--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:16:46 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/recG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3058.46         -3061.34
2      -3058.49         -3062.27
--------------------------------------
TOTAL    -3058.47         -3061.91
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.887550    0.088733    0.362367    1.476258    0.861962   1501.00   1501.00    1.000
r(A<->C){all}   0.169980    0.021217    0.000029    0.460029    0.129639    145.17    197.14    1.000
r(A<->G){all}   0.153800    0.018119    0.000060    0.426629    0.115740    259.76    321.01    1.000
r(A<->T){all}   0.165203    0.020265    0.000066    0.459677    0.124246    204.30    206.45    1.002
r(C<->G){all}   0.197478    0.023484    0.000114    0.496716    0.161994    156.83    171.09    1.001
r(C<->T){all}   0.164008    0.019908    0.000015    0.446304    0.123761    144.73    165.70    1.001
r(G<->T){all}   0.149531    0.017396    0.000225    0.418873    0.114072    156.79    204.62    1.000
pi(A){all}      0.198117    0.000071    0.182236    0.215172    0.198018   1158.70   1231.79    1.000
pi(C){all}      0.279291    0.000086    0.260339    0.296210    0.279195   1332.98   1378.97    1.000
pi(G){all}      0.320138    0.000096    0.301944    0.340065    0.320142   1181.93   1190.79    1.000
pi(T){all}      0.202454    0.000070    0.187212    0.220003    0.202300   1256.99   1290.33    1.000
alpha{1,2}      0.350640    0.198661    0.000131    1.285897    0.167920   1136.04   1157.85    1.000
alpha{3}        0.480613    0.227828    0.000188    1.453648    0.325898   1250.86   1257.25    1.002
pinvar{all}     0.998563    0.000002    0.996238    0.999957    0.998884    986.09    999.28    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2977.565124
Model 2: PositiveSelection	-2972.548458
Model 0: one-ratio	-2977.51055
Model 7: beta	-2977.585176
Model 8: beta&w>1	-2972.55031


Model 0 vs 1	0.10914800000045943

Model 2 vs 1	10.033331999999973

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634436_1_1776_MLBR_RS08420)

            Pr(w>1)     post mean +- SE for w

   545 E      1.000**       962.613

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634436_1_1776_MLBR_RS08420)

            Pr(w>1)     post mean +- SE for w

   545 E      0.921         6.676 +- 2.926


Model 8 vs 7	10.06973199999993

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634436_1_1776_MLBR_RS08420)

            Pr(w>1)     post mean +- SE for w

   545 E      1.000**       951.441

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634436_1_1776_MLBR_RS08420)

            Pr(w>1)     post mean +- SE for w

   545 E      0.967*        6.566 +- 2.761

>C1
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C2
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C3
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C4
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C5
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C6
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=743 

C1              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C2              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C3              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C4              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C5              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C6              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
                **************************************************

C1              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C2              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C3              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C4              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C5              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C6              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
                **************************************************

C1              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C2              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C3              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C4              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C5              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C6              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
                **************************************************

C1              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C2              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C3              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C4              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C5              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C6              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
                **************************************************

C1              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C2              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C3              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C4              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C5              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C6              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
                **************************************************

C1              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C2              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C3              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C4              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C5              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C6              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
                **************************************************

C1              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C2              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C3              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C4              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C5              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C6              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
                **************************************************

C1              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C2              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C3              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C4              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C5              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C6              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
                **************************************************

C1              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C2              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C3              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C4              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C5              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C6              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
                **************************************************

C1              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C2              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C3              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C4              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C5              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C6              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
                **************************************************

C1              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C2              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
C3              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C4              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C5              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
C6              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
                ********************************************:*****

C1              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C2              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C3              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C4              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C5              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C6              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
                **************************************************

C1              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C2              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C3              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C4              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C5              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C6              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
                **************************************************

C1              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C2              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C3              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C4              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C5              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C6              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
                **************************************************

C1              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C2              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C3              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C4              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C5              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C6              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
                *******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  743 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  743 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22290]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [22290]--->[22290]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.614 Mb, Max= 31.377 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C2              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C3              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C4              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C5              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
C6              MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
                **************************************************

C1              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C2              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C3              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C4              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C5              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
C6              DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
                **************************************************

C1              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C2              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C3              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C4              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C5              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
C6              AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
                **************************************************

