1128.727) [-1130.754] * (-1130.559) (-1127.973) (-1128.693) [-1129.445] -- 0:00:52 147500 -- [-1128.006] (-1128.365) (-1126.649) (-1128.087) * [-1128.197] (-1127.077) (-1129.300) (-1136.781) -- 0:00:52 148000 -- (-1128.495) [-1130.295] (-1127.029) (-1127.258) * (-1126.466) (-1129.647) [-1126.980] (-1128.606) -- 0:00:51 148500 -- (-1129.648) (-1131.740) [-1128.667] (-1127.331) * [-1127.386] (-1132.870) (-1127.604) (-1129.099) -- 0:00:51 149000 -- (-1128.852) [-1127.852] (-1128.097) (-1128.157) * [-1128.170] (-1129.777) (-1128.211) (-1130.583) -- 0:00:51 149500 -- (-1127.350) (-1127.243) (-1127.320) [-1128.374] * (-1130.946) (-1126.735) (-1127.917) [-1127.725] -- 0:00:51 150000 -- (-1127.788) (-1130.096) (-1128.796) [-1127.733] * [-1126.734] (-1128.359) (-1127.972) (-1128.262) -- 0:00:51 Average standard deviation of split frequencies: 0.019761 150500 -- [-1129.141] (-1131.492) (-1128.617) (-1129.294) * (-1128.449) (-1129.033) [-1127.342] (-1127.770) -- 0:00:50 151000 -- (-1129.888) (-1129.045) (-1128.984) [-1129.498] * [-1127.116] (-1127.926) (-1127.963) (-1128.951) -- 0:00:50 151500 -- [-1128.182] (-1127.624) (-1129.628) (-1128.008) * (-1128.506) (-1132.355) [-1128.015] (-1128.624) -- 0:00:50 152000 -- (-1129.530) (-1127.853) (-1129.691) [-1128.316] * (-1127.165) (-1130.891) [-1127.699] (-1128.131) -- 0:00:50 152500 -- (-1128.705) (-1129.145) (-1127.713) [-1126.732] * (-1128.002) (-1130.554) [-1129.401] (-1130.545) -- 0:00:50 153000 -- [-1127.956] (-1127.681) (-1128.874) (-1126.685) * (-1128.226) (-1129.719) [-1130.490] (-1126.758) -- 0:00:49 153500 -- (-1131.313) (-1128.246) (-1131.174) [-1128.548] * (-1130.511) (-1132.290) (-1127.862) [-1127.128] -- 0:00:49 154000 -- (-1130.101) (-1127.882) (-1128.600) [-1131.555] * (-1129.774) (-1127.725) [-1128.912] (-1128.979) -- 0:00:49 154500 -- [-1132.095] (-1128.023) (-1132.427) (-1130.464) * (-1127.874) (-1130.490) [-1128.460] (-1127.305) -- 0:00:49 155000 -- (-1126.602) (-1127.975) (-1130.601) [-1131.880] * (-1128.682) (-1126.424) (-1127.989) [-1129.581] -- 0:00:49 Average standard deviation of split frequencies: 0.020145 155500 -- (-1126.653) (-1128.188) (-1130.402) [-1130.359] * (-1130.161) (-1130.210) [-1128.173] (-1127.707) -- 0:00:48 156000 -- (-1126.770) [-1129.426] (-1129.261) (-1126.469) * [-1128.226] (-1128.717) (-1127.964) (-1128.452) -- 0:00:48 156500 -- (-1129.052) (-1127.652) [-1128.729] (-1131.645) * (-1129.434) (-1133.193) [-1128.548] (-1130.063) -- 0:00:48 157000 -- (-1127.719) [-1128.249] (-1127.667) (-1128.597) * (-1129.065) [-1128.400] (-1127.325) (-1128.784) -- 0:00:48 157500 -- (-1126.360) (-1128.134) (-1133.577) [-1127.243] * (-1131.049) (-1128.271) [-1127.102] (-1128.918) -- 0:00:48 158000 -- (-1127.821) (-1128.108) (-1131.670) [-1127.603] * (-1132.058) [-1126.953] (-1128.554) (-1130.215) -- 0:00:47 158500 -- [-1128.094] (-1127.399) (-1128.615) (-1129.457) * [-1129.938] (-1130.954) (-1130.541) (-1131.708) -- 0:00:53 159000 -- (-1129.186) (-1130.823) [-1132.335] (-1128.288) * (-1127.706) (-1133.567) (-1132.477) [-1128.582] -- 0:00:52 159500 -- [-1128.357] (-1128.330) (-1127.072) (-1126.633) * (-1132.024) (-1136.299) [-1127.945] (-1128.860) -- 0:00:52 160000 -- (-1129.998) (-1128.779) (-1127.180) [-1128.936] * (-1129.775) [-1131.012] (-1129.547) (-1127.760) -- 0:00:52 Average standard deviation of split frequencies: 0.020864 160500 -- (-1131.316) [-1127.495] (-1130.551) (-1132.495) * [-1127.536] (-1129.285) (-1127.761) (-1127.715) -- 0:00:52 161000 -- (-1133.515) (-1128.023) (-1130.507) [-1128.575] * [-1126.506] (-1128.341) (-1127.958) (-1129.062) -- 0:00:52 161500 -- (-1133.644) [-1128.733] (-1127.652) (-1127.250) * (-1126.778) [-1126.606] (-1128.638) (-1131.196) -- 0:00:51 162000 -- (-1129.884) [-1128.551] (-1127.565) (-1126.910) * (-1127.575) (-1130.125) (-1129.449) [-1127.618] -- 0:00:51 162500 -- (-1129.054) [-1128.725] (-1128.368) (-1128.220) * (-1129.738) (-1126.623) (-1129.275) [-1127.087] -- 0:00:51 163000 -- (-1129.484) (-1128.051) [-1128.368] (-1133.053) * (-1129.639) [-1131.882] (-1126.659) (-1127.037) -- 0:00:51 163500 -- [-1128.270] (-1127.736) (-1135.588) (-1127.968) * (-1130.729) [-1126.996] (-1128.028) (-1127.151) -- 0:00:51 164000 -- [-1128.134] (-1129.106) (-1130.149) (-1128.227) * (-1127.800) [-1126.430] (-1126.755) (-1129.170) -- 0:00:50 164500 -- (-1127.101) (-1131.051) [-1128.104] (-1133.125) * (-1128.156) (-1127.666) (-1130.269) [-1129.297] -- 0:00:50 165000 -- (-1128.314) (-1132.355) [-1128.113] (-1134.026) * (-1130.699) [-1128.387] (-1128.471) (-1131.337) -- 0:00:50 Average standard deviation of split frequencies: 0.021074 165500 -- (-1127.504) (-1130.892) [-1127.081] (-1133.582) * (-1131.185) (-1129.893) [-1127.648] (-1129.214) -- 0:00:50 166000 -- (-1127.608) (-1133.885) (-1127.716) [-1131.929] * (-1134.861) (-1126.818) [-1127.376] (-1126.445) -- 0:00:50 166500 -- (-1132.400) (-1128.878) [-1127.501] (-1134.740) * (-1135.106) [-1128.540] (-1128.189) (-1127.184) -- 0:00:50 167000 -- (-1132.053) (-1130.076) [-1127.226] (-1132.124) * (-1134.213) [-1131.022] (-1130.929) (-1127.623) -- 0:00:49 167500 -- (-1127.742) (-1133.539) [-1127.685] (-1128.879) * [-1132.336] (-1129.831) (-1131.789) (-1129.084) -- 0:00:49 168000 -- [-1127.788] (-1133.253) (-1126.847) (-1131.966) * (-1130.660) (-1132.899) (-1128.616) [-1129.964] -- 0:00:49 168500 -- [-1128.758] (-1130.659) (-1128.800) (-1130.073) * (-1127.062) (-1128.472) [-1131.090] (-1128.804) -- 0:00:49 169000 -- (-1128.796) (-1128.196) (-1126.770) [-1126.582] * [-1127.080] (-1128.891) (-1130.664) (-1128.810) -- 0:00:49 169500 -- [-1126.951] (-1132.039) (-1127.412) (-1127.155) * [-1128.029] (-1127.401) (-1130.023) (-1130.734) -- 0:00:48 170000 -- (-1127.201) (-1129.794) [-1128.896] (-1126.456) * (-1129.037) (-1127.859) [-1126.788] (-1128.857) -- 0:00:48 Average standard deviation of split frequencies: 0.021806 170500 -- (-1128.372) (-1130.581) [-1128.615] (-1126.880) * (-1127.418) (-1127.459) (-1126.971) [-1129.388] -- 0:00:48 171000 -- (-1127.624) (-1130.904) [-1128.718] (-1130.045) * (-1129.232) [-1126.858] (-1127.886) (-1130.251) -- 0:00:48 171500 -- (-1128.208) (-1129.261) (-1129.385) [-1127.021] * [-1130.220] (-1127.684) (-1134.364) (-1128.703) -- 0:00:48 172000 -- (-1128.975) (-1126.272) [-1127.181] (-1129.719) * (-1126.632) (-1129.234) [-1128.798] (-1126.569) -- 0:00:48 172500 -- [-1129.934] (-1126.990) (-1127.780) (-1127.549) * (-1127.745) (-1128.944) (-1128.797) [-1127.216] -- 0:00:47 173000 -- [-1128.335] (-1128.476) (-1133.592) (-1127.086) * (-1129.275) (-1130.427) [-1127.041] (-1128.399) -- 0:00:47 173500 -- [-1127.261] (-1130.010) (-1134.178) (-1127.229) * (-1128.221) (-1131.017) (-1129.732) [-1127.618] -- 0:00:47 174000 -- [-1127.947] (-1133.629) (-1127.991) (-1129.938) * (-1127.147) (-1128.436) (-1128.431) [-1128.915] -- 0:00:47 174500 -- (-1128.217) (-1129.001) (-1130.290) [-1129.091] * (-1126.529) [-1129.377] (-1129.274) (-1128.544) -- 0:00:47 175000 -- (-1134.757) (-1128.469) [-1129.129] (-1127.723) * [-1126.547] (-1129.135) (-1126.748) (-1127.518) -- 0:00:51 Average standard deviation of split frequencies: 0.020797 175500 -- (-1134.147) (-1130.312) [-1127.258] (-1130.798) * (-1129.705) [-1130.477] (-1126.326) (-1127.518) -- 0:00:51 176000 -- (-1131.344) (-1126.801) (-1128.998) [-1127.632] * (-1128.500) (-1129.771) [-1128.004] (-1129.165) -- 0:00:51 176500 -- (-1129.163) [-1127.532] (-1128.582) (-1127.850) * (-1128.121) (-1134.069) (-1127.882) [-1131.499] -- 0:00:51 177000 -- (-1127.297) [-1130.549] (-1130.308) (-1129.496) * (-1127.654) [-1134.841] (-1130.749) (-1128.423) -- 0:00:51 177500 -- [-1127.271] (-1127.612) (-1131.543) (-1128.847) * (-1126.671) (-1129.152) (-1129.789) [-1127.774] -- 0:00:50 178000 -- [-1127.586] (-1126.690) (-1129.707) (-1130.252) * [-1128.434] (-1128.734) (-1130.892) (-1126.820) -- 0:00:50 178500 -- (-1129.490) [-1129.292] (-1133.179) (-1127.655) * (-1128.117) (-1128.766) (-1129.609) [-1126.971] -- 0:00:50 179000 -- [-1129.753] (-1132.839) (-1128.775) (-1129.321) * [-1128.190] (-1129.789) (-1127.906) (-1127.853) -- 0:00:50 179500 -- [-1128.058] (-1131.811) (-1127.990) (-1130.366) * (-1126.997) (-1127.286) (-1132.165) [-1127.294] -- 0:00:50 180000 -- (-1131.374) [-1130.512] (-1128.128) (-1133.217) * (-1127.635) (-1128.295) [-1131.096] (-1127.883) -- 0:00:50 Average standard deviation of split frequencies: 0.020385 180500 -- (-1128.640) [-1131.314] (-1129.194) (-1133.502) * (-1128.434) (-1128.335) [-1128.664] (-1128.129) -- 0:00:49 181000 -- (-1129.072) (-1129.702) (-1128.982) [-1128.161] * (-1129.615) (-1129.707) (-1128.076) [-1126.592] -- 0:00:49 181500 -- (-1128.048) [-1126.760] (-1128.213) (-1129.029) * (-1128.947) [-1127.069] (-1128.157) (-1127.444) -- 0:00:49 182000 -- (-1128.017) (-1128.683) (-1129.877) [-1128.714] * (-1130.184) (-1129.147) (-1130.453) [-1127.154] -- 0:00:49 182500 -- (-1127.839) [-1126.658] (-1127.977) (-1128.915) * [-1132.384] (-1126.948) (-1128.468) (-1128.404) -- 0:00:49 183000 -- (-1127.764) (-1127.337) [-1127.469] (-1127.082) * (-1130.296) (-1128.794) [-1129.589] (-1129.969) -- 0:00:49 183500 -- (-1127.973) (-1128.139) [-1127.254] (-1127.706) * (-1130.705) (-1127.941) [-1130.354] (-1130.291) -- 0:00:48 184000 -- (-1129.546) [-1132.926] (-1127.888) (-1130.945) * [-1127.725] (-1127.886) (-1130.162) (-1135.550) -- 0:00:48 184500 -- (-1127.534) (-1133.122) (-1128.190) [-1128.130] * (-1127.174) (-1130.945) [-1129.584] (-1129.306) -- 0:00:48 185000 -- (-1128.773) (-1129.020) [-1128.839] (-1128.162) * (-1128.873) [-1128.262] (-1129.411) (-1130.135) -- 0:00:48 Average standard deviation of split frequencies: 0.019008 185500 -- (-1127.254) (-1128.419) (-1129.342) [-1128.278] * (-1127.152) [-1126.706] (-1129.735) (-1127.391) -- 0:00:48 186000 -- (-1126.785) (-1128.848) [-1127.739] (-1129.058) * (-1134.233) (-1130.111) (-1127.919) [-1129.742] -- 0:00:48 186500 -- (-1128.337) [-1129.069] (-1130.864) (-1130.650) * (-1129.387) [-1126.278] (-1130.492) (-1128.282) -- 0:00:47 187000 -- [-1131.883] (-1127.909) (-1132.702) (-1128.130) * [-1129.116] (-1126.617) (-1128.166) (-1127.464) -- 0:00:47 187500 -- (-1132.180) [-1128.006] (-1129.143) (-1128.869) * (-1130.016) (-1128.563) (-1128.061) [-1127.799] -- 0:00:47 188000 -- (-1130.299) (-1130.057) (-1135.560) [-1131.869] * (-1130.823) (-1130.227) [-1128.235] (-1127.156) -- 0:00:47 188500 -- (-1126.963) (-1127.617) (-1126.862) [-1129.237] * (-1130.496) (-1128.246) (-1134.478) [-1127.947] -- 0:00:47 189000 -- (-1126.966) [-1127.592] (-1130.320) (-1129.402) * [-1130.220] (-1131.538) (-1136.354) (-1126.475) -- 0:00:47 189500 -- (-1130.093) (-1127.709) (-1129.359) [-1129.344] * (-1132.143) (-1128.550) (-1134.039) [-1126.516] -- 0:00:47 190000 -- [-1129.638] (-1128.549) (-1130.379) (-1127.708) * (-1132.071) [-1127.438] (-1131.771) (-1127.068) -- 0:00:46 Average standard deviation of split frequencies: 0.018179 190500 -- (-1128.978) (-1127.248) (-1130.381) [-1128.383] * (-1132.160) (-1128.103) [-1127.439] (-1127.173) -- 0:00:46 191000 -- (-1131.982) (-1127.206) [-1127.210] (-1128.361) * (-1129.563) (-1128.215) [-1127.267] (-1129.177) -- 0:00:50 191500 -- [-1131.488] (-1134.804) (-1128.248) (-1127.100) * (-1127.473) (-1129.288) [-1127.356] (-1128.840) -- 0:00:50 192000 -- [-1126.949] (-1130.396) (-1130.904) (-1128.843) * (-1128.314) (-1129.970) (-1127.740) [-1129.565] -- 0:00:50 192500 -- (-1133.857) [-1127.693] (-1129.006) (-1127.869) * (-1128.314) (-1127.709) (-1128.388) [-1131.433] -- 0:00:50 193000 -- [-1133.095] (-1129.968) (-1128.883) (-1128.779) * (-1127.440) [-1129.914] (-1126.888) (-1130.406) -- 0:00:50 193500 -- [-1134.445] (-1131.496) (-1132.818) (-1129.579) * (-1128.665) (-1132.386) [-1126.800] (-1131.494) -- 0:00:50 194000 -- (-1130.343) (-1131.158) (-1130.040) [-1129.699] * (-1130.710) (-1129.357) (-1133.217) [-1131.848] -- 0:00:49 194500 -- (-1126.629) (-1130.240) (-1129.432) [-1127.581] * (-1128.136) [-1128.098] (-1127.720) (-1130.674) -- 0:00:49 195000 -- [-1127.033] (-1128.047) (-1129.277) (-1128.809) * (-1128.056) (-1128.698) (-1128.052) [-1127.114] -- 0:00:49 Average standard deviation of split frequencies: 0.018817 195500 -- [-1126.939] (-1129.725) (-1136.277) (-1130.040) * (-1130.868) [-1127.714] (-1127.975) (-1128.107) -- 0:00:49 196000 -- (-1129.343) (-1130.431) (-1134.202) [-1126.366] * (-1127.094) (-1128.026) (-1128.018) [-1131.737] -- 0:00:49 196500 -- (-1127.292) (-1127.637) (-1129.065) [-1128.354] * (-1128.161) (-1127.626) [-1129.420] (-1129.011) -- 0:00:49 197000 -- (-1134.237) (-1127.637) [-1133.064] (-1127.395) * [-1127.837] (-1131.536) (-1133.191) (-1129.774) -- 0:00:48 197500 -- (-1127.530) [-1127.161] (-1133.190) (-1130.843) * [-1131.323] (-1133.709) (-1130.766) (-1130.831) -- 0:00:48 198000 -- [-1126.915] (-1128.319) (-1126.504) (-1128.392) * (-1130.199) (-1126.691) (-1129.137) [-1128.491] -- 0:00:48 198500 -- [-1127.952] (-1127.955) (-1129.313) (-1129.003) * (-1128.993) (-1127.452) (-1128.460) [-1128.950] -- 0:00:48 199000 -- (-1128.128) (-1127.061) [-1127.901] (-1129.051) * (-1127.290) (-1129.774) (-1130.078) [-1126.727] -- 0:00:48 199500 -- [-1127.579] (-1128.388) (-1128.821) (-1129.171) * (-1127.904) (-1135.880) (-1128.205) [-1127.179] -- 0:00:48 200000 -- [-1127.337] (-1128.223) (-1128.853) (-1128.590) * (-1127.818) (-1131.815) [-1128.246] (-1127.099) -- 0:00:48 Average standard deviation of split frequencies: 0.019821 200500 -- (-1126.782) (-1130.042) (-1129.027) [-1127.296] * (-1128.727) [-1131.307] (-1128.715) (-1128.413) -- 0:00:47 201000 -- (-1131.443) (-1132.081) (-1127.249) [-1127.280] * [-1132.111] (-1127.759) (-1127.614) (-1127.757) -- 0:00:47 201500 -- (-1128.623) (-1130.902) [-1127.454] (-1127.707) * (-1131.718) [-1129.220] (-1127.849) (-1128.582) -- 0:00:47 202000 -- (-1127.559) (-1127.808) (-1130.321) [-1127.276] * (-1134.482) (-1130.981) (-1128.103) [-1127.610] -- 0:00:47 202500 -- (-1129.783) (-1126.723) (-1134.513) [-1128.492] * (-1128.627) [-1127.733] (-1130.553) (-1127.764) -- 0:00:47 203000 -- (-1138.459) (-1131.643) (-1127.748) [-1128.012] * (-1129.029) [-1127.742] (-1129.153) (-1129.577) -- 0:00:47 203500 -- (-1132.862) (-1128.924) [-1128.705] (-1128.001) * (-1129.121) (-1128.598) (-1130.066) [-1128.915] -- 0:00:46 204000 -- (-1128.612) (-1129.622) [-1127.368] (-1128.418) * (-1127.289) [-1128.916] (-1130.306) (-1129.865) -- 0:00:46 204500 -- (-1127.701) [-1128.509] (-1129.124) (-1130.154) * [-1126.650] (-1129.752) (-1128.633) (-1129.149) -- 0:00:46 205000 -- (-1128.824) (-1127.466) [-1129.358] (-1129.232) * [-1126.650] (-1130.834) (-1127.861) (-1129.658) -- 0:00:46 Average standard deviation of split frequencies: 0.019653 205500 -- (-1129.016) [-1130.035] (-1128.101) (-1132.266) * [-1126.927] (-1130.814) (-1127.156) (-1129.039) -- 0:00:46 206000 -- (-1129.150) (-1127.534) [-1128.222] (-1128.473) * (-1128.332) [-1127.316] (-1127.200) (-1128.718) -- 0:00:46 206500 -- (-1128.854) [-1128.202] (-1130.322) (-1128.062) * (-1130.063) (-1131.531) (-1127.574) [-1130.624] -- 0:00:46 207000 -- (-1126.756) [-1128.830] (-1130.724) (-1129.884) * (-1127.209) [-1129.770] (-1129.132) (-1130.555) -- 0:00:49 207500 -- (-1127.842) (-1127.167) (-1127.912) [-1127.390] * [-1128.250] (-1128.433) (-1128.843) (-1129.131) -- 0:00:49 208000 -- (-1128.352) (-1129.953) (-1127.356) [-1127.979] * (-1127.617) [-1129.105] (-1129.672) (-1129.551) -- 0:00:49 208500 -- (-1127.891) (-1127.565) [-1127.539] (-1128.528) * (-1132.963) (-1130.402) [-1127.974] (-1129.926) -- 0:00:49 209000 -- [-1128.770] (-1127.842) (-1128.714) (-1128.576) * [-1128.368] (-1133.667) (-1132.234) (-1127.149) -- 0:00:49 209500 -- [-1128.939] (-1129.820) (-1129.556) (-1127.453) * [-1128.466] (-1132.317) (-1130.754) (-1127.487) -- 0:00:49 210000 -- [-1131.235] (-1133.434) (-1128.597) (-1129.602) * [-1130.971] (-1130.383) (-1129.011) (-1128.709) -- 0:00:48 Average standard deviation of split frequencies: 0.017375 210500 -- (-1129.855) [-1129.937] (-1128.364) (-1130.335) * [-1128.841] (-1132.170) (-1129.878) (-1127.362) -- 0:00:48 211000 -- (-1133.243) (-1129.523) (-1128.345) [-1127.231] * (-1131.955) (-1128.629) [-1128.638] (-1127.375) -- 0:00:48 211500 -- [-1130.746] (-1131.084) (-1127.248) (-1127.737) * (-1130.320) (-1127.179) [-1129.463] (-1127.778) -- 0:00:48 212000 -- [-1127.930] (-1131.211) (-1127.534) (-1127.688) * (-1134.992) (-1128.101) (-1131.134) [-1127.267] -- 0:00:48 212500 -- (-1128.062) (-1127.806) (-1127.832) [-1129.797] * [-1127.520] (-1128.100) (-1128.042) (-1127.832) -- 0:00:48 213000 -- (-1128.089) (-1127.846) [-1128.092] (-1131.066) * (-1127.774) (-1126.669) [-1128.083] (-1128.441) -- 0:00:48 213500 -- (-1126.839) [-1127.900] (-1129.276) (-1131.760) * [-1127.668] (-1129.063) (-1128.718) (-1128.520) -- 0:00:47 214000 -- (-1129.733) [-1127.080] (-1128.183) (-1129.456) * (-1128.810) (-1127.917) (-1130.707) [-1127.924] -- 0:00:47 214500 -- (-1128.369) (-1130.008) (-1127.832) [-1129.045] * (-1134.291) (-1129.177) [-1132.978] (-1130.582) -- 0:00:47 215000 -- (-1129.144) (-1128.471) (-1127.625) [-1128.337] * [-1129.414] (-1130.274) (-1134.332) (-1129.534) -- 0:00:47 Average standard deviation of split frequencies: 0.017331 215500 -- (-1128.837) [-1128.141] (-1128.625) (-1128.187) * [-1129.266] (-1131.960) (-1132.270) (-1128.230) -- 0:00:47 216000 -- [-1131.248] (-1129.133) (-1128.531) (-1129.082) * (-1130.907) (-1129.836) (-1127.707) [-1126.914] -- 0:00:47 216500 -- (-1131.449) [-1127.275] (-1128.939) (-1128.518) * (-1130.612) [-1130.875] (-1129.153) (-1130.973) -- 0:00:47 217000 -- (-1133.001) [-1129.807] (-1128.766) (-1130.603) * (-1129.835) [-1130.225] (-1128.611) (-1128.768) -- 0:00:46 217500 -- (-1127.985) [-1126.683] (-1127.095) (-1128.615) * (-1131.977) (-1129.483) [-1128.141] (-1129.024) -- 0:00:46 218000 -- [-1130.161] (-1127.362) (-1126.692) (-1129.192) * (-1129.743) [-1132.452] (-1130.632) (-1132.368) -- 0:00:46 218500 -- (-1128.510) [-1126.981] (-1127.990) (-1128.822) * (-1127.419) (-1131.522) (-1127.344) [-1129.465] -- 0:00:46 219000 -- [-1127.423] (-1129.042) (-1127.690) (-1128.905) * (-1128.977) (-1127.133) (-1132.271) [-1130.351] -- 0:00:46 219500 -- (-1130.971) (-1130.394) (-1127.022) [-1128.609] * (-1130.597) [-1127.174] (-1127.313) (-1128.669) -- 0:00:46 220000 -- (-1126.580) (-1130.087) (-1128.473) [-1130.369] * (-1133.242) (-1127.362) [-1129.809] (-1131.282) -- 0:00:46 Average standard deviation of split frequencies: 0.017758 220500 -- (-1130.338) (-1132.573) (-1127.620) [-1127.504] * (-1128.032) (-1127.383) [-1128.458] (-1128.567) -- 0:00:45 221000 -- [-1129.996] (-1128.546) (-1129.067) (-1129.139) * (-1128.682) (-1126.953) (-1127.176) [-1127.065] -- 0:00:45 221500 -- (-1130.301) [-1129.270] (-1128.877) (-1128.948) * (-1130.939) [-1131.732] (-1133.985) (-1127.142) -- 0:00:45 222000 -- (-1130.299) [-1128.240] (-1128.136) (-1129.297) * (-1130.312) (-1130.817) (-1129.389) [-1126.983] -- 0:00:45 222500 -- (-1131.098) (-1128.597) [-1129.242] (-1129.383) * (-1134.365) (-1130.368) [-1129.898] (-1129.383) -- 0:00:45 223000 -- (-1129.653) (-1128.110) [-1127.883] (-1128.649) * [-1127.663] (-1126.899) (-1136.174) (-1128.809) -- 0:00:48 223500 -- (-1128.978) (-1128.826) [-1128.074] (-1128.648) * (-1129.080) [-1126.780] (-1131.871) (-1129.879) -- 0:00:48 224000 -- (-1128.444) [-1126.658] (-1127.505) (-1129.136) * (-1130.916) [-1128.663] (-1128.636) (-1129.152) -- 0:00:48 224500 -- (-1130.489) [-1127.610] (-1132.856) (-1127.820) * (-1129.815) (-1134.301) (-1128.886) [-1129.395] -- 0:00:48 225000 -- (-1130.326) (-1128.137) (-1133.652) [-1127.540] * (-1126.785) [-1129.708] (-1130.782) (-1129.767) -- 0:00:48 Average standard deviation of split frequencies: 0.018251 225500 -- (-1132.174) [-1132.012] (-1127.819) (-1130.425) * [-1126.645] (-1131.226) (-1129.631) (-1133.231) -- 0:00:48 226000 -- [-1131.071] (-1132.908) (-1127.937) (-1135.660) * [-1128.641] (-1127.756) (-1127.670) (-1127.806) -- 0:00:47 226500 -- [-1128.938] (-1129.046) (-1128.286) (-1129.602) * (-1126.981) [-1132.066] (-1127.616) (-1126.415) -- 0:00:47 227000 -- (-1131.179) (-1129.523) [-1133.868] (-1129.578) * (-1127.162) (-1127.519) [-1127.413] (-1127.305) -- 0:00:47 227500 -- (-1133.492) [-1128.279] (-1127.534) (-1130.011) * (-1128.028) [-1128.652] (-1128.663) (-1128.684) -- 0:00:47 228000 -- [-1128.439] (-1133.314) (-1131.612) (-1126.968) * (-1128.977) [-1132.612] (-1127.688) (-1130.402) -- 0:00:47 228500 -- (-1127.079) [-1127.821] (-1135.115) (-1127.621) * (-1128.791) [-1131.701] (-1131.317) (-1133.713) -- 0:00:47 229000 -- (-1128.337) [-1128.610] (-1127.341) (-1126.816) * (-1130.979) (-1133.769) [-1130.108] (-1130.531) -- 0:00:47 229500 -- (-1129.843) (-1127.143) [-1127.069] (-1127.794) * (-1128.767) (-1135.222) (-1131.891) [-1127.292] -- 0:00:47 230000 -- [-1130.844] (-1130.725) (-1127.123) (-1127.794) * (-1128.499) (-1131.909) (-1128.010) [-1127.663] -- 0:00:46 Average standard deviation of split frequencies: 0.019475 230500 -- [-1128.988] (-1128.327) (-1127.507) (-1127.329) * (-1128.034) [-1128.378] (-1129.709) (-1128.938) -- 0:00:46 231000 -- (-1127.873) (-1130.975) (-1127.400) [-1128.366] * (-1128.869) [-1128.806] (-1127.932) (-1131.619) -- 0:00:46 231500 -- (-1127.473) (-1130.906) (-1129.507) [-1129.675] * (-1130.411) (-1130.062) (-1128.650) [-1127.833] -- 0:00:46 232000 -- (-1129.944) (-1130.148) [-1130.432] (-1134.498) * (-1126.464) [-1130.891] (-1128.177) (-1127.482) -- 0:00:46 232500 -- (-1127.515) (-1130.593) (-1131.104) [-1129.038] * (-1127.078) [-1128.351] (-1126.924) (-1129.951) -- 0:00:46 233000 -- (-1129.711) (-1127.669) (-1130.048) [-1128.518] * (-1128.970) (-1129.005) (-1126.848) [-1129.181] -- 0:00:46 233500 -- (-1128.355) [-1127.999] (-1129.810) (-1128.066) * (-1128.870) (-1127.741) [-1128.083] (-1133.114) -- 0:00:45 234000 -- (-1132.087) (-1127.014) [-1128.042] (-1128.171) * (-1128.112) [-1127.764] (-1128.804) (-1128.801) -- 0:00:45 234500 -- (-1131.064) (-1127.006) [-1127.482] (-1130.778) * (-1128.010) [-1127.284] (-1129.332) (-1131.857) -- 0:00:45 235000 -- (-1129.851) (-1128.452) (-1128.089) [-1127.315] * [-1127.668] (-1128.922) (-1129.846) (-1136.986) -- 0:00:45 Average standard deviation of split frequencies: 0.018602 235500 -- (-1129.809) (-1127.172) (-1131.497) [-1128.081] * [-1131.357] (-1129.021) (-1127.556) (-1130.017) -- 