C1              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C2              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C3              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C4              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C5              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
C6              RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
                **************************************************

C1              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C2              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C3              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C4              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C5              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
C6              PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
                **************************************************

C1              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C2              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C3              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C4              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C5              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
C6              QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
                **************************************************

C1              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C2              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C3              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C4              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C5              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
C6              DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
                **************************************************

C1              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C2              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C3              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C4              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C5              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
C6              QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
                **************************************************

C1              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C2              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C3              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C4              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C5              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
C6              QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
                **************************************************

C1              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C2              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C3              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C4              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C5              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
C6              HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
                **************************************************

C1              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C2              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
C3              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C4              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
C5              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
C6              LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
                ********************************************:*****

C1              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C2              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C3              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C4              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C5              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
C6              LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
                **************************************************

C1              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C2              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C3              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C4              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C5              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
C6              PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
                **************************************************

C1              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C2              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C3              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C4              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C5              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
C6              LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
                **************************************************

C1              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C2              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C3              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C4              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C5              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
C6              EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.87 C1	 C2	 99.87
TOP	    1    0	 99.87 C2	 C1	 99.87
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.87 C1	 C5	 99.87
TOP	    4    0	 99.87 C5	 C1	 99.87
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.87 C2	 C3	 99.87
TOP	    2    1	 99.87 C3	 C2	 99.87
BOT	    1    3	 99.87 C2	 C4	 99.87
TOP	    3    1	 99.87 C4	 C2	 99.87
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.87 C2	 C6	 99.87
TOP	    5    1	 99.87 C6	 C2	 99.87
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.87 C3	 C5	 99.87
TOP	    4    2	 99.87 C5	 C3	 99.87
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 99.87 C4	 C5	 99.87
TOP	    4    3	 99.87 C5	 C4	 99.87
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 99.87 C5	 C6	 99.87
TOP	    5    4	 99.87 C6	 C5	 99.87
AVG	 0	 C1	  *	 99.95
AVG	 1	 C2	  *	 99.89
AVG	 2	 C3	  *	 99.95
AVG	 3	 C4	  *	 99.95
AVG	 4	 C5	  *	 99.89
AVG	 5	 C6	  *	 99.95
TOT	 TOT	  *	 99.93
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
C2              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
C3              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
C4              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
C5              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
C6              ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
                **************************************************

C1              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
C2              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
C3              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
C4              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
C5              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
C6              CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
                **************************************************

C1              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
C2              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
C3              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
C4              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
C5              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
C6              GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
                **************************************************

C1              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
C2              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
C3              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
C4              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
C5              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
C6              GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
                **************************************************

C1              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
C2              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
C3              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
C4              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
C5              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
C6              AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
                **************************************************

C1              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
C2              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
C3              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
C4              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
C5              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
C6              GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
                **************************************************

C1              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
C2              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
C3              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
C4              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
C5              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
C6              GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
                **************************************************

C1              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
C2              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
C3              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
C4              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
C5              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
C6              TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
                **************************************************

C1              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
C2              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
C3              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
C4              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
C5              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
C6              TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
                **************************************************

C1              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
C2              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
C3              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
C4              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
C5              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
C6              CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
                **************************************************

C1              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
C2              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
C3              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
C4              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
C5              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
C6              GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
                **************************************************

C1              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
C2              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
C3              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
C4              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
C5              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
C6              AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
                **************************************************

C1              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
C2              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
C3              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
C4              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
C5              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
C6              CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
                **************************************************

C1              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
C2              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
C3              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
C4              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
C5              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
C6              CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
                **************************************************

C1              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
C2              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
C3              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
C4              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
C5              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
C6              ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
                **************************************************

C1              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
C2              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
C3              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
C4              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
C5              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
C6              CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
                **************************************************

C1              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
C2              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
C3              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
C4              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
C5              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
C6              GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
                **************************************************

C1              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
C2              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
C3              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
C4              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
C5              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
C6              TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
                **************************************************

C1              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
C2              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
C3              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
C4              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
C5              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
C6              GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
                **************************************************

C1              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
C2              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
C3              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
C4              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
C5              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
C6              CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
                **************************************************

C1              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
C2              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
C3              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
C4              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
C5              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
C6              ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
                **************************************************

C1              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
C2              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
C3              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
C4              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
C5              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
C6              CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
                **************************************************

C1              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
C2              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
C3              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
C4              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
C5              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
C6              TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
                **************************************************

C1              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
C2              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
C3              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
C4              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
C5              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
C6              CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
                **************************************************

C1              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
C2              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
C3              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
C4              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
C5              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
C6              CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
                **************************************************

C1              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
C2              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
C3              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
C4              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
C5              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
C6              ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
                **************************************************

C1              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
C2              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
C3              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
C4              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
C5              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
C6              TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
                **************************************************

C1              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
C2              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
C3              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
C4              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
C5              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
C6              CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
                **************************************************

C1              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
C2              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
C3              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
C4              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
C5              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
C6              CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
                **************************************************

C1              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
C2              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
C3              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
C4              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
C5              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
C6              GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
                **************************************************

C1              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
C2              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
C3              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
C4              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
C5              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
C6              CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
                **************************************************

C1              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
C2              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
C3              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
C4              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
C5              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
C6              AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
                **************************************************

C1              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
C2              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGACGGTCTCTACGCACGA
C3              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
C4              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
C5              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGACGGTCTCTACGCACGA
C6              GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
                ********************************** ***************

C1              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
C2              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
C3              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
C4              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
C5              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
C6              TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
                **************************************************

C1              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
C2              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
C3              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
C4              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
C5              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
C6              GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
                **************************************************

C1              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
C2              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
C3              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
C4              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
C5              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
C6              AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
                **************************************************

C1              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
C2              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
C3              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
C4              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
C5              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
C6              CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
                **************************************************

C1              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
C2              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
C3              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
C4              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
C5              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
C6              CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
                **************************************************

C1              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
C2              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
C3              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
C4              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
C5              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
C6              TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
                **************************************************

C1              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
C2              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
C3              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
C4              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
C5              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
C6              CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
                **************************************************

C1              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
C2              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
C3              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
C4              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
C5              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
C6              CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
                **************************************************

C1              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
C2              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
C3              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
C4              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
C5              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
C6              AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
                **************************************************

C1              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
C2              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
C3              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
C4              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
C5              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
C6              GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
                **************************************************

C1              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
C2              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
C3              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
C4              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
C5              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
C6              ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
                **************************************************

C1              CCGACCGTATAGAATACTTAGGCAAGTCA
C2              CCGACCGTATAGAATACTTAGGCAAGTCA
C3              CCGACCGTATAGAATACTTAGGCAAGTCA
C4              CCGACCGTATAGAATACTTAGGCAAGTCA
C5              CCGACCGTATAGAATACTTAGGCAAGTCA
C6              CCGACCGTATAGAATACTTAGGCAAGTCA
                *****************************