0:00:45 236000 -- (-1126.497) [-1130.767] (-1134.220) (-1128.990) * (-1130.092) [-1129.142] (-1127.145) (-1130.473) -- 0:00:45 236500 -- (-1129.984) (-1127.615) (-1136.369) [-1127.489] * (-1126.931) (-1128.116) [-1128.415] (-1127.169) -- 0:00:45 237000 -- (-1128.505) (-1127.264) (-1128.059) [-1129.081] * (-1126.908) (-1129.345) [-1128.001] (-1129.247) -- 0:00:45 237500 -- (-1128.788) [-1127.797] (-1128.572) (-1126.813) * (-1127.884) (-1138.286) (-1128.414) [-1129.232] -- 0:00:44 238000 -- (-1129.912) (-1128.726) [-1126.906] (-1129.481) * [-1128.552] (-1129.747) (-1128.695) (-1128.867) -- 0:00:44 238500 -- [-1132.029] (-1128.936) (-1127.453) (-1130.419) * (-1131.768) (-1127.312) (-1128.476) [-1130.408] -- 0:00:44 239000 -- (-1136.633) (-1135.606) [-1126.815] (-1127.973) * (-1132.612) (-1128.252) [-1128.931] (-1130.748) -- 0:00:47 239500 -- (-1129.656) (-1135.317) [-1131.474] (-1127.766) * (-1129.459) (-1126.515) [-1127.845] (-1131.776) -- 0:00:47 240000 -- [-1134.891] (-1127.939) (-1129.968) (-1134.059) * (-1131.986) [-1126.274] (-1127.428) (-1131.950) -- 0:00:47 Average standard deviation of split frequencies: 0.017629 240500 -- (-1130.559) [-1127.299] (-1130.036) (-1128.469) * (-1126.936) [-1129.546] (-1127.098) (-1132.340) -- 0:00:47 241000 -- (-1128.935) (-1126.911) (-1127.878) [-1127.471] * (-1130.776) (-1129.051) (-1129.549) [-1129.061] -- 0:00:47 241500 -- [-1127.051] (-1127.794) (-1129.320) (-1127.788) * (-1133.672) (-1129.184) (-1130.487) [-1130.005] -- 0:00:47 242000 -- (-1127.051) (-1130.755) (-1132.085) [-1127.758] * (-1133.072) [-1129.104] (-1130.258) (-1129.347) -- 0:00:46 242500 -- [-1127.051] (-1130.893) (-1128.498) (-1127.717) * (-1127.244) (-1128.925) (-1128.410) [-1128.413] -- 0:00:46 243000 -- (-1128.811) (-1130.096) [-1129.051] (-1129.730) * (-1128.001) (-1130.306) (-1127.118) [-1129.066] -- 0:00:46 243500 -- [-1132.894] (-1130.147) (-1127.750) (-1129.706) * (-1127.366) [-1128.156] (-1128.479) (-1128.475) -- 0:00:46 244000 -- (-1132.893) (-1130.374) [-1130.679] (-1128.622) * (-1127.749) (-1129.491) [-1129.136] (-1128.378) -- 0:00:46 244500 -- (-1128.324) (-1127.249) (-1128.967) [-1128.664] * (-1130.960) (-1126.733) (-1130.055) [-1130.691] -- 0:00:46 245000 -- (-1126.741) [-1126.947] (-1128.621) (-1129.051) * (-1132.751) (-1128.382) (-1128.563) [-1131.012] -- 0:00:46 Average standard deviation of split frequencies: 0.017697 245500 -- [-1127.786] (-1127.492) (-1128.451) (-1129.365) * (-1134.610) (-1127.376) [-1129.875] (-1129.400) -- 0:00:46 246000 -- (-1128.486) (-1129.725) [-1129.742] (-1130.184) * [-1133.132] (-1127.255) (-1126.306) (-1128.723) -- 0:00:45 246500 -- (-1131.861) [-1129.788] (-1127.179) (-1127.847) * [-1128.069] (-1127.246) (-1126.203) (-1130.185) -- 0:00:45 247000 -- (-1132.682) (-1128.685) [-1127.361] (-1126.977) * (-1127.771) [-1127.128] (-1129.104) (-1133.394) -- 0:00:45 247500 -- (-1129.588) (-1127.219) (-1128.024) [-1129.958] * [-1127.360] (-1127.616) (-1127.396) (-1128.941) -- 0:00:45 248000 -- (-1128.726) [-1131.547] (-1128.487) (-1129.595) * (-1127.650) [-1128.844] (-1127.513) (-1129.298) -- 0:00:45 248500 -- (-1132.264) (-1128.902) [-1127.509] (-1127.480) * (-1129.140) (-1132.269) [-1127.193] (-1130.857) -- 0:00:45 249000 -- (-1131.035) (-1134.018) (-1129.624) [-1130.025] * (-1127.176) (-1132.723) [-1130.538] (-1126.703) -- 0:00:45 249500 -- (-1130.601) (-1132.767) (-1128.400) [-1129.853] * (-1128.782) (-1129.210) [-1130.491] (-1127.855) -- 0:00:45 250000 -- [-1130.922] (-1133.054) (-1127.059) (-1126.850) * (-1130.403) [-1129.370] (-1130.641) (-1128.422) -- 0:00:45 Average standard deviation of split frequencies: 0.016483 250500 -- (-1130.906) (-1127.699) (-1128.712) [-1126.784] * (-1131.040) (-1129.818) [-1127.349] (-1128.158) -- 0:00:44 251000 -- (-1129.080) (-1128.102) [-1126.721] (-1127.351) * (-1129.347) [-1129.074] (-1126.295) (-1127.481) -- 0:00:44 251500 -- [-1127.537] (-1128.287) (-1126.979) (-1126.827) * (-1130.337) (-1130.087) (-1127.927) [-1127.605] -- 0:00:44 252000 -- (-1126.649) [-1127.820] (-1130.040) (-1127.104) * (-1129.482) [-1127.882] (-1126.831) (-1129.350) -- 0:00:44 252500 -- (-1126.626) (-1127.042) [-1128.297] (-1128.977) * [-1128.663] (-1129.454) (-1127.334) (-1129.296) -- 0:00:44 253000 -- (-1129.076) [-1127.089] (-1127.215) (-1127.973) * (-1129.781) (-1130.848) (-1129.873) [-1129.138] -- 0:00:44 253500 -- [-1126.615] (-1128.070) (-1126.822) (-1127.851) * (-1130.155) [-1127.450] (-1127.282) (-1127.053) -- 0:00:44 254000 -- [-1126.790] (-1127.212) (-1136.909) (-1130.676) * (-1128.019) (-1128.138) (-1128.446) [-1127.860] -- 0:00:44 254500 -- (-1127.348) (-1127.671) (-1129.834) [-1131.705] * (-1126.962) (-1128.456) [-1129.814] (-1128.335) -- 0:00:43 255000 -- (-1129.161) (-1129.708) (-1129.815) [-1130.105] * [-1128.404] (-1127.261) (-1127.938) (-1127.912) -- 0:00:46 Average standard deviation of split frequencies: 0.016789 255500 -- (-1127.985) [-1130.799] (-1129.039) (-1127.850) * [-1130.719] (-1131.224) (-1128.359) (-1127.246) -- 0:00:46 256000 -- (-1129.225) (-1129.326) (-1128.869) [-1129.877] * (-1130.162) [-1127.215] (-1128.696) (-1127.219) -- 0:00:46 256500 -- [-1129.226] (-1128.273) (-1131.565) (-1128.677) * (-1127.251) [-1128.169] (-1129.274) (-1127.750) -- 0:00:46 257000 -- [-1127.417] (-1128.974) (-1127.192) (-1128.208) * [-1130.272] (-1131.084) (-1131.762) (-1132.509) -- 0:00:46 257500 -- (-1127.341) [-1128.808] (-1127.691) (-1126.948) * [-1128.559] (-1127.137) (-1129.479) (-1128.310) -- 0:00:46 258000 -- (-1127.053) [-1129.273] (-1127.925) (-1131.234) * (-1131.981) [-1127.992] (-1128.621) (-1131.124) -- 0:00:46 258500 -- (-1126.986) (-1130.843) (-1127.146) [-1128.989] * (-1130.532) [-1130.724] (-1130.113) (-1129.141) -- 0:00:45 259000 -- (-1127.154) (-1129.136) [-1126.596] (-1129.331) * (-1130.283) (-1132.983) [-1131.607] (-1127.907) -- 0:00:45 259500 -- (-1127.438) [-1127.429] (-1126.600) (-1127.961) * (-1127.490) (-1129.129) [-1130.368] (-1130.193) -- 0:00:45 260000 -- (-1126.411) (-1130.194) (-1130.331) [-1127.197] * (-1129.238) [-1126.772] (-1127.030) (-1127.332) -- 0:00:45 Average standard deviation of split frequencies: 0.018424 260500 -- (-1127.782) [-1128.249] (-1128.435) (-1127.195) * (-1127.024) (-1129.454) [-1127.091] (-1128.782) -- 0:00:45 261000 -- (-1126.918) (-1130.384) (-1131.330) [-1129.105] * [-1128.658] (-1128.197) (-1131.822) (-1128.439) -- 0:00:45 261500 -- (-1128.246) (-1132.237) [-1128.109] (-1131.834) * (-1126.883) [-1127.185] (-1132.275) (-1126.787) -- 0:00:45 262000 -- (-1130.713) [-1130.953] (-1126.451) (-1130.010) * (-1127.072) [-1129.750] (-1128.418) (-1126.754) -- 0:00:45 262500 -- (-1131.581) [-1129.034] (-1126.752) (-1126.932) * (-1127.183) (-1127.094) [-1127.944] (-1130.102) -- 0:00:44 263000 -- (-1128.610) [-1127.033] (-1126.454) (-1128.127) * (-1126.532) [-1128.611] (-1126.698) (-1127.294) -- 0:00:44 263500 -- (-1128.997) (-1127.789) [-1126.482] (-1128.986) * [-1126.546] (-1129.520) (-1129.121) (-1128.087) -- 0:00:44 264000 -- (-1127.264) (-1129.174) (-1127.009) [-1128.732] * [-1126.546] (-1129.713) (-1136.329) (-1127.674) -- 0:00:44 264500 -- (-1128.304) [-1131.588] (-1128.333) (-1127.895) * [-1129.181] (-1130.213) (-1128.822) (-1129.545) -- 0:00:44 265000 -- (-1132.128) (-1129.981) (-1130.192) [-1129.673] * (-1126.660) (-1128.733) [-1129.570] (-1129.354) -- 0:00:44 Average standard deviation of split frequencies: 0.018973 265500 -- (-1132.624) (-1131.421) [-1127.836] (-1132.532) * [-1128.997] (-1128.913) (-1128.695) (-1128.334) -- 0:00:44 266000 -- (-1129.555) (-1129.671) [-1129.072] (-1129.241) * (-1131.709) (-1127.804) [-1129.215] (-1127.526) -- 0:00:44 266500 -- (-1133.587) (-1137.582) [-1129.678] (-1129.266) * [-1128.167] (-1128.711) (-1127.669) (-1128.221) -- 0:00:44 267000 -- [-1127.463] (-1134.696) (-1127.812) (-1126.867) * [-1128.167] (-1129.705) (-1130.658) (-1126.905) -- 0:00:43 267500 -- (-1127.074) [-1126.902] (-1127.012) (-1128.268) * (-1128.329) [-1131.407] (-1128.008) (-1128.589) -- 0:00:43 268000 -- (-1135.798) [-1126.968] (-1127.587) (-1128.248) * (-1127.749) (-1129.617) (-1128.155) [-1128.524] -- 0:00:43 268500 -- (-1129.920) (-1131.908) (-1128.176) [-1131.253] * (-1127.759) (-1128.806) (-1127.669) [-1127.251] -- 0:00:43 269000 -- (-1130.287) [-1129.120] (-1128.351) (-1131.690) * (-1128.618) [-1127.327] (-1129.484) (-1129.446) -- 0:00:43 269500 -- (-1128.687) (-1133.515) (-1128.806) [-1130.383] * [-1128.485] (-1127.834) (-1127.418) (-1135.424) -- 0:00:43 270000 -- (-1130.343) (-1129.560) [-1128.771] (-1128.713) * (-1126.657) (-1129.089) [-1129.149] (-1128.137) -- 0:00:43 Average standard deviation of split frequencies: 0.018748 270500 -- (-1129.346) [-1127.352] (-1130.276) (-1127.906) * (-1128.191) (-1130.543) (-1130.690) [-1126.627] -- 0:00:43 271000 -- (-1127.839) (-1128.989) [-1126.831] (-1128.372) * (-1131.812) [-1129.599] (-1127.783) (-1131.018) -- 0:00:45 271500 -- (-1130.754) [-1127.207] (-1127.106) (-1131.146) * (-1131.185) [-1127.373] (-1133.888) (-1128.875) -- 0:00:45 272000 -- [-1127.056] (-1127.513) (-1127.166) (-1129.682) * (-1127.963) (-1127.273) [-1132.650] (-1127.162) -- 0:00:45 272500 -- (-1129.430) [-1126.768] (-1126.625) (-1127.535) * (-1130.325) [-1127.094] (-1134.579) (-1127.274) -- 0:00:45 273000 -- (-1130.612) (-1128.799) [-1128.586] (-1130.680) * (-1126.777) (-1129.233) (-1130.884) [-1126.818] -- 0:00:45 273500 -- (-1130.242) (-1129.870) [-1129.060] (-1129.307) * (-1134.163) (-1131.983) [-1129.055] (-1127.066) -- 0:00:45 274000 -- (-1127.897) (-1127.613) [-1128.754] (-1129.228) * [-1128.196] (-1133.201) (-1128.413) (-1127.112) -- 0:00:45 274500 -- (-1128.643) [-1127.149] (-1130.491) (-1131.284) * (-1127.619) (-1130.693) (-1128.924) [-1128.147] -- 0:00:44 275000 -- (-1128.263) (-1128.403) (-1130.088) [-1133.039] * (-1127.805) (-1127.726) (-1133.546) [-1127.274] -- 0:00:44 Average standard deviation of split frequencies: 0.019215 275500 -- (-1128.491) (-1128.542) [-1127.413] (-1132.394) * (-1129.311) [-1127.973] (-1129.171) (-1127.274) -- 0:00:44 276000 -- (-1131.036) (-1129.536) [-1129.828] (-1130.077) * (-1133.326) (-1127.343) (-1128.116) [-1127.461] -- 0:00:44 276500 -- [-1133.158] (-1127.178) (-1129.385) (-1131.357) * (-1134.115) (-1129.270) [-1128.574] (-1131.220) -- 0:00:44 277000 -- (-1130.979) (-1127.402) [-1129.817] (-1129.825) * (-1128.506) (-1128.871) (-1126.628) [-1127.904] -- 0:00:44 277500 -- (-1129.489) (-1129.522) [-1129.377] (-1129.786) * (-1127.304) (-1129.567) (-1127.248) [-1129.388] -- 0:00:44 278000 -- (-1129.603) [-1127.144] (-1127.386) (-1129.995) * (-1135.657) (-1129.125) (-1127.117) [-1127.782] -- 0:00:44 278500 -- [-1129.745] (-1128.491) (-1130.206) (-1128.688) * (-1127.039) (-1132.021) [-1128.730] (-1127.280) -- 0:00:44 279000 -- (-1128.531) (-1131.312) (-1128.064) [-1128.271] * (-1127.474) [-1128.804] (-1128.773) (-1129.091) -- 0:00:43 279500 -- [-1126.599] (-1127.644) (-1127.381) (-1128.902) * [-1128.711] (-1130.208) (-1128.913) (-1128.413) -- 0:00:43 280000 -- (-1128.100) [-1128.161] (-1128.030) (-1137.876) * (-1127.008) [-1128.387] (-1129.956) (-1127.288) -- 0:00:43 Average standard deviation