>C1
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C2
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGACGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C3
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C4
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C5
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGACGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C6
ATGGTGTCACTATCCGATCGGCTCGACTACATCGTGGGCGCCAAGGCTGC
CGATTCCCTCGACGAAGTGTTTGGTATTCGCACTGTCGACGACCTGCTAC
GCCATTACCCACGCAGTTACACTAAGGGTGCGACTGTGCGGGGCGCCCAA
GACGAGCGGCCGGAAGCAGGTGAACACATCACCATCGTCGACGTCATCAC
AGAGGCGGTGACGTTACCGATGAAGAAGGACTCGAAAAAGAAGTATCTAC
GTCTCACGGTCGGCTCTGGACGCAACAAGGTGATCGCTACGTTTTTTAAT
GCGGGCTATATCAGTAAGGGGCTAACCAAAGATACCCGGGTGATGCTCTC
TGGGGAGGTTGGATTTTTTCGGGGCGTTATGCAGCTGACGCACCCCGCGT
TTCTCATTCTCGACTCGCCGGACGGACGCAACCGCGGCAGTAGCTCGCTG
CGCCGCATCGCCGATGCTTCACAGGCTGTCAGTGGCGAAGTGCTGATGTC
GGCGTTCGAACGTCGATTCTTTCCGATCTATCCGGCCAGCACCAAACTGC
AGAGCTGGGATATCTACGCCTGCGTGCGTCAGGTGCTTGAGGTCCTCGAT
CCGGTGGCCGATCCGTTGCCCGCGGATCTGCGCGCCAAGCATGGCCTGGT
CTCCGAAGATGAGGCACTGCGCGCCATCCATCTCGCTGAAAGCGAGTCGG
ACCGTCGGCGTGCGCGGGAGCGGCTAACCTTCGACGAAGCGGTCGGCTTG
CAGTGGGCGTTGGTAACCCGAAGGCATGGTGAACTGTCGGAATCGGGACC
GTCGGCGCCGCCGCGGTCTGACGGTCTGATGGCAGAACTGATGCGGCGGT
TGCCGTTCGAGCTTACGGAGGGACAGCGTGAGGTGCGTGACGTGCTGTCC
GATGGGCTAGCGGCTACCCGTCCGTTGAACCGCCTGCTGCAAGGTGAAGT
CGGGTCGGGCAAGACCATCGTCGCGGTATTGGCAATGTTGCAGATGATTG
ATGCTGGCTACCAATGCGTGTTGCTGGCTCCTACGGAAGTTCTTGCTGCA
CAACATCTACTGTCGATCCGTGACGTTCTCGGCCCGTTGGGGATGGGGTG
TCAGCTGGGCGGGGCGGAAAATGCCACCCAGGTGGCTCTGCTGACCGGCT
CGATGACGATGGCCCAGAAGAAAAAGGTTCGCGCCGACATTTTCAGCGGC
CAGACTGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGACGCGATTGA
ATTCCACAACCTAGGCATGGTAGTAGTCGACGAACAACACCGTTTCGGTG
TCGAGCAGCGAGATCAATTGCGTACCAAGGCCCGCACTGGCATCATGCCA
CATCTGTTGGTGATGACGGCGACGCCAATCCCGCGTACTGTCGCACTTAC
CGTCTATGGCGACTTGGAGATGTCGACACTGCGCGAACTGCCGCGCGGAC
GTCAGCCGATAACCAGCAACGTCATCTTCGTCAAGGACAAGCCAGGGTGG
CTGGACCGGGCTTGGCAGCGCATCCTCGAGGAAGTCGCCGCGGGCCGCCA
AGCGTATGTGGTGGCGCCCCGGATTGACGAGACCGAAGATCCGCAGAAAG
GGGGGCAAAACAGCAGACCATCGGAAACCGCGGAGGGTCTCTACGCACGA
TTGCGTTCTGGTGAGCTGGCTAACGTGCGGCTGGCGCTTATGCACGGTCG
GTTGTCCGCTGACGAGAAGGACGCTGCGATGATGGCTTTCCGTGCAGGCG
AAATCGATGTGCTGGTGTGTACCAACGTCATTGAGGTAGGCGTAGATGTA
CCTAACGCCACCATCATGCTGGTGATGGACGCCGATCGGTTTGGAATAAG
CCAGTTGCATCAGCTGCGTGGCCGCATCGGTCGCGGCACGCATCCGAGCC
TGTGTTTGTTGGCCAGCTGGGTCTCACCGGGCTCCCCGGCCGGGCGCAGG
CTATGTGCCGTCGCCGAGACCATGGACGGGTTCGCACTCGCCGATCTCGA
CCTCAAGGAGCGTCGGGAAGGAGATGTTCTGGGCCGCAACCAATCCGGAA
AGGCAATTACCCTGCGGATGCTGTCATTGGCCGAGCATCAGGTGTTCATT
GAGGCCGCAAGGGATTTCTGCACGCGTGCCTACGAGTATCCGCACCTCGG
ATTAGCCCCGCATCCGGGATTGGCAGATTTGGCAGCACGATTCATTGACA
CCGACCGTATAGAATACTTAGGCAAGTCA
>C1
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C2
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C3
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C4
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C5
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETADGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS
>C6
MVSLSDRLDYIVGAKAADSLDEVFGIRTVDDLLRHYPRSYTKGATVRGAQ
DERPEAGEHITIVDVITEAVTLPMKKDSKKKYLRLTVGSGRNKVIATFFN
AGYISKGLTKDTRVMLSGEVGFFRGVMQLTHPAFLILDSPDGRNRGSSSL
RRIADASQAVSGEVLMSAFERRFFPIYPASTKLQSWDIYACVRQVLEVLD
PVADPLPADLRAKHGLVSEDEALRAIHLAESESDRRRARERLTFDEAVGL
QWALVTRRHGELSESGPSAPPRSDGLMAELMRRLPFELTEGQREVRDVLS
DGLAATRPLNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAA
QHLLSIRDVLGPLGMGCQLGGAENATQVALLTGSMTMAQKKKVRADIFSG
QTGIVIGTHALLQDAIEFHNLGMVVVDEQHRFGVEQRDQLRTKARTGIMP
HLLVMTATPIPRTVALTVYGDLEMSTLRELPRGRQPITSNVIFVKDKPGW
LDRAWQRILEEVAAGRQAYVVAPRIDETEDPQKGGQNSRPSETAEGLYAR
LRSGELANVRLALMHGRLSADEKDAAMMAFRAGEIDVLVCTNVIEVGVDV
PNATIMLVMDADRFGISQLHQLRGRIGRGTHPSLCLLASWVSPGSPAGRR
LCAVAETMDGFALADLDLKERREGDVLGRNQSGKAITLRMLSLAEHQVFI
EAARDFCTRAYEYPHLGLAPHPGLADLAARFIDTDRIEYLGKS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2229 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788901
      Setting output file names to "/data/11res/recG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 980022648
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0758435948
      Seed = 241827453
      Swapseed = 1579788901
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 5 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4995.279351 -- -24.965149
         Chain 2 -- -4991.973943 -- -24.965149
         Chain 3 -- -4995.315923 -- -24.965149
         Chain 4 -- -4994.642506 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4995.279064 -- -24.965149
         Chain 2 -- -4995.279351 -- -24.965149
         Chain 3 -- -4995.279351 -- -24.965149
         Chain 4 -- -4995.315923 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4995.279] (-4991.974) (-4995.316) (-4994.643) * [-4995.279] (-4995.279) (-4995.279) (-4995.316) 
        500 -- (-3084.943) (-3088.789) [-3068.795] (-3084.667) * [-3075.232] (-3086.663) (-3081.688) (-3099.119) -- 0:00:00
       1000 -- [-3067.698] (-3065.263) (-3066.986) (-3067.733) * (-3078.393) (-3090.781) [-3058.557] (-3070.030) -- 0:00:00
       1500 -- (-3074.805) (-3064.115) [-3065.758] (-3067.231) * (-3069.859) (-3065.590) (-3061.397) [-3064.264] -- 0:00:00
       2000 -- (-3065.725) [-3058.179] (-3064.305) (-3070.262) * (-3071.251) (-3066.809) [-3062.799] (-3064.855) -- 0:00:00
       2500 -- (-3062.268) (-3063.458) [-3063.079] (-3067.970) * [-3066.257] (-3062.662) (-3057.596) (-3062.676) -- 0:00:00
       3000 -- [-3061.014] (-3060.454) (-3066.899) (-3069.634) * (-3066.291) (-3059.985) [-3060.577] (-3063.454) -- 0:00:00
       3500 -- (-3067.591) (-3059.240) (-3055.921) [-3059.358] * [-3060.943] (-3064.218) (-3063.260) (-3060.841) -- 0:00:00
       4000 -- (-3060.249) (-3066.692) (-3062.678) [-3063.431] * (-3065.963) (-3069.955) (-3067.858) [-3061.482] -- 0:00:00
       4500 -- (-3064.784) [-3061.556] (-3059.627) (-3065.356) * (-3065.742) (-3061.800) (-3067.497) [-3061.707] -- 0:00:00
       5000 -- (-3069.306) (-3061.811) (-3062.221) [-3066.619] * (-3064.316) [-3061.037] (-3065.685) (-3067.476) -- 0:00:00