of split frequencies: 0.017636 280500 -- (-1129.101) [-1127.575] (-1128.180) (-1130.225) * [-1127.681] (-1130.343) (-1131.380) (-1126.847) -- 0:00:43 281000 -- (-1130.499) (-1130.886) (-1127.251) [-1129.035] * (-1128.725) (-1130.118) (-1132.708) [-1127.500] -- 0:00:43 281500 -- (-1130.613) (-1128.563) (-1129.158) [-1127.950] * (-1132.221) (-1130.715) [-1128.333] (-1127.498) -- 0:00:43 282000 -- (-1129.618) (-1127.656) [-1128.152] (-1126.929) * (-1130.072) (-1128.035) [-1128.757] (-1127.226) -- 0:00:43 282500 -- [-1128.243] (-1127.565) (-1131.688) (-1127.855) * (-1127.908) (-1127.625) (-1126.284) [-1126.989] -- 0:00:43 283000 -- (-1126.645) [-1127.969] (-1131.650) (-1128.525) * (-1127.535) [-1128.832] (-1130.438) (-1126.740) -- 0:00:43 283500 -- (-1129.679) (-1127.705) (-1129.964) [-1127.159] * (-1130.457) (-1133.597) [-1127.732] (-1128.246) -- 0:00:42 284000 -- (-1128.798) (-1130.581) (-1130.081) [-1128.224] * (-1127.834) (-1128.344) (-1128.286) [-1126.294] -- 0:00:42 284500 -- (-1128.973) [-1128.788] (-1131.236) (-1127.267) * (-1128.196) (-1128.318) (-1128.309) [-1127.737] -- 0:00:42 285000 -- (-1128.733) [-1130.341] (-1130.383) (-1129.750) * (-1130.183) (-1128.137) [-1130.409] (-1126.803) -- 0:00:42 Average standard deviation of split frequencies: 0.017307 285500 -- (-1128.095) [-1130.749] (-1129.352) (-1130.326) * (-1126.775) (-1127.457) (-1129.017) [-1127.407] -- 0:00:42 286000 -- (-1128.494) [-1130.544] (-1129.698) (-1128.818) * (-1126.784) (-1127.722) [-1128.374] (-1130.440) -- 0:00:42 286500 -- (-1127.359) (-1130.300) (-1130.124) [-1133.410] * [-1127.166] (-1128.950) (-1132.220) (-1127.916) -- 0:00:44 287000 -- (-1128.455) [-1128.448] (-1128.690) (-1129.241) * (-1128.461) [-1128.886] (-1131.238) (-1127.653) -- 0:00:44 287500 -- (-1130.590) (-1128.180) [-1132.094] (-1129.388) * (-1129.468) (-1128.413) (-1133.314) [-1128.021] -- 0:00:44 288000 -- (-1128.666) (-1126.924) (-1130.873) [-1129.515] * [-1129.977] (-1130.617) (-1128.450) (-1129.399) -- 0:00:44 288500 -- [-1127.605] (-1128.415) (-1135.255) (-1132.466) * (-1127.731) [-1131.797] (-1128.814) (-1133.019) -- 0:00:44 289000 -- (-1131.015) (-1129.174) (-1134.814) [-1131.037] * [-1132.722] (-1132.244) (-1128.283) (-1130.277) -- 0:00:44 289500 -- (-1132.260) [-1128.539] (-1129.328) (-1128.024) * (-1131.097) [-1127.163] (-1128.860) (-1128.019) -- 0:00:44 290000 -- (-1128.084) [-1128.130] (-1128.172) (-1128.494) * (-1129.460) (-1127.996) (-1129.036) [-1128.401] -- 0:00:44 Average standard deviation of split frequencies: 0.017407 290500 -- (-1128.474) (-1127.789) [-1128.499] (-1129.145) * (-1130.957) (-1130.171) (-1132.210) [-1128.590] -- 0:00:43 291000 -- [-1133.745] (-1128.320) (-1128.425) (-1131.016) * (-1128.943) (-1128.907) [-1130.637] (-1134.746) -- 0:00:43 291500 -- (-1128.217) [-1131.352] (-1129.174) (-1131.695) * (-1128.940) (-1128.347) (-1135.043) [-1127.238] -- 0:00:43 292000 -- (-1132.598) [-1133.209] (-1127.770) (-1134.807) * (-1130.699) (-1128.132) (-1130.037) [-1128.292] -- 0:00:43 292500 -- [-1127.822] (-1128.647) (-1128.382) (-1130.512) * (-1131.159) [-1128.990] (-1128.876) (-1128.355) -- 0:00:43 293000 -- (-1127.015) [-1129.029] (-1129.601) (-1130.216) * (-1127.972) [-1128.913] (-1126.956) (-1129.636) -- 0:00:43 293500 -- [-1127.368] (-1127.073) (-1128.862) (-1128.151) * (-1128.027) [-1127.461] (-1128.461) (-1132.076) -- 0:00:43 294000 -- (-1127.479) (-1127.040) [-1128.138] (-1126.965) * (-1133.915) [-1128.375] (-1127.729) (-1129.191) -- 0:00:43 294500 -- (-1127.444) [-1129.984] (-1129.543) (-1129.157) * [-1128.348] (-1129.070) (-1127.725) (-1127.701) -- 0:00:43 295000 -- (-1127.939) (-1128.552) [-1127.095] (-1129.603) * (-1130.929) (-1127.446) [-1126.717] (-1130.060) -- 0:00:43 Average standard deviation of split frequencies: 0.017618 295500 -- [-1128.754] (-1127.671) (-1126.447) (-1128.071) * [-1127.958] (-1127.343) (-1126.681) (-1129.915) -- 0:00:42 296000 -- (-1129.059) (-1129.063) (-1126.452) [-1132.152] * (-1127.809) (-1127.345) (-1130.265) [-1127.823] -- 0:00:42 296500 -- (-1130.364) [-1129.848] (-1128.262) (-1132.344) * [-1130.608] (-1129.545) (-1129.978) (-1131.887) -- 0:00:42 297000 -- (-1131.972) (-1129.227) (-1127.858) [-1127.775] * (-1128.219) (-1129.288) [-1130.229] (-1129.671) -- 0:00:42 297500 -- [-1131.048] (-1128.322) (-1127.442) (-1127.470) * (-1127.110) (-1127.807) [-1126.450] (-1129.596) -- 0:00:42 298000 -- (-1131.824) [-1130.470] (-1128.112) (-1127.439) * [-1127.757] (-1130.960) (-1130.023) (-1131.806) -- 0:00:42 298500 -- (-1128.674) (-1129.983) (-1129.418) [-1132.607] * (-1130.057) [-1129.004] (-1128.643) (-1134.350) -- 0:00:42 299000 -- (-1128.308) (-1128.275) [-1132.055] (-1130.216) * [-1127.402] (-1128.588) (-1127.298) (-1132.550) -- 0:00:42 299500 -- (-1127.661) (-1130.522) (-1127.529) [-1128.541] * (-1130.836) (-1129.326) (-1126.802) [-1130.013] -- 0:00:42 300000 -- (-1127.408) [-1127.537] (-1127.021) (-1127.994) * (-1128.345) (-1128.379) [-1132.196] (-1128.603) -- 0:00:42 Average standard deviation of split frequencies: 0.016933 300500 -- [-1126.502] (-1127.613) (-1127.077) (-1127.821) * (-1132.022) [-1128.709] (-1129.536) (-1129.093) -- 0:00:41 301000 -- (-1127.531) (-1130.325) (-1130.784) [-1129.907] * [-1130.177] (-1128.159) (-1129.490) (-1130.687) -- 0:00:41 301500 -- (-1129.948) [-1130.596] (-1129.833) (-1130.169) * (-1131.682) (-1129.094) (-1127.147) [-1130.361] -- 0:00:41 302000 -- (-1128.841) [-1128.550] (-1135.231) (-1128.665) * (-1131.117) [-1127.496] (-1130.513) (-1127.129) -- 0:00:43 302500 -- [-1128.360] (-1126.989) (-1126.431) (-1128.632) * (-1130.957) [-1128.117] (-1128.910) (-1127.538) -- 0:00:43 303000 -- (-1128.468) (-1127.262) [-1128.000] (-1128.017) * (-1127.452) (-1128.387) (-1129.758) [-1127.505] -- 0:00:43 303500 -- (-1129.055) (-1129.860) [-1127.738] (-1126.530) * (-1128.967) (-1126.950) (-1128.208) [-1127.682] -- 0:00:43 304000 -- (-1128.665) [-1131.468] (-1129.938) (-1129.956) * (-1128.283) (-1128.750) [-1130.697] (-1127.208) -- 0:00:43 304500 -- [-1128.568] (-1130.210) (-1127.160) (-1129.558) * (-1127.921) (-1128.505) (-1129.450) [-1127.337] -- 0:00:43 305000 -- (-1128.601) [-1130.353] (-1128.480) (-1128.254) * (-1132.685) (-1133.652) [-1126.842] (-1128.436) -- 0:00:43 Average standard deviation of split frequencies: 0.015768 305500 -- (-1130.210) (-1134.094) (-1129.322) [-1127.909] * [-1132.341] (-1132.244) (-1126.562) (-1128.199) -- 0:00:43 306000 -- (-1129.795) (-1131.505) (-1127.637) [-1129.433] * [-1127.928] (-1127.492) (-1127.029) (-1133.063) -- 0:00:43 306500 -- [-1127.936] (-1130.045) (-1131.760) (-1127.449) * [-1129.183] (-1131.156) (-1131.326) (-1134.809) -- 0:00:42 307000 -- (-1129.095) (-1127.429) (-1132.766) [-1128.155] * (-1127.800) (-1129.117) [-1132.658] (-1128.531) -- 0:00:42 307500 -- [-1131.571] (-1128.707) (-1129.093) (-1130.922) * (-1127.139) [-1130.112] (-1128.014) (-1128.356) -- 0:00:42 308000 -- (-1136.922) [-1131.911] (-1127.744) (-1133.486) * (-1127.237) (-1128.741) [-1127.982] (-1127.355) -- 0:00:42 308500 -- (-1127.728) (-1132.798) (-1133.056) [-1128.995] * (-1127.398) (-1129.328) (-1127.848) [-1127.600] -- 0:00:42 309000 -- (-1134.095) (-1133.105) [-1127.744] (-1133.790) * (-1129.231) (-1126.558) (-1126.900) [-1128.263] -- 0:00:42 309500 -- (-1127.929) (-1130.807) [-1126.362] (-1132.956) * (-1130.095) (-1127.844) (-1126.900) [-1130.866] -- 0:00:42 310000 -- (-1127.257) [-1129.311] (-1126.484) (-1130.508) * [-1128.262] (-1128.799) (-1129.510) (-1128.154) -- 0:00:42 Average standard deviation of split frequencies: 0.016407 310500 -- (-1136.068) (-1126.902) [-1126.983] (-1128.292) * (-1129.766) (-1127.241) (-1128.628) [-1128.229] -- 0:00:42 311000 -- (-1129.926) (-1128.915) [-1127.823] (-1128.071) * (-1129.225) (-1127.366) [-1128.241] (-1128.105) -- 0:00:42 311500 -- (-1127.869) (-1132.015) [-1126.696] (-1133.766) * (-1127.705) (-1127.360) (-1128.832) [-1133.270] -- 0:00:41 312000 -- [-1127.366] (-1129.946) (-1128.833) (-1129.470) * (-1129.075) (-1128.362) (-1129.687) [-1131.894] -- 0:00:41 312500 -- (-1127.652) [-1129.933] (-1127.510) (-1129.721) * [-1128.388] (-1129.191) (-1132.239) (-1143.219) -- 0:00:41 313000 -- (-1128.378) (-1126.844) [-1128.524] (-1127.761) * [-1127.956] (-1129.562) (-1134.098) (-1128.822) -- 0:00:41 313500 -- (-1129.949) (-1127.856) [-1128.883] (-1129.002) * [-1127.263] (-1129.349) (-1131.078) (-1131.541) -- 0:00:41 314000 -- (-1129.034) (-1128.134) (-1127.332) [-1129.017] * (-1126.468) [-1130.128] (-1128.623) (-1129.058) -- 0:00:41 314500 -- (-1127.236) (-1128.025) (-1127.653) [-1126.812] * (-1126.587) [-1129.697] (-1128.660) (-1128.344) -- 0:00:41 315000 -- (-1127.135) [-1132.190] (-1127.848) (-1127.842) * (-1130.019) (-1128.300) [-1128.702] (-1127.457) -- 0:00:41 Average standard deviation of split frequencies: 0.015117 315500 -- [-1126.624] (-1129.402) (-1128.480) (-1127.170) * [-1128.347] (-1130.431) (-1127.148) (-1127.958) -- 0:00:41 316000 -- (-1128.189) [-1129.870] (-1129.554) (-1127.252) * (-1130.250) (-1128.880) [-1126.879] (-1128.434) -- 0:00:41 316500 -- (-1128.974) (-1127.916) [-1129.056] (-1129.192) * (-1127.631) [-1128.649] (-1129.607) (-1130.362) -- 0:00:41 317000 -- (-1132.303) (-1128.878) (-1128.654) [-1130.562] * (-1127.696) (-1128.260) (-1131.628) [-1127.680] -- 0:00:40 317500 -- (-1127.581) (-1128.210) [-1128.923] (-1128.751) * [-1127.976] (-1128.118) (-1130.104) (-1127.874) -- 0:00:40 318000 -- (-1129.145) (-1131.146) [-1130.983] (-1129.830) * (-1126.939) (-1129.318) (-1129.271) [-1127.735] -- 0:00:42 318500 -- (-1128.494) (-1129.081) (-1128.736) [-1134.420] * [-1130.274] (-1129.866) (-1129.267) (-1133.102) -- 0:00:42 319000 -- (-1130.185) (-1131.645) [-1131.471] (-1130.496) * (-1128.748) [-1128.862] (-1128.436) (-1133.002) -- 0:00:42 319500 -- (-1128.961) (-1128.814) [-1128.356] (-1129.677) * [-1129.862] (-1129.581) (-1127.217) (-1128.514) -- 0:00:42 320000 -- (-1128.940) (-1126.700) (-1128.836) [-1127.904] * (-1127.458) [-1128.342] (-1126.919) (-1126.898) -- 0:00:42 Average standard deviation of split frequencies: 0.014793 320500 -- (-1127.921) (-1128.731) (-1129.331) [-1127.504] * (-1130.725) (-1129.264) (-1128.263) [-1130.677] -- 0:00:42 321000 -- [-1127.905] (-1128.880) (-1131.316) (-1127.502) * (-1132.268) [-1127.283] (-1130.445) (-1128.778) -- 0:00:42 321500 -- [-1130.007] (-1127.387) (-1129.270) (-1130.868) * (-1128.794) [-1135.367] (-1127.677) (-1131.874) -- 0:00:42 322000 -- [-1128.816] (-1127.471) (-1131.159) (-1128.008) * (-1130.745) (-1136.123) [-1127.748] (-1130.160) -- 0:00:42 322500 -- (-1128.984) (-1126.619) (-1132.547) [-1128.014] * [-1128.196] (-1136.903) (-1126.547) (-1127.240) -- 0:00:42 323000 -- (-1128.590) (-1127.612) [-1127.270] (-1130.404) * [-1127.890] (-1129.971) (-1133.925) (-1127.458) -- 0:00:41 323500 -- (-1128.953) (-1127.222) (-1127.796) [-1131.041] * (-1130.167) (-1128.982) [-1130.972] (-1131.113) -- 0:00:41 324000 -- (-1131.441) (-1126.642) [-1127.299] (-1130.565) * (-1127.454) (-1128.398) [-1128.624] (-1128.077) -- 0:00:41 324500 -- (-1133.506) [-1127.841] (-1127.327) (-1130.205) * (-1129.643) (-1129.247) [-1126.304] (-1127.122) -- 0:00:41 325000 -- [-1127.796] (-1128.725) (-1127.464) (-1127.158) * (-1127.846) (-1131.559) [-1128.622] (-1128.879) -- 0:00:41 Average standard deviation of split frequencies: 0.013818 325500 -- (-1131.651) (-1130.570) (-1129.860) [-1128.942] * [-1127.596] (-1128.310) (-1128.978) (-1128.165) -- 0:00:41 326000 -- (-1126.861) (-1131.137) [-1129.460] (-1127.215) * (-1129.426) (-1126.396) [-1128.380] (-1128.203) -- 0:00:41 326500 -- (-1127.176) (-1129.689) [-1128.767] (-1127.589) * (-1128.433) (-1127.422) [-1128.989] (-1128.168) -- 0:00:41 327000 -- (-1127.229) (-1127.435) (-1130.824) [-1130.386] * (-1127.686) (-1128.688) (-1130.845) [-1128.547] -- 0:00:41 327500 -- [-1127.209] (-1126.660) (-1130.016) (-1129.570) * (-1128.124) (-1127.347) [-1129.764] (-1128.893) -- 0:00:41 328000 -- (-1127.266) [-1129.327] (-1132.440) (-1132.380) * (-1127.524) [-1132.829] (-1138.078) (-1129.732) -- 0:00:40 328500 -- [-1127.254] (-1128.317) (-1129.469) (-1134.430) * (-1127.494) (-1129.344) [-1128.406] (-1129.543) -- 0:00:40 329000 -- (-1127.160) [-1128.531] (-1128.454) (-1127.810) * (-1130.319) (-1129.320) (-1127.448) [-1127.880] -- 0:00:40 329500 -- (-1127.367) (-1129.441) (-1129.196) [-1129.708] * (-1129.313) (-1130.121) (-1130.916) [-1127.861] -- 0:00:40 330000 -- (-1129.780) (-1127.938) (-1129.105) [-1131.910] * (-1131.188) [-1128.868] (-1130.035) (-1128.621) -- 0:00:40 Average standard deviation of split frequencies: 0.013334 330500 -- (-1128.895) [-1127.266] (-1129.536) (-1134.255) * (-1127.272) (-1126.391) [-1127.582] (-1129.135) -- 0:00:40 331000 -- (-1126.908) (-1128.386) [-1128.641] (-1133.327) * (-1126.574) [-1126.508] (-1131.304) (-1128.898) -- 0:00:40 331500 -- (-1130.979) (-1128.588) (-1131.122) [-1130.232] * (-1126.977) (-1127.027) (-1136.900) [-1128.248] -- 0:00:40 332000 -- (-1130.486) [-1127.541] (-1129.550) (-1128.297) * (-1126.799) [-1130.312] (-1132.262) (-1127.238) -- 0:00:40 332500 -- (-1128.188) [-1128.847] (-1129.121) (-1131.084) * [-1128.315] (-1129.502) (-1128.823) (-1126.895) -- 0:00:40 333000 -- (-1127.877) [-1127.967] (-1128.169) (-1127.980) * (-1129.785) [-1128.468] (-1129.854) (-1127.606) -- 0:00:40 333500 -- [-1128.582] (-1128.055) (-1132.214) (-1128.051) * (-1130.673) (-1126.792) (-1133.104) [-1127.172] -- 0:00:39 334000 -- [-1126.852] (-1127.458) (-1131.118) (-1126.858) * (-1127.949) (-1129.328) [-1129.473] (-1129.773) -- 0:00:41 334500 -- (-1130.220) (-1128.024) [-1130.489] (-1128.594) * [-1126.992] (-1130.400) (-1128.388) (-1129.775) -- 0:00:41 335000 -- (-1130.302) [-1127.803] (-1130.019) (-1127.459) * (-1127.823) [-1130.639] (-1128.307) (-1133.667) -- 0:00:41 Average standard deviation of split frequencies: 0.013153 335500 -- (-1130.039) (-1128.405) [-1128.966] (-1127.397) * (-1128.091) (-1130.649) [-1131.805] (-1127.372) -- 0:00:41 336000 -- (-1128.586) (-1128.631) (-1129.942) [-1128.245] * (-1129.186) (-1129.826) [-1129.836] (-1126.820) -- 0:00:41 336500 -- (-1127.553) [-1129.935] (-1131.482) (-1128.317) * [-1127.941] (-1128.178) (-1129.885) (-1127.356) -- 0:00:41 337000 -- (-1131.565) (-1132.500) [-1127.003] (-1133.337) * (-1128.585) (-1128.663) (-1126.717) [-1133.342] -- 0:00:41 337500 -- (-1126.942) [-1129.542] (-1128.996) (-1128.145) * (-1128.504) (-1128.438) (-1127.035) [-1128.841] -- 0:00:41 338000 -- (-1130.330) [-1130.539] (-1130.700) (-1127.636) * (-1129.160) [-1129.857] (-1127.743) (-1129.453) -- 0:00:41 338500 -- (-1128.848) (-1129.816) (-1129.069) [-1129.287] * [-1128.373] (-1131.961) (-1130.110) (-1131.032) -- 0:00:41 339000 -- (-1130.045) (-1130.020) (-1128.675) [-1131.712] * (-1127.743) (-1130.535) (-1127.790) [-1131.622] -- 0:00:40 339500 -- (-1130.391) [-1128.737] (-1130.891) (-1127.959) * (-1129.869) [-1128.089] (-1126.796) (-1132.241) -- 0:00:40 340000 -- (-1129.068) (-1129.079) (-1133.989) [-1128.912] * (-1129.785) [-1126.466] (-1127.234) (-1128.764) -- 0:00:40 Average standard deviation of split frequencies: 0.012800 340500 -- (-1127.546) (-1129.557) [-1127.613] (-1129.726) * (-1130.341) (-1129.212) (-1129.006) [-1127.983] -- 0:00:40 341000 -- (-1127.348) (-1127.239) (-1128.941) [-1129.634] * (-1128.887) (-1128.843) [-1128.521] (-1126.999) -- 0:00:40 341500 -- (-1128.700) (-1128.075) (-1129.401) [-1129.835] * (-1127.913) (-1126.887) (-1127.681) [-1128.275] -- 0:00:40 342000 -- [-1130.525] (-1128.189) (-1129.249) (-1128.477) * [-1128.673] (-1126.854) (-1132.244) (-1126.416) -- 0:00:40 342500 -- (-1129.070) (-1126.922) [-1130.582] (-1128.705) * (-1129.228) (-1127.459) (-1130.735) [-1127.150] -- 0:00:40 343000 -- [-1128.010] (-1128.473) (-1130.301) (-1127.893) * (-1134.045) (-1132.179) [-1128.957] (-1129.599) -- 0:00:40 343500 -- (-1128.991) (-1127.354) (-1129.538) [-1127.253] * (-1130.344) (-1128.864) (-1128.015) [-1128.413] -- 0:00:40 344000 -- (-1127.992) [-1127.882] (-1131.589) (-1129.270) * [-1126.955] (-1128.268) (-1127.863) (-1129.036) -- 0:00:40 344500 -- (-1127.978) [-1128.140] (-1130.396) (-1127.545) * [-1126.647] (-1130.148) (-1128.131) (-1126.819) -- 0:00:39 345000 -- (-1128.510) (-1128.123) [-1127.720] (-1128.770) * (-1127.852) (-1129.917) [-1130.176] (-1126.497) -- 0:00:39 Average standard deviation of split frequencies: 0.013224 345500 -- (-1126.563) (-1128.005) (-1128.423) [-1129.701] * (-1128.223) (-1127.102) (-1128.317) [-1127.811] -- 0:00:39 346000 -- [-1130.046] (-1128.343) (-1127.570) (-1130.824) * (-1129.309) (-1127.353) [-1128.281] (-1127.034) -- 0:00:39 346500 -- (-1127.259) (-1128.097) (-1129.182) [-1126.519] * [-1128.757] (-1132.365) (-1126.902) (-1128.019) -- 0:00:39 347000 -- [-1132.099] (-1127.773) (-1129.205) (-1128.678) * (-1130.523) (-1133.765) [-1127.942] (-1128.689) -- 0:00:39 347500 -- [-1130.207] (-1131.691) (-1128.626) (-1128.184) * (-1129.695) (-1129.639) [-1130.955] (-1132.020) -- 0:00:39 348000 -- (-1127.941) (-1130.661) (-1128.045) [-1127.210] * [-1127.276] (-1130.460) (-1126.697) (-1129.073) -- 0:00:39 348500 -- (-1128.108) (-1132.956) (-1128.491) [-1127.577] * (-1129.235) (-1130.333) (-1128.675) [-1127.189] -- 0:00:39 349000 -- (-1130.321) (-1128.619) (-1128.365) [-1127.408] * [-1128.950] (-1130.654) (-1127.352) (-1127.955) -- 0:00:39 349500 -- (-1131.314) (-1127.975) (-1128.194) [-1130.461] * (-1127.444) (-1128.467) (-1127.358) [-1127.358] -- 0:00:39 350000 -- (-1133.052) (-1129.065) [-1128.655] (-1127.249) * (-1129.282) (-1139.395) [-1127.252] (-1129.308) -- 0:00:40 Average standard deviation of split frequencies: 0.013680 350500 -- (-1128.155) (-1129.746) [-1126.990] (-1127.369) * (-1130.183) (-1131.748) [-1128.780] (-1133.014) -- 0:00:40 351000 -- (-1129.249) [-1129.890] (-1127.008) (-1128.451) * [-1129.833] (-1132.141) (-1126.436) (-1130.254) -- 0:00:40 351500 -- (-1129.386) (-1127.121) [-1131.164] (-1128.359) * [-1126.825] (-1130.797) (-1126.446) (-1128.779) -- 0:00:40 352000 -- (-1127.496) (-1128.065) [-1129.559] (-1128.328) * (-1129.153) (-1129.338) [-1128.294] (-1129.683) -- 0:00:40 352500 -- (-1127.262) (-1127.708) [-1129.544] (-1127.568) * (-1127.705) [-1130.761] (-1131.550) (-1131.090) -- 0:00:40 353000 -- (-1131.639) (-1127.465) [-1128.235] (-1130.617) * (-1126.488) (-1129.391) (-1129.816) [-1131.001] -- 0:00:40 353500 -- [-1128.098] (-1127.359) (-1128.286) (-1132.505) * [-1126.953] (-1131.778) (-1131.401) (-1127.255) -- 0:00:40 354000 -- (-1128.356) [-1127.416] (-1128.824) (-1126.392) * (-1126.953) (-1128.627) (-1130.906) [-1130.125] -- 0:00:40 354500 -- [-1128.375] (-1130.086) (-1128.779) (-1129.060) * (-1127.349) (-1129.510) [-1128.051] (-1128.269) -- 0:00:40 355000 -- (-1126.883) (-1127.086) [-1128.099] (-1126.638) * (-1127.022) (-1127.100) (-1130.932) [-1127.676] -- 0:00:39 Average standard deviation of split frequencies: 0.012619 355500 -- [-1126.955] (-1128.168) (-1128.210) (-1127.106) * (-1128.892) [-1127.956] (-1127.632) (-1132.267) -- 0:00:39 356000 -- (-1127.178) [-1127.326] (-1132.200) (-1127.422) * (-1128.610) (-1129.102) [-1130.813] (-1133.510) -- 0:00:39 356500 -- (-1129.286) [-1127.584] (-1129.083) (-1126.869) * (-1128.502) (-1129.892) (-1134.498) [-1131.381] -- 0:00:39 357000 -- (-1128.258) [-1127.871] (-1129.885) (-1126.764) * [-1127.849] (-1128.771) (-1129.006) (-1132.987) -- 0:00:39 357500 -- (-1132.866) (-1127.546) (-1127.429) [-1128.008] * (-1128.703) [-1127.749] (-1127.135) (-1128.968) -- 0:00:39 358000 -- (-1127.789) [-1129.724] (-1128.712) (-1129.589) * (-1128.965) (-1129.728) [-1126.802] (-1127.871) -- 0:00:39 358500 -- (-1126.894) (-1132.957) (-1126.942) [-1129.685] * (-1127.107) [-1128.569] (-1127.497) (-1126.756) -- 0:00:39 359000 -- (-1127.609) (-1127.111) [-1129.869] (-1129.643) * (-1128.303) (-1129.358) (-1129.234) [-1128.105] -- 0:00:39 359500 -- (-1129.221) (-1129.306) [-1130.130] (-1133.791) * (-1130.963) [-1128.984] (-1129.506) (-1127.211) -- 0:00:39 360000 -- (-1134.877) [-1127.528] (-1133.041) (-1131.726) * (-1131.676) (-1129.049) [-1133.216] (-1128.273) -- 0:00:39 Average standard deviation of split frequencies: 0.012686 360500 -- (-1126.769) (-1128.330) [-1133.492] (-1128.031) * (-1127.787) (-1127.162) (-1129.950) [-1127.598] -- 0:00:39 361000 -- (-1129.029) (-1128.883) (-1137.174) [-1128.398] * [-1128.166] (-1127.365) (-1130.803) (-1126.649) -- 0:00:38 361500 -- (-1129.037) [-1130.129] (-1133.801) (-1129.769) * (-1130.123) (-1129.277) (-1129.142) [-1126.929] -- 0:00:38 362000 -- (-1129.590) (-1131.202) [-1130.000] (-1130.223) * (-1128.616) [-1129.169] (-1127.779) (-1126.766) -- 0:00:38 362500 -- (-1130.485) (-1130.934) [-1126.942] (-1126.454) * (-1127.319) (-1128.825) (-1128.048) [-1126.205] -- 0:00:38 363000 -- (-1130.126) (-1128.027) (-1128.118) [-1128.991] * [-1129.432] (-1127.931) (-1128.498) (-1126.438) -- 0:00:38 363500 -- (-1126.986) (-1128.173) [-1127.826] (-1129.219) * (-1127.760) [-1128.917] (-1133.782) (-1131.250) -- 0:00:38 364000 -- (-1127.567) (-1128.398) [-1129.117] (-1129.484) * [-1129.063] (-1127.507) (-1132.328) (-1130.316) -- 0:00:38 364500 -- [-1129.627] (-1133.369) (-1131.090) (-1128.758) * (-1129.302) [-1131.058] (-1129.671) (-1129.619) -- 0:00:38 365000 -- (-1127.797) (-1129.611) [-1127.618] (-1128.151) * (-1131.738) (-1129.096) [-1128.956] (-1129.790) -- 0:00:38 Average standard deviation of split frequencies: 0.012638 365500 -- (-1127.465) (-1131.582) (-1127.884) [-1128.309] * (-1129.503) (-1129.479) [-1129.225] (-1131.851) -- 0:00:38 366000 -- (-1126.806) (-1129.323) (-1126.927) [-1129.312] * (-1130.370) (-1128.851) [-1129.576] (-1128.283) -- 0:00:39 366500 -- [-1128.016] (-1129.694) (-1127.296) (-1128.485) * [-1127.344] (-1129.060) (-1127.692) (-1128.576) -- 0:00:39 367000 -- (-1129.567) (-1131.413) [-1126.691] (-1128.435) * (-1127.523) (-1132.184) (-1126.602) [-1128.858] -- 0:00:39 367500 -- (-1127.912) (-1129.462) (-1128.148) [-1128.144] * [-1129.412] (-1132.956) (-1126.897) (-1129.156) -- 0:00:39 368000 -- (-1128.494) (-1128.316) [-1127.446] (-1128.403) * (-1129.378) [-1127.146] (-1126.921) (-1130.532) -- 0:00:39 368500 -- (-1127.606) (-1126.527) [-1128.971] (-1128.189) * (-1126.756) [-1126.842] (-1131.941) (-1128.855) -- 0:00:39 369000 -- (-1128.325) [-1129.191] (-1129.869) (-1130.376) * (-1126.202) [-1128.737] (-1128.104) (-1134.648) -- 