      Average standard deviation of split frequencies: 0.062854

       5500 -- [-3062.538] (-3059.031) (-3068.913) (-3063.135) * (-3064.489) (-3068.393) (-3066.786) [-3064.550] -- 0:00:00
       6000 -- (-3064.700) [-3062.548] (-3066.790) (-3062.038) * [-3063.200] (-3062.215) (-3069.868) (-3060.948) -- 0:00:00
       6500 -- [-3062.406] (-3061.196) (-3074.887) (-3062.788) * (-3060.627) (-3067.669) [-3064.494] (-3063.595) -- 0:00:00
       7000 -- [-3058.994] (-3078.411) (-3062.542) (-3068.851) * (-3073.602) (-3065.949) (-3059.082) [-3059.052] -- 0:00:00
       7500 -- (-3064.574) (-3069.458) (-3063.112) [-3061.246] * (-3071.006) (-3062.101) [-3060.822] (-3057.906) -- 0:00:00
       8000 -- (-3067.256) (-3063.894) [-3060.941] (-3064.404) * (-3067.185) [-3059.520] (-3061.080) (-3069.299) -- 0:02:04
       8500 -- (-3065.744) (-3061.955) (-3069.620) [-3071.921] * (-3065.318) [-3058.784] (-3062.816) (-3059.811) -- 0:01:56
       9000 -- (-3070.975) (-3065.243) (-3060.458) [-3056.525] * [-3060.868] (-3065.099) (-3060.135) (-3061.782) -- 0:01:50
       9500 -- [-3059.354] (-3067.000) (-3073.902) (-3058.154) * (-3059.672) [-3062.928] (-3063.238) (-3068.431) -- 0:01:44
      10000 -- (-3066.478) [-3061.797] (-3064.698) (-3067.772) * (-3065.772) (-3064.477) [-3060.291] (-3062.518) -- 0:01:39

      Average standard deviation of split frequencies: 0.040177

      10500 -- [-3061.952] (-3064.088) (-3062.392) (-3055.815) * (-3070.796) (-3067.910) [-3064.079] (-3067.432) -- 0:01:34
      11000 -- [-3070.332] (-3061.374) (-3058.091) (-3061.003) * [-3062.068] (-3068.850) (-3069.653) (-3067.484) -- 0:01:29
      11500 -- [-3065.398] (-3067.466) (-3067.623) (-3059.313) * (-3061.690) (-3068.390) [-3059.917] (-3077.408) -- 0:01:25
      12000 -- [-3058.925] (-3071.591) (-3069.833) (-3069.062) * (-3068.169) [-3059.910] (-3061.151) (-3064.965) -- 0:01:22
      12500 -- (-3065.314) (-3072.304) [-3059.551] (-3065.409) * [-3071.723] (-3060.713) (-3068.708) (-3071.071) -- 0:01:19
      13000 -- (-3061.349) (-3065.972) [-3060.946] (-3067.113) * (-3071.408) [-3057.407] (-3065.467) (-3069.793) -- 0:01:15
      13500 -- (-3068.140) (-3065.003) (-3060.798) [-3063.477] * [-3062.389] (-3067.747) (-3071.672) (-3065.360) -- 0:01:13
      14000 -- (-3071.219) [-3061.255] (-3063.930) (-3064.668) * (-3062.070) (-3067.928) [-3063.877] (-3066.036) -- 0:01:10
      14500 -- (-3061.551) (-3058.916) [-3058.631] (-3059.498) * (-3057.665) (-3062.127) [-3061.528] (-3069.279) -- 0:01:07
      15000 -- (-3062.401) (-3068.018) [-3056.955] (-3060.074) * [-3069.982] (-3069.814) (-3060.983) (-3059.801) -- 0:01:05

      Average standard deviation of split frequencies: 0.047140

      15500 -- (-3060.367) [-3063.136] (-3066.731) (-3068.214) * (-3071.422) (-3061.096) [-3058.181] (-3065.724) -- 0:01:03
      16000 -- (-3062.582) [-3060.674] (-3060.623) (-3063.550) * (-3064.176) [-3067.420] (-3063.896) (-3060.202) -- 0:01:01
      16500 -- (-3063.751) (-3065.735) [-3062.007] (-3057.800) * (-3060.052) [-3064.082] (-3059.827) (-3064.941) -- 0:00:59
      17000 -- [-3060.234] (-3061.682) (-3069.476) (-3057.834) * (-3066.142) (-3062.060) (-3063.970) [-3060.619] -- 0:00:57
      17500 -- (-3059.908) [-3060.779] (-3064.619) (-3063.201) * (-3062.224) (-3063.140) (-3062.905) [-3059.075] -- 0:00:56
      18000 -- (-3062.062) [-3062.499] (-3064.630) (-3058.069) * (-3063.503) [-3060.306] (-3063.487) (-3066.753) -- 0:00:54
      18500 -- [-3061.545] (-3060.981) (-3064.725) (-3067.122) * [-3068.614] (-3065.813) (-3067.226) (-3062.018) -- 0:00:53
      19000 -- [-3064.219] (-3071.263) (-3061.659) (-3065.030) * (-3062.223) (-3061.410) (-3065.246) [-3061.182] -- 0:00:51
      19500 -- (-3061.219) [-3065.240] (-3060.482) (-3066.996) * [-3059.951] (-3060.976) (-3063.746) (-3062.281) -- 0:00:50
      20000 -- (-3062.008) (-3067.978) [-3061.580] (-3062.880) * [-3056.900] (-3062.038) (-3063.393) (-3058.429) -- 0:00:49

      Average standard deviation of split frequencies: 0.041473

      20500 -- [-3062.315] (-3063.457) (-3060.376) (-3063.164) * (-3064.245) (-3068.341) (-3063.813) [-3072.633] -- 0:01:35
      21000 -- [-3062.117] (-3061.513) (-3063.579) (-3056.881) * [-3057.296] (-3066.594) (-3068.538) (-3064.403) -- 0:01:33
      21500 -- [-3059.078] (-3061.899) (-3063.545) (-3061.863) * (-3065.527) (-3061.606) [-3063.665] (-3069.937) -- 0:01:31
      22000 -- (-3061.232) [-3065.258] (-3062.605) (-3063.016) * [-3062.975] (-3062.743) (-3061.967) (-3060.992) -- 0:01:28
      22500 -- (-3062.360) [-3060.099] (-3059.295) (-3068.654) * (-3060.454) (-3079.643) [-3059.939] (-3065.655) -- 0:01:26
      23000 -- (-3060.171) (-3063.114) (-3067.474) [-3064.411] * [-3058.562] (-3061.705) (-3070.847) (-3064.118) -- 0:01:24
      23500 -- (-3064.312) (-3070.475) [-3060.878] (-3068.350) * [-3069.305] (-3061.773) (-3065.819) (-3064.567) -- 0:01:23
      24000 -- (-3068.518) (-3065.865) (-3061.236) [-3065.319] * (-3062.319) [-3057.380] (-3063.384) (-3062.318) -- 0:01:21
      24500 -- [-3063.409] (-3063.954) (-3065.492) (-3063.598) * [-3061.974] (-3059.373) (-3063.743) (-3059.032) -- 0:01:19
      25000 -- (-3061.536) (-3066.296) [-3061.922] (-3063.690) * (-3073.166) (-3062.807) (-3063.842) [-3061.936] -- 0:01:18

      Average standard deviation of split frequencies: 0.028021

      25500 -- (-3062.405) (-3058.322) [-3065.736] (-3062.807) * [-3059.768] (-3062.199) (-3068.470) (-3067.559) -- 0:01:16
      26000 -- (-3064.408) (-3059.549) (-3062.643) [-3063.153] * (-3069.914) (-3059.164) (-3058.369) [-3069.955] -- 0:01:14
      26500 -- (-3067.463) [-3067.065] (-3065.142) (-3065.448) * [-3057.403] (-3058.564) (-3062.942) (-3064.897) -- 0:01:13
      27000 -- (-3059.887) (-3064.178) (-3057.412) [-3059.116] * (-3059.259) (-3059.176) [-3062.084] (-3068.461) -- 0:01:12
      27500 -- [-3061.755] (-3066.153) (-3065.372) (-3061.788) * (-3071.079) (-3059.201) [-3065.964] (-3060.967) -- 0:01:10
      28000 -- (-3067.940) (-3063.042) [-3066.222] (-3063.575) * [-3058.357] (-3059.742) (-3061.538) (-3061.474) -- 0:01:09
      28500 -- (-3064.700) [-3063.211] (-3057.920) (-3070.907) * (-3064.078) (-3058.973) (-3067.298) [-3059.364] -- 0:01:08
      29000 -- (-3062.886) [-3059.611] (-3067.255) (-3061.408) * [-3062.911] (-3062.529) (-3066.192) (-3063.760) -- 0:01:06
      29500 -- (-3065.896) (-3061.943) [-3061.210] (-3074.678) * (-3062.692) (-3061.527) [-3067.666] (-3062.219) -- 0:01:05
      30000 -- (-3065.419) (-3057.652) [-3057.751] (-3073.228) * (-3067.783) (-3059.653) (-3060.076) [-3066.413] -- 0:01:04