0:00:39 369500 -- (-1135.550) (-1127.867) [-1129.519] (-1129.685) * (-1127.852) (-1130.210) [-1129.281] (-1129.967) -- 0:00:39 370000 -- (-1130.258) (-1128.307) (-1127.828) [-1130.002] * (-1128.297) [-1130.310] (-1129.329) (-1128.085) -- 0:00:39 Average standard deviation of split frequencies: 0.012082 370500 -- (-1127.922) (-1128.274) [-1127.091] (-1127.580) * (-1127.889) [-1129.153] (-1127.101) (-1127.331) -- 0:00:39 371000 -- (-1131.677) [-1127.983] (-1129.667) (-1127.333) * (-1129.757) (-1130.023) (-1129.992) [-1126.317] -- 0:00:38 371500 -- (-1127.499) (-1131.934) (-1127.021) [-1133.043] * (-1127.002) (-1127.873) (-1128.932) [-1126.308] -- 0:00:38 372000 -- (-1135.702) (-1133.436) (-1130.571) [-1129.870] * [-1127.410] (-1128.415) (-1128.439) (-1127.958) -- 0:00:38 372500 -- (-1128.446) (-1131.467) (-1130.569) [-1127.575] * [-1126.523] (-1128.004) (-1130.379) (-1130.035) -- 0:00:38 373000 -- (-1128.351) (-1127.807) (-1127.326) [-1129.890] * [-1126.523] (-1130.309) (-1129.757) (-1128.628) -- 0:00:38 373500 -- (-1127.186) (-1127.192) (-1131.620) [-1128.256] * (-1127.560) (-1132.791) [-1127.775] (-1129.922) -- 0:00:38 374000 -- (-1127.290) [-1126.927] (-1127.170) (-1129.656) * (-1130.882) (-1126.569) (-1127.275) [-1130.526] -- 0:00:38 374500 -- (-1126.849) (-1127.123) [-1127.729] (-1129.154) * (-1128.374) (-1127.364) [-1127.069] (-1130.461) -- 0:00:38 375000 -- (-1126.850) [-1127.676] (-1126.408) (-1129.643) * (-1130.331) (-1130.932) (-1128.540) [-1133.624] -- 0:00:38 Average standard deviation of split frequencies: 0.012146 375500 -- (-1127.903) (-1128.628) [-1129.021] (-1128.574) * (-1129.472) (-1128.186) (-1127.523) [-1128.742] -- 0:00:38 376000 -- (-1128.351) [-1128.006] (-1129.206) (-1128.048) * (-1129.415) (-1136.585) (-1129.719) [-1128.865] -- 0:00:38 376500 -- (-1127.526) [-1127.967] (-1126.443) (-1128.886) * (-1128.441) [-1132.286] (-1129.840) (-1130.236) -- 0:00:38 377000 -- (-1129.175) [-1130.653] (-1127.547) (-1129.689) * [-1129.283] (-1128.907) (-1128.833) (-1132.299) -- 0:00:38 377500 -- (-1127.965) (-1132.377) [-1128.997] (-1128.572) * (-1128.460) (-1127.664) (-1127.243) [-1128.529] -- 0:00:37 378000 -- (-1127.146) (-1127.866) [-1126.693] (-1134.770) * [-1132.702] (-1130.341) (-1127.393) (-1129.186) -- 0:00:37 378500 -- [-1127.815] (-1128.964) (-1126.715) (-1127.027) * (-1130.942) (-1130.702) [-1128.984] (-1132.194) -- 0:00:37 379000 -- (-1127.985) [-1131.701] (-1129.061) (-1130.416) * (-1137.270) (-1128.573) [-1126.729] (-1127.560) -- 0:00:37 379500 -- (-1128.160) [-1129.565] (-1127.475) (-1127.300) * (-1128.878) [-1126.993] (-1126.781) (-1130.945) -- 0:00:37 380000 -- (-1127.103) (-1127.990) [-1129.946] (-1127.235) * (-1129.326) (-1128.063) [-1127.348] (-1131.602) -- 0:00:37 Average standard deviation of split frequencies: 0.011919 380500 -- [-1127.161] (-1128.261) (-1130.235) (-1127.407) * [-1126.621] (-1126.647) (-1129.810) (-1134.110) -- 0:00:37 381000 -- [-1129.680] (-1127.434) (-1129.763) (-1132.178) * (-1128.615) [-1126.899] (-1127.446) (-1128.487) -- 0:00:37 381500 -- (-1127.483) (-1128.636) (-1128.368) [-1130.721] * (-1129.811) [-1127.049] (-1131.176) (-1129.394) -- 0:00:37 382000 -- (-1128.377) (-1130.042) [-1133.460] (-1127.194) * (-1127.699) (-1129.988) [-1128.726] (-1128.651) -- 0:00:37 382500 -- [-1129.302] (-1128.967) (-1136.223) (-1126.865) * (-1127.916) [-1129.444] (-1130.474) (-1129.930) -- 0:00:38 383000 -- [-1127.515] (-1128.600) (-1129.429) (-1127.340) * (-1129.704) [-1127.612] (-1129.068) (-1129.823) -- 0:00:38 383500 -- [-1131.219] (-1128.639) (-1130.849) (-1126.483) * [-1129.569] (-1128.747) (-1129.318) (-1129.005) -- 0:00:38 384000 -- [-1129.428] (-1129.303) (-1132.731) (-1127.394) * (-1127.353) (-1129.483) [-1129.531] (-1126.804) -- 0:00:38 384500 -- (-1128.399) (-1132.470) [-1128.192] (-1128.323) * (-1129.426) (-1127.570) (-1128.825) [-1129.804] -- 0:00:38 385000 -- (-1128.220) (-1131.123) (-1128.479) [-1127.924] * (-1132.260) (-1130.881) [-1128.036] (-1127.646) -- 0:00:38 Average standard deviation of split frequencies: 0.011831 385500 -- (-1130.246) (-1127.779) (-1127.317) [-1128.692] * (-1129.950) (-1129.425) (-1128.729) [-1128.314] -- 0:00:38 386000 -- (-1128.420) (-1127.030) [-1130.818] (-1130.565) * (-1127.698) (-1129.222) [-1129.652] (-1127.558) -- 0:00:38 386500 -- [-1127.713] (-1128.862) (-1126.415) (-1128.525) * [-1128.627] (-1129.228) (-1129.776) (-1129.774) -- 0:00:38 387000 -- [-1127.601] (-1131.202) (-1130.978) (-1132.117) * (-1128.255) (-1126.981) [-1128.400] (-1127.247) -- 0:00:38 387500 -- [-1128.334] (-1131.463) (-1129.487) (-1128.704) * (-1130.149) (-1128.506) (-1127.761) [-1127.200] -- 0:00:37 388000 -- (-1127.647) (-1129.131) (-1128.833) [-1127.917] * (-1127.737) (-1128.331) (-1129.438) [-1129.308] -- 0:00:37 388500 -- [-1128.062] (-1129.695) (-1127.482) (-1127.921) * [-1127.515] (-1128.466) (-1128.581) (-1130.305) -- 0:00:37 389000 -- [-1128.650] (-1130.975) (-1127.133) (-1131.762) * (-1127.657) [-1132.448] (-1130.426) (-1133.924) -- 0:00:37 389500 -- [-1127.872] (-1129.037) (-1128.678) (-1129.085) * [-1127.343] (-1130.235) (-1126.766) (-1131.211) -- 0:00:37 390000 -- (-1127.563) (-1127.915) (-1132.071) [-1127.764] * [-1127.549] (-1131.213) (-1128.013) (-1127.572) -- 0:00:37 Average standard deviation of split frequencies: 0.011840 390500 -- (-1137.665) (-1129.487) (-1130.069) [-1128.667] * (-1129.332) (-1128.808) (-1127.990) [-1128.795] -- 0:00:37 391000 -- (-1134.033) [-1130.501] (-1127.523) (-1127.246) * (-1127.716) [-1130.080] (-1128.266) (-1128.754) -- 0:00:37 391500 -- [-1127.790] (-1129.437) (-1126.553) (-1126.716) * [-1128.974] (-1130.082) (-1129.233) (-1127.694) -- 0:00:37 392000 -- (-1129.376) (-1128.086) (-1129.685) [-1126.854] * (-1126.948) (-1128.471) [-1131.527] (-1127.038) -- 0:00:37 392500 -- (-1128.457) (-1131.304) (-1128.831) [-1127.647] * (-1127.676) (-1128.134) [-1127.598] (-1126.688) -- 0:00:37 393000 -- (-1129.310) [-1128.548] (-1129.496) (-1128.492) * (-1134.349) (-1128.113) [-1126.980] (-1126.716) -- 0:00:37 393500 -- (-1126.442) (-1131.498) [-1128.162] (-1128.675) * (-1132.773) [-1129.239] (-1132.717) (-1128.587) -- 0:00:36 394000 -- (-1126.752) (-1131.460) [-1127.821] (-1129.922) * (-1136.992) (-1130.779) [-1127.904] (-1129.531) -- 0:00:36 394500 -- (-1127.973) (-1128.448) [-1128.040] (-1128.360) * (-1131.630) (-1127.502) [-1130.259] (-1127.194) -- 0:00:36 395000 -- (-1130.658) (-1127.930) (-1127.175) [-1129.830] * (-1131.120) [-1127.552] (-1130.360) (-1130.522) -- 0:00:36 Average standard deviation of split frequencies: 0.011755 395500 -- (-1131.395) (-1132.191) (-1130.936) [-1128.299] * (-1131.099) [-1128.427] (-1128.898) (-1130.345) -- 0:00:36 396000 -- (-1132.716) [-1129.462] (-1133.722) (-1129.366) * (-1129.625) (-1129.230) [-1128.235] (-1132.603) -- 0:00:36 396500 -- (-1129.126) (-1129.090) [-1131.188] (-1127.851) * [-1127.109] (-1129.750) (-1128.113) (-1129.197) -- 0:00:36 397000 -- (-1128.120) (-1129.414) [-1130.049] (-1127.421) * [-1129.988] (-1127.802) (-1128.489) (-1127.732) -- 0:00:36 397500 -- [-1127.575] (-1128.228) (-1126.957) (-1127.493) * (-1131.586) (-1131.376) [-1128.610] (-1129.885) -- 0:00:36 398000 -- [-1128.004] (-1126.610) (-1128.835) (-1127.385) * (-1126.924) (-1127.578) [-1128.353] (-1128.290) -- 0:00:36 398500 -- (-1128.134) (-1126.898) [-1130.402] (-1127.371) * (-1127.046) [-1130.675] (-1130.769) (-1127.675) -- 0:00:36 399000 -- [-1127.567] (-1128.129) (-1129.709) (-1127.509) * (-1127.194) (-1130.485) (-1127.810) [-1131.157] -- 0:00:37 399500 -- [-1127.267] (-1126.919) (-1130.184) (-1126.601) * [-1127.423] (-1127.035) (-1127.515) (-1127.319) -- 0:00:37 400000 -- [-1127.567] (-1130.413) (-1137.113) (-1129.636) * (-1129.812) [-1127.638] (-1126.536) (-1130.487) -- 0:00:37 Average standard deviation of split frequencies: 0.012060 400500 -- (-1127.539) (-1128.427) [-1127.864] (-1129.437) * (-1129.050) (-1127.592) (-1128.211) [-1130.464] -- 0:00:37 401000 -- (-1127.635) [-1132.048] (-1126.633) (-1127.505) * [-1129.095] (-1130.371) (-1127.963) (-1128.905) -- 0:00:37 401500 -- [-1130.040] (-1133.348) (-1127.624) (-1128.854) * (-1127.988) (-1130.907) [-1128.851] (-1127.640) -- 0:00:37 402000 -- (-1130.982) (-1132.806) (-1127.002) [-1131.648] * (-1130.103) (-1130.122) [-1129.112] (-1127.239) -- 0:00:37 402500 -- (-1130.111) (-1135.856) [-1126.846] (-1129.031) * (-1129.895) [-1126.927] (-1129.426) (-1126.361) -- 0:00:37 403000 -- (-1127.219) (-1129.442) [-1127.080] (-1128.375) * (-1129.318) (-1128.597) (-1127.357) [-1131.500] -- 0:00:37 403500 -- [-1128.418] (-1128.716) (-1127.098) (-1127.721) * (-1128.444) [-1127.133] (-1128.998) (-1130.274) -- 0:00:36 404000 -- (-1131.877) (-1127.804) [-1127.974] (-1130.242) * (-1130.717) (-1127.319) (-1128.765) [-1127.451] -- 0:00:36 404500 -- (-1130.243) (-1136.730) [-1128.415] (-1127.915) * [-1128.495] (-1128.224) (-1128.628) (-1127.574) -- 0:00:36 405000 -- (-1129.940) (-1131.894) (-1131.763) [-1127.731] * (-1128.925) [-1126.972] (-1128.081) (-1133.872) -- 0:00:36 Average standard deviation of split frequencies: 0.011829 405500 -- [-1126.542] (-1130.035) (-1127.837) (-1127.079) * (-1130.983) (-1130.716) (-1128.035) [-1129.110] -- 0:00:36 406000 -- (-1128.180) (-1127.822) (-1127.656) [-1127.865] * (-1127.753) (-1128.727) (-1128.914) [-1130.441] -- 0:00:36 406500 -- (-1129.716) [-1130.328] (-1127.518) (-1127.815) * [-1128.051] (-1127.942) (-1126.878) (-1128.337) -- 0:00:36 407000 -- (-1130.415) (-1128.493) [-1127.292] (-1127.473) * (-1128.040) [-1127.298] (-1127.596) (-1130.353) -- 0:00:36 407500 -- (-1128.459) (-1129.323) (-1127.395) [-1129.034] * (-1133.983) (-1133.721) [-1127.825] (-1129.025) -- 0:00:36 408000 -- (-1128.864) (-1127.694) (-1127.543) [-1132.524] * (-1128.219) [-1129.877] (-1132.146) (-1130.165) -- 0:00:36 408500 -- (-1130.951) [-1130.202] (-1127.383) (-1130.439) * (-1127.676) (-1130.006) [-1128.387] (-1127.727) -- 0:00:36 409000 -- [-1129.644] (-1130.968) (-1127.501) (-1129.484) * (-1129.627) (-1129.170) (-1130.061) [-1129.274] -- 0:00:36 409500 -- (-1128.587) (-1127.794) (-1126.759) [-1128.378] * (-1127.959) (-1130.151) (-1130.721) [-1129.219] -- 0:00:36 410000 -- (-1127.402) [-1128.438] (-1127.496) (-1127.969) * (-1128.651) (-1128.569) [-1128.854] (-1128.518) -- 0:00:35 Average standard deviation of split frequencies: 0.011766 410500 -- (-1131.248) (-1128.676) (-1127.459) [-1132.219] * [-1127.127] (-1129.487) (-1128.418) (-1131.302) -- 0:00:35 411000 -- (-1127.813) [-1131.587] (-1130.372) (-1128.456) * (-1128.376) (-1130.244) (-1129.001) [-1128.167] -- 0:00:35 411500 -- (-1131.024) (-1129.289) [-1130.967] (-1133.694) * (-1127.301) [-1129.392] (-1128.777) (-1126.886) -- 0:00:35 412000 -- (-1127.311) [-1130.519] (-1126.807) (-1130.951) * (-1127.231) (-1127.754) (-1130.251) [-1128.180] -- 0:00:35 412500 -- (-1128.582) [-1133.412] (-1128.120) (-1127.653) * (-1128.046) (-1126.764) (-1129.902) [-1130.125] -- 0:00:35 413000 -- (-1128.111) (-1129.194) (-1128.471) [-1127.313] * (-1127.838) (-1129.979) [-1128.031] (-1129.282) -- 0:00:35 413500 -- (-1128.563) [-1126.306] (-1129.158) (-1127.136) * (-1129.911) (-1131.859) (-1130.061) [-1126.788] -- 0:00:35 414000 -- (-1128.204) (-1128.801) (-1131.530) [-1127.303] * (-1127.910) [-1127.666] (-1129.817) (-1129.442) -- 0:00:35 414500 -- (-1130.812) (-1128.251) (-1127.349) [-1127.304] * (-1127.640) [-1127.933] (-1127.394) (-1129.474) -- 0:00:35 415000 -- (-1128.899) [-1127.439] (-1129.967) (-1128.196) * (-1127.483) [-1131.885] (-1127.156) (-1129.604) -- 0:00:36 Average standard deviation of split frequencies: 0.011732 415500 -- (-1127.579) (-1127.557) (-1126.412) [-1126.794] * [-1127.202] (-1129.453) (-1127.600) (-1128.334) -- 0:00:36 416000 -- (-1129.889) (-1127.824) [-1127.971] (-1131.039) * [-1128.236] (-1130.032) (-1126.651) (-1130.459) -- 0:00:36 416500 -- (-1130.470) [-1128.883] (-1128.588) (-1133.068) * [-1128.118] (-1130.024) (-1127.569) (-1127.756) -- 0:00:36 417000 -- [-1127.157] (-1132.266) (-1131.717) (-1129.264) * (-1131.614) [-1130.888] (-1129.103) (-1132.075) -- 0:00:36 417500 -- (-1127.243) [-1127.187] (-1132.252) (-1129.967) * [-1129.391] (-1127.334) (-1129.537) (-1130.411) -- 0:00:36 418000 -- [-1126.903] (-1128.396) (-1126.603) (-1129.156) * [-1128.920] (-1129.880) (-1128.930) (-1129.592) -- 0:00:36 418500 -- (-1127.733) [-1127.463] (-1127.193) (-1131.547) * (-1133.704) (-1130.482) [-1129.301] (-1128.082) -- 0:00:36 419000 -- (-1128.537) (-1128.745) (-1128.601) [-1127.954] * (-1129.974) (-1131.107) (-1128.090) [-1127.339] -- 0:00:36 419500 -- [-1128.548] (-1129.754) (-1127.128) (-1129.249) * (-1128.307) (-1128.082) (-1128.499) [-1129.186] -- 0:00:35 420000 -- (-1127.576) (-1132.793) (-1126.925) [-1127.736] * (-1126.480) (-1130.115) [-1128.612] (-1128.820) -- 0:00:35 Average standard deviation of split frequencies: 0.012063 420500 -- (-1128.222) (-1129.580) (-1130.823) [-1127.030] * (-1127.517) (-1127.638) [-1127.564] (-1129.904) -- 0:00:35 421000 -- [-1127.757] (-1126.689) (-1131.624) (-1128.532) * (-1127.683) [-1129.967] (-1129.063) (-1127.949) -- 0:00:35 421500 -- (-1126.273) (-1126.898) [-1129.146] (-1128.088) * [-1129.015] (-1130.550) (-1130.271) (-1128.192) -- 0:00:35 422000 -- [-1126.273] (-1126.705) (-1128.669) (-1130.525) * (-1127.531) (-1134.846) [-1132.038] (-1126.687) -- 0:00:35 422500 -- (-1128.653) [-1127.285] (-1129.713) (-1131.271) * [-1129.402] (-1131.837) (-1128.963) (-1128.018) -- 0:00:35 423000 -- (-1132.761) (-1127.550) [-1128.423] (-1128.467) * (-1127.826) [-1131.223] (-1126.894) (-1130.615) -- 0:00:35 423500 -- (-1129.112) (-1129.945) [-1127.238] (-1127.577) * [-1128.504] (-1130.877) (-1130.003) (-1128.957) -- 0:00:35 424000 -- [-1128.872] (-1128.234) (-1130.008) (-1128.780) * [-1128.882] (-1127.327) (-1129.072) (-1130.861) -- 0:00:35 424500 -- (-1128.744) [-1127.954] (-1126.935) (-1137.008) * [-1126.930] (-1131.076) (-1129.253) (-1130.047) -- 0:00:35 425000 -- (-1132.657) (-1129.520) [-1126.493] (-1130.708) * (-1126.899) (-1126.875) [-1128.046] (-1130.987) -- 0:00:35 Average standard deviation of split frequencies: 0.012541 425500 -- (-1133.362) (-1127.755) [-1129.486] (-1127.783) * (-1126.985) (-1127.670) (-1129.697) [-1129.875] -- 0:00:35 426000 -- (-1128.413) (-1127.843) [-1127.429] (-1127.733) * (-1129.312) (-1128.766) (-1133.234) [-1129.675] -- 0:00:35 426500 -- (-1128.372) [-1127.189] (-1127.031) (-1132.502) * [-1130.797] (-1127.795) (-1129.494) (-1127.306) -- 0:00:34 427000 -- (-1129.487) (-1127.801) [-1127.603] (-1130.618) * [-1128.459] (-1129.414) (-1128.597) (-1129.522) -- 0:00:34 427500 -- (-1128.245) (-1128.378) (-1127.565) [-1128.133] * (-1129.735) (-1127.446) (-1129.519) [-1129.405] -- 0:00:34 428000 -- [-1127.603] (-1128.139) (-1129.861) (-1128.114) * (-1132.721) [-1127.148] (-1128.676) (-1126.856) -- 0:00:34 428500 -- (-1128.656) (-1128.407) [-1128.630] (-1132.780) * [-1128.646] (-1127.718) (-1131.186) (-1126.858) -- 0:00:34 429000 -- (-1127.361) (-1127.748) (-1128.147) [-1128.966] * [-1129.610] (-1127.935) (-1129.920) (-1127.544) -- 0:00:34 429500 -- (-1126.604) (-1127.747) (-1128.743) [-1133.462] * [-1126.754] (-1127.399) (-1127.888) (-1126.779) -- 0:00:34 430000 -- (-1129.589) (-1126.563) [-1130.209] (-1133.153) * (-1130.000) (-1129.678) (-1127.588) [-1128.000] -- 0:00:34 Average standard deviation of split frequencies: 0.012831 430500 -- (-1127.316) [-1131.231] (-1127.951) (-1133.572) * (-1128.016) [-1129.145] (-1127.392) (-1132.647) -- 0:00:34 431000 -- (-1131.034) (-1129.253) [-1126.150] (-1129.195) * [-1127.634] (-1128.608) (-1132.605) (-1131.319) -- 0:00:35 431500 -- (-1130.038) (-1128.223) (-1127.115) [-1127.128] * (-1127.037) (-1129.170) [-1127.836] (-1129.929) -- 0:00:35 432000 -- (-1128.810) [-1128.869] (-1127.718) (-1128.200) * (-1128.280) [-1130.657] (-1126.627) (-1134.021) -- 0:00:35 432500 -- [-1127.938] (-1130.518) (-1129.260) (-1128.290) * [-1128.099] (-1129.201) (-1128.326) (-1132.118) -- 0:00:35 433000 -- (-1129.824) [-1127.881] (-1129.568) (-1128.072) * (-1127.442) (-1128.735) [-1128.692] (-1131.531) -- 0:00:35 433500 -- [-1127.712] (-1129.212) (-1129.208) (-1130.128) * (-1129.683) (-1128.298) [-1128.831] (-1131.531) -- 0:00:35 434000 -- [-1128.454] (-1130.182) (-1129.400) (-1126.307) * (-1131.542) [-1127.999] (-1127.477) (-1128.391) -- 0:00:35 434500 -- (-1128.709) (-1129.454) (-1128.417) [-1128.389] * (-1134.860) (-1130.206) [-1126.522] (-1130.516) -- 0:00:35 435000 -- (-1129.720) (-1128.504) [-1126.744] (-1131.721) * (-1129.449) [-1127.587] (-1131.988) (-1136.377) -- 0:00:35 Average standard deviation of split frequencies: 0.012674 435500 -- (-1128.229) (-1130.527) [-1126.942] (-1128.425) * (-1126.937) (-1128.863) (-1129.343) [-1127.669] -- 0:00:34 436000 -- (-1126.861) (-1127.467) [-1127.273] (-1128.845) * (-1128.007) (-1127.310) [-1126.538] (-1127.809) -- 0:00:34 436500 -- (-1128.455) (-1127.427) [-1129.115] (-1128.357) * (-1127.930) [-1127.553] (-1132.449) (-1127.809) -- 0:00:34 437000 -- (-1127.955) (-1128.338) (-1128.635) [-1128.929] * (-1128.063) (-1127.764) [-1128.255] (-1127.330) -- 0:00:34 437500 -- (-1127.362) (-1128.747) (-1127.501) [-1128.614] * (-1127.886) (-1131.065) [-1129.984] (-1130.495) -- 0:00:34 438000 -- [-1127.146] (-1128.539) (-1128.217) (-1127.990) * (-1133.627) (-1131.821) [-1127.141] (-1129.413) -- 0:00:34 438500 -- (-1130.043) (-1127.775) [-1127.523] (-1126.848) * (-1127.088) (-1130.240) (-1129.275) [-1128.645] -- 0:00:34 439000 -- [-1129.884] (-1127.813) (-1129.903) (-1130.677) * (-1127.842) (-1129.438) [-1133.130] (-1129.284) -- 0:00:34 439500 -- (-1127.227) (-1128.011) (-1131.463) [-1128.024] * (-1128.310) (-1132.524) (-1130.686) [-1129.640] -- 0:00:34 440000 -- (-1126.712) [-1127.176] (-1131.658) (-1131.181) * [-1129.343] (-1131.798) (-1130.271) (-1129.650) -- 0:00:34 Average standard deviation of split frequencies: 0.012459 440500 -- [-1128.196] (-1129.048) (-1135.636) (-1128.743) * [-1126.874] (-1128.417) (-1129.310) (-1128.652) -- 0:00:34 441000 -- (-1127.641) (-1129.940) (-1137.415) [-1130.344] * (-1127.510) (-1129.177) (-1130.498) [-1128.152] -- 0:00:34 441500 -- (-1129.684) (-1133.489) [-1131.588] (-1131.545) * [-1132.042] (-1132.269) (-1130.824) (-1129.218) -- 0:00:34 442000 -- [-1128.356] (-1130.541) (-1129.501) (-1126.659) * (-1127.531) (-1130.324) [-1134.370] (-1129.734) -- 0:00:34 442500 -- (-1128.142) (-1131.661) [-1129.721] (-1128.829) * (-1127.793) (-1126.653) [-1128.057] (-1129.646) -- 0:00:34 443000 -- (-1129.708) (-1129.918) (-1127.295) [-1129.690] * (-1129.409) (-1126.382) [-1128.876] (-1130.412) -- 0:00:33 443500 -- (-1129.418) (-1129.402) [-1129.927] (-1131.042) * (-1131.007) [-1127.519] (-1131.555) (-1129.047) -- 0:00:33 444000 -- [-1128.362] (-1132.760) (-1131.753) (-1133.605) * (-1128.748) [-1129.234] (-1128.986) (-1127.176) -- 0:00:33 444500 -- (-1126.930) (-1129.673) [-1126.608] (-1134.393) * (-1129.286) (-1132.768) (-1127.765) [-1129.107] -- 0:00:33 445000 -- (-1127.750) (-1131.933) [-1128.262] (-1130.535) * [-1130.113] (-1130.368) (-1128.330) (-1127.902) -- 0:00:33 Average standard deviation of split frequencies: 0.013119 445500 -- (-1131.147) [-1127.653] (-1129.445) (-1128.068) * (-1126.871) (-1131.180) [-1128.802] (-1127.972) -- 0:00:33 446000 -- (-1130.064) (-1128.133) (-1129.628) [-1128.211] * (-1133.112) (-1126.844) (-1132.137) [-1129.759] -- 0:00:34 446500 -- (-1127.656) (-1131.399) (-1129.884) [-1129.042] * (-1127.861) (-1129.333) [-1126.260] (-1128.488) -- 0:00:34 447000 -- (-1129.325) [-1129.074] (-1128.647) (-1127.759) * (-1130.453) [-1129.869] (-1129.092) (-1127.700) -- 0:00:34 447500 -- (-1133.589) (-1131.068) [-1128.086] (-1127.331) * (-1128.613) (-1128.249) [-1128.951] (-1133.906) -- 0:00:34 448000 -- (-1129.500) (-1130.538) (-1128.956) [-1127.873] * (-1127.805) [-1129.135] (-1128.045) (-1128.380) -- 0:00:34 448500 -- (-1134.024) (-1130.664) (-1128.807) [-1128.576] * [-1127.316] (-1127.075) (-1129.243) (-1128.327) -- 0:00:34 449000 -- (-1128.374) [-1130.125] (-1127.724) (-1128.656) * [-1127.734] (-1127.520) (-1127.444) (-1130.717) -- 0:00:34 449500 -- [-1129.341] (-1130.084) (-1129.036) (-1130.422) * (-1127.075) (-1129.392) (-1129.013) [-1128.266] -- 0:00:34 450000 -- (-1129.465) (-1127.516) (-1127.548) [-1128.661] * (-1127.039) (-1126.624) [-1126.903] (-1134.391) -- 0:00:34 Average standard deviation of split frequencies: 0.012614 450500 -- [-1128.152] (-1127.167) (-1127.904) (-1128.987) * (-1132.077) (-1126.850) [-1131.444] (-1128.612) -- 0:00:34 451000 -- (-1129.275) (-1126.884) [-1127.038] (-1130.751) * (-1131.023) (-1130.428) (-1127.801) [-1132.658] -- 0:00:34 451500 -- (-1131.821) (-1129.293) (-1126.924) [-1131.542] * [-1129.143] (-1129.548) (-1127.587) (-1132.598) -- 0:00:34 452000 -- (-1130.814) [-1129.712] (-1129.039) (-1133.048) * [-1127.654] (-1128.620) (-1128.434) (-1132.998) -- 0:00:33 452500 -- (-1128.176) (-1129.804) [-1128.430] (-1129.338) * (-1130.979) [-1129.712] (-1126.955) (-1128.583) -- 0:00:33 453000 -- [-1128.426] (-1128.370) (-1128.900) (-1131.497) * [-1132.444] (-1126.905) (-1128.661) (-1126.540) -- 0:00:33 453500 -- [-1128.182] (-1130.517) (-1132.175) (-1129.721) * (-1126.663) (-1126.758) (-1127.973) [-1128.084] -- 0:00:33 454000 -- (-1135.254) (-1131.495) (-1130.357) [-1126.387] * (-1127.622) [-1126.930] (-1126.550) (-1130.030) -- 0:00:33 454500 -- (-1131.936) (-1128.697) (-1130.456) [-1129.450] * (-1129.810) (-1126.957) (-1129.280) [-1129.185] -- 0:00:33 455000 -- (-1128.927) [-1129.206] (-1129.194) (-1130.204) * (-1133.107) [-1129.606] (-1129.814) (-1126.802) -- 0:00:33 Average standard deviation of split frequencies: 0.012770 455500 -- (-1132.438) (-1126.820) (-1127.695) [-1129.842] * [-1127.543] (-1129.630) (-1128.321) (-1129.667) -- 0:00:33 456000 -- [-1133.382] (-1131.740) (-1128.080) (-1129.292) * (-1127.355) (-1128.251) [-1128.835] (-1129.092) -- 0:00:33 456500 -- (-1131.218) [-1128.152] (-1129.215) (-1127.045) * (-1126.963) (-1129.447) (-1133.392) [-1127.419] -- 0:00:33 457000 -- (-1129.093) [-1127.413] (-1133.484) (-1127.952) * (-1127.058) [-1127.502] (-1129.364) (-1131.477) -- 0:00:33 457500 -- [-1127.479] (-1127.303) (-1132.752) (-1132.402) * (-1127.399) (-1128.853) [-1127.658] (-1130.951) -- 0:00:33 458000 -- [-1127.386] (-1131.529) (-1126.629) (-1132.789) * (-1128.288) (-1127.060) [-1127.440] (-1128.584) -- 0:00:33 458500 -- (-1131.736) (-1130.245) (-1128.729) [-1127.097] * (-1127.572) (-1131.272) [-1126.820] (-1132.423) -- 0:00:33 459000 -- (-1127.092) [-1129.540] (-1127.696) (-1129.622) * [-1127.369] (-1132.310) (-1130.112) (-1128.164) -- 0:00:33 459500 -- (-1127.444) (-1128.452) [-1128.225] (-1129.193) * (-1128.200) [-1130.220] (-1128.342) (-1129.606) -- 0:00:32 460000 -- [-1126.460] (-1128.072) (-1133.373) (-1129.463) * (-1128.245) [-1128.009] (-1129.557) (-1130.465) -- 0:00:32 Average standard deviation of split frequencies: 0.013002 460500 -- (-1126.437) (-1127.810) (-1129.670) [-1128.464] * (-1131.960) (-1129.713) [-1130.728] (-1127.292) -- 0:00:32 461000 -- [-1126.996] (-1128.038) (-1132.243) (-1128.903) * (-1129.102) (-1127.578) [-1126.650] (-1130.201) -- 0:00:32 461500 -- (-1127.413) (-1128.130) (-1131.070) [-1129.200] * (-1128.532) (-1129.842) (-1128.888) [-1126.637] -- 0:00:33 462000 -- (-1127.333) (-1132.347) (-1131.705) [-1127.565] * [-1131.335] (-1131.794) (-1127.686) (-1126.769) -- 0:00:33 462500 -- (-1128.298) (-1130.543) [-1130.536] (-1128.721) * (-1130.490) (-1129.987) [-1126.916] (-1131.010) -- 0:00:33 463000 -- (-1129.822) (-1134.124) (-1130.819) [-1128.823] * (-1127.419) (-1128.881) (-1128.757) [-1126.937] -- 0:00:33 463500 -- (-1129.009) [-1130.725] (-1130.558) (-1128.896) * (-1129.137) (-1131.602) (-1128.578) [-1127.380] -- 0:00:33 464000 -- [-1126.512] (-1131.596) (-1127.289) (-1126.536) * (-1129.127) (-1127.848) (-1128.620) [-1128.823] -- 0:00:33 464500 -- [-1126.527] (-1127.827) (-1127.328) (-1130.949) * (-1130.778) (-1126.768) [-1128.205] (-1129.160) -- 0:00:33 465000 -- (-1126.529) (-1130.569) [-1127.447] (-1131.268) * (-1129.273) (-1128.894) (-1127.367) [-1126.982] -- 0:00:33 Average standard deviation of split frequencies: 0.012972 465500 -- (-1127.466) [-1126.628] (-1127.078) (-1130.783) * (-1128.856) [-1127.057] (-1129.106) (-1127.615) -- 0:00:33 466000 -- (-1127.992) (-1128.413) [-1126.258] (-1128.614) * (-1129.397) (-1127.487) [-1129.496] (-1128.645) -- 0:00:33 466500 -- [-1127.483] (-1131.019) (-1128.215) (-1128.087) * (-1127.809) (-1128.742) (-1126.402) [-1127.422] -- 0:00:33 467000 -- (-1130.457) (-1135.611) [-1126.956] (-1130.150) * (-1127.980) [-1127.757] (-1126.709) (-1128.907) -- 0:00:33 467500 -- (-1129.329) (-1127.694) [-1128.709] (-1129.921) * (-1126.702) (-1131.629) [-1128.845] (-1126.939) -- 0:00:33 468000 -- [-1130.115] (-1129.604) (-1128.691) (-1126.736) * (-1131.165) [-1133.963] (-1127.412) (-1129.664) -- 0:00:32 468500 -- (-1128.602) [-1129.569] (-1126.947) (-1129.649) * (-1129.044) (-1137.435) [-1127.322] (-1130.683) -- 0:00:32 469000 -- (-1132.866) (-1128.392) [-1127.036] (-1127.070) * (-1128.470) (-1129.609) [-1127.425] (-1129.230) -- 0:00:32 469500 -- (-1128.450) (-1126.979) [-1128.802] (-1126.502) * (-1128.660) (-1129.246) (-1129.502) [-1127.721] -- 0:00:32 470000 -- [-1127.703] (-1130.180) (-1126.945) (-1126.463) * [-1127.237] (-1129.268) (-1129.672) (-1129.580) -- 0:00:32 Average standard deviation of split frequencies: 0.013315 470500 -- (-1127.958) (-1129.247) (-1128.836) [-1128.586] * [-1127.122] (-1130.986) (-1128.124) (-1126.729) -- 0:00:32 471000 -- (-1129.738) (-1130.404) [-1128.252] (-1128.813) * (-1128.411) (-1128.149) (-1128.485) [-1126.823] -- 0:00:32 471500 -- [-1131.270] (-1128.303) (-1127.532) (-1131.582) * (-1128.591) (-1133.701) (-1127.707) [-1127.435] -- 0:00:32 472000 -- [-1127.815] (-1127.180) (-1127.774) (-1131.711) * [-1126.801] (-1135.997) (-1126.954) (-1129.767) -- 0:00:32 472500 -- (-1128.002) [-1132.462] (-1128.022) (-1139.604) * (-1127.133) (-1128.986) (-1129.007) [-1130.909] -- 0:00:32 473000 -- [-1130.494] (-1131.168) (-1130.027) (-1130.092) * (-1127.956) [-1128.211] (-1130.545) (-1128.674) -- 0:00:32 473500 -- (-1128.303) (-1137.306) [-1127.163] (-1133.553) * (-1127.514) (-1126.944) (-1129.060) [-1127.774] -- 0:00:32 474000 -- (-1129.530) (-1129.234) (-1127.137) [-1129.297] * (-1128.984) [-1131.433] (-1131.549) (-1127.049) -- 0:00:32 474500 -- (-1129.803) [-1130.701] (-1127.433) (-1129.855) * (-1127.697) (-1129.233) [-1127.917] (-1129.569) -- 0:00:32 475000 -- (-1127.408) [-1128.581] (-1128.039) (-1132.392) * [-1127.729] (-1128.186) (-1129.144) (-1129.807) -- 0:00:32 Average standard deviation of split frequencies: 0.012933 475500 -- (-1126.671) (-1127.599) (-1128.241) [-1128.541] * (-1131.364) [-1130.446] (-1128.572) (-1127.102) -- 0:00:31 476000 -- (-1127.095) (-1132.554) [-1130.727] (-1126.702) * (-1129.088) [-1127.580] (-1129.599) (-1129.380) -- 0:00:31 476500 -- (-1126.261) (-1130.355) [-1129.189] (-1127.319) * [-1129.697] (-1128.600) (-1127.359) (-1127.420) -- 0:00:31 477000 -- (-1126.413) (-1129.031) [-1130.407] (-1128.078) * (-1129.984) (-1129.168) [-1127.476] (-1128.681) -- 0:00:31 477500 -- (-1130.126) (-1132.428) (-1130.448) [-1129.260] * (-1129.687) [-1127.248] (-1128.011) (-1128.685) -- 0:00:31 478000 -- (-1129.304) [-1127.339] (-1127.352) (-1127.569) * (-1127.207) (-1127.700) (-1127.233) [-1127.645] -- 0:00:32 478500 -- [-1127.183] (-1129.879) (-1127.303) (-1126.742) * (-1127.773) [-1127.730] (-1127.503) (-1130.490) -- 0:00:32 479000 -- (-1130.082) (-1127.475) (-1127.053) [-1126.970] * (-1128.406) [-1127.731] (-1128.206) (-1128.580) -- 0:00:32 479500 -- (-1128.456) (-1128.877) (-1129.031) [-1130.458] * (-1129.193) [-1131.683] (-1130.664) (-1128.435) -- 0:00:32 480000 -- (-1127.512) (-1140.052) [-1127.670] (-1129.407) * (-1131.544) (-1128.754) [-1127.683] (-1130.979) -- 0:00:32 Average standard deviation of split frequencies: 0.013362 480500 -- [-1128.885] (-1133.368) (-1126.657) (-1129.183) * [-1126.862] (-1127.286) (-1127.451) (-1132.842) -- 0:00:32 481000 -- (-1129.662) (-1127.945) [-1130.408] (-1128.094) * [-1127.313] (-1127.534) (-1127.142) (-1132.067) -- 0:00:32 481500 -- (-1127.392) (-1131.841) [-1127.178] (-1129.408) * [-1129.255] (-1130.226) (-1130.161) (-1129.680) -- 0:00:32 482000 -- [-1128.181] (-1127.627) (-1130.404) (-1132.211) * (-1128.279) (-1127.892) [-1128.961] (-1130.287) -- 0:00:32 482500 -- (-1127.439) (-1126.813) [-1126.910] (-1128.118) * (-1129.929) [-1127.044] (-1131.555) (-1133.140) -- 0:00:32 483000 -- (-1128.192) (-1131.728) [-1127.113] (-1127.146) * (-1130.061) [-1128.217] (-1129.008) (-1130.014) -- 0:00:32 483500 -- (-1132.478) (-1130.436) [-1130.308] (-1128.990) * (-1133.253) (-1128.420) (-1128.848) [-1129.952] -- 0:00:32 484000 -- [-1130.253] (-1129.522) (-1127.518) (-1127.814) * [-1128.767] (-1130.484) (-1127.128) (-1132.165) -- 0:00:31 484500 -- (-1130.022) (-1128.222) [-1127.060] (-1128.886) * [-1129.342] (-1129.755) (-1135.298) (-1128.446) -- 0:00:31 485000 -- (-1128.996) (-1128.055) [-1127.663] (-1127.788) * [-1130.236] (-1129.247) (-1127.703) (-1126.888) -- 0:00:31 Average standard deviation of split frequencies: 0.012553 485500 -- (-1129.449) [-1127.855] (-1131.244) (-1129.669) * (-1127.121) (-1131.144) (-1127.669) [-1127.174] -- 0:00:31 486000 -- (-1126.609) [-1132.280] (-1132.587) (-1127.131) * (-1127.013) [-1135.942] (-1129.819) (-1127.435) -- 0:00:31 486500 -- [-1128.694] (-1131.555) (-1129.134) (-1126.350) * (-1127.013) (-1130.260) (-1129.073) [-1126.956] -- 0:00:31 487000 -- (-1129.069) (-1126.378) [-1129.155] (-1128.010) * (-1128.631) [-1128.408] (-1129.518) (-1127.237) -- 0:00:31 487500 -- (-1127.971) (-1130.810) (-1126.819) [-1127.767] * (-1127.534) (-1127.442) [-1128.648] (-1127.969) -- 0:00:31 488000 -- (-1126.924) [-1127.523] (-1127.039) (-1127.624) * [-1129.262] (-1127.264) (-1127.088) (-1126.903) -- 0:00:31 488500 -- [-1127.123] (-1129.992) (-1126.757) (-1129.540) * [-1129.218] (-1128.131) (-1129.604) (-1127.104) -- 0:00:31 489000 -- (-1129.440) [-1130.547] (-1127.390) (-1129.592) * (-1129.239) [-1127.595] (-1129.382) (-1131.377) -- 0:00:31 489500 -- [-1126.962] (-1129.083) (-1130.449) (-1130.365) * (-1130.233) (-1129.810) (-1127.290) [-1131.935] -- 0:00:31 490000 -- [-1129.860] (-1128.723) (-1129.520) (-1131.385) * (-1128.256) (-1131.593) [-1129.707] (-1128.624) -- 0:00:31 Average standard deviation of split frequencies: 0.012433 490500 -- (-1132.117) [-1132.191] (-1128.067) (-1127.431) * (-1128.748) (-1138.756) [-1132.411] (-1128.125) -- 0:00:31 491000 -- (-1129.479) [-1130.203] (-1127.260) (-1127.412) * [-1128.197] (-1130.582) (-1131.099) (-1133.991) -- 0:00:31 491500 -- (-1127.562) [-1128.088] (-1126.991) (-1128.180) * [-1129.385] (-1129.442) (-1133.445) (-1129.151) -- 0:00:31 492000 -- (-1128.150) (-1130.427) [-1131.158] (-1129.502) * (-1126.613) [-1129.232] (-1128.671) (-1127.171) -- 0:00:30 492500 -- [-1128.231] (-1129.309) (-1129.833) (-1131.841) * (-1128.462) (-1128.265) [-1127.383] (-1132.317) -- 0:00:30 493000 -- (-1127.834) (-1131.737) [-1131.592] (-1127.796) * (-1131.164) (-1133.807) [-1127.429] (-1130.875) -- 0:00:30 493500 -- (-1129.661) [-1126.579] (-1129.421) (-1126.779) * [-1127.976] (-1131.983) (-1129.797) (-1128.268) -- 0:00:30 494000 -- (-1126.812) (-1131.075) [-1130.404] (-1128.281) * (-1129.182) (-1130.430) [-1129.519] (-1128.253) -- 0:00:30 494500 -- [-1128.454] (-1130.051) (-1136.093) (-1128.828) * (-1129.844) (-1130.507) [-1129.321] (-1128.192) -- 0:00:31 495000 -- (-1129.379) (-1127.509) (-1127.931) [-1128.668] * (-1130.540) (-1131.149) (-1129.443) [-1127.436] -- 0:00:31 Average standard deviation of split frequencies: 0.012914 495500 -- (-1129.847) [-1128.178] (-1127.297) (-1128.213) * (-1130.227) (-1131.040) (-1128.354) [-1129.104] -- 0:00:31 496000 -- (-1126.815) (-1134.558) (-1126.386) [-1128.085] * (-1128.064) (-1132.095) [-1128.869] (-1127.875) -- 0:00:31 496500 -- (-1127.363) (-1130.180) (-1131.655) [-1128.417] * (-1135.250) (-1128.536) [-1130.594] (-1131.217) -- 0:00:31 497000 -- (-1128.998) (-1128.485) [-1127.929] (-1134.869) * (-1127.361) (-1133.406) (-1128.656) [-1129.086] -- 0:00:31 497500 -- (-1133.354) (-1129.243) (-1126.736) [-1126.667] * [-1127.693] (-1129.711) (-1127.684) (-1130.721) -- 0:00:31 498000 -- [-1127.848] (-1127.698) (-1127.645) (-1127.248) * (-1126.765) [-1128.556] (-1127.972) (-1129.134) -- 0:00:31 498500 -- (-1128.304) (-1129.517) (-1132.078) [-1127.086] * [-1128.509] (-1130.006) (-1127.055) (-1128.591) -- 0:00:31 499000 -- [-1126.718] (-1127.002) (-1130.229) (-1127.418) * [-1126.755] (-1126.897) (-1127.055) (-1127.533) -- 0:00:31 499500 -- (-1127.780) (-1129.638) (-1128.329) [-1128.195] * (-1127.114) (-1127.067) (-1128.716) [-1127.397] -- 0:00:31 500000 -- (-1129.288) (-1128.797) (-1127.164) [-1128.870] * (-1126.867) (-1130.961) [-1132.253] (-1127.351) -- 0:00:31 Average standard deviation of split frequencies: 0.012905 500500 -- (-1130.898) (-1127.126) (-1127.031) [-1130.317] * (-1127.812) (-1129.548) (-1128.381) [-1127.019] -- 0:00:30 501000 -- [-1127.550] (-1128.979) (-1130.775) (-1132.574) * (-1128.619) [-1127.465] (-1132.425) (-1126.928) -- 0:00:30 501500 -- (-1127.519) (-1130.279) [-1126.953] (-1132.631) * [-1127.911] (-1129.329) (-1128.379) (-1129.160) -- 0:00:30 502000 -- (-1127.880) (-1129.942) (-1128.675) [-1129.547] * (-1126.775) [-1129.431] (-1128.841) (-1129.256) -- 0:00:30 502500 -- (-1128.419) (-1128.564) (