      Average standard deviation of split frequencies: 0.023757

      30500 -- (-3068.569) (-3064.152) (-3058.200) [-3063.163] * [-3072.813] (-3059.098) (-3063.284) (-3067.114) -- 0:01:03
      31000 -- (-3074.616) (-3062.124) [-3061.703] (-3059.748) * (-3066.527) (-3059.133) [-3066.613] (-3063.331) -- 0:01:02
      31500 -- [-3063.560] (-3059.757) (-3064.375) (-3064.920) * (-3062.382) (-3058.664) [-3065.847] (-3065.729) -- 0:01:01
      32000 -- [-3063.642] (-3063.015) (-3060.766) (-3063.810) * (-3066.116) (-3059.491) (-3066.756) [-3060.025] -- 0:01:00
      32500 -- (-3067.096) (-3060.156) (-3061.839) [-3064.006] * (-3071.353) (-3065.138) (-3058.995) [-3057.530] -- 0:00:59
      33000 -- (-3068.326) [-3065.935] (-3074.239) (-3069.868) * (-3062.978) (-3063.287) [-3062.728] (-3064.943) -- 0:01:27
      33500 -- (-3068.499) (-3058.330) (-3059.959) [-3064.323] * (-3061.518) (-3059.660) (-3057.950) [-3062.826] -- 0:01:26
      34000 -- (-3066.872) (-3062.399) [-3058.961] (-3069.633) * (-3079.762) [-3057.951] (-3060.831) (-3064.187) -- 0:01:25
      34500 -- (-3075.393) [-3064.876] (-3064.489) (-3064.562) * (-3064.578) (-3057.752) (-3065.650) [-3059.945] -- 0:01:23
      35000 -- (-3057.547) (-3069.954) [-3058.470] (-3067.410) * (-3061.784) [-3057.070] (-3062.707) (-3065.552) -- 0:01:22

      Average standard deviation of split frequencies: 0.030951

      35500 -- (-3061.623) (-3066.107) (-3061.806) [-3063.041] * (-3064.925) (-3058.782) [-3061.542] (-3059.759) -- 0:01:21
      36000 -- (-3062.877) [-3059.414] (-3064.042) (-3071.082) * (-3067.130) (-3059.525) (-3066.278) [-3059.386] -- 0:01:20
      36500 -- (-3085.735) (-3059.699) (-3071.982) [-3061.900] * (-3066.201) [-3060.001] (-3062.399) (-3064.941) -- 0:01:19
      37000 -- (-3059.588) [-3063.553] (-3079.795) (-3064.931) * (-3072.269) (-3061.635) (-3066.279) [-3065.477] -- 0:01:18
      37500 -- (-3058.704) (-3061.480) (-3069.472) [-3061.077] * (-3068.617) [-3059.146] (-3063.060) (-3068.318) -- 0:01:17
      38000 -- (-3059.349) (-3064.694) (-3062.236) [-3067.121] * [-3064.441] (-3063.124) (-3067.752) (-3062.987) -- 0:01:15
      38500 -- (-3059.862) (-3059.908) [-3059.833] (-3062.792) * (-3059.348) [-3063.360] (-3067.008) (-3064.012) -- 0:01:14
      39000 -- (-3059.955) (-3065.987) (-3060.594) [-3065.860] * [-3060.087] (-3061.789) (-3062.657) (-3060.914) -- 0:01:13
      39500 -- [-3060.214] (-3060.592) (-3072.510) (-3060.576) * [-3063.207] (-3060.914) (-3062.101) (-3059.474) -- 0:01:12
      40000 -- (-3058.847) [-3058.005] (-3070.416) (-3065.813) * (-3065.861) (-3060.191) [-3065.178] (-3059.148) -- 0:01:12

      Average standard deviation of split frequencies: 0.035830

      40500 -- (-3059.458) [-3065.906] (-3059.491) (-3063.040) * [-3061.718] (-3059.034) (-3062.830) (-3059.152) -- 0:01:11
      41000 -- (-3058.070) [-3060.873] (-3062.903) (-3067.856) * [-3063.758] (-3058.544) (-3061.873) (-3060.935) -- 0:01:10
      41500 -- (-3059.380) (-3059.872) [-3061.586] (-3065.473) * [-3059.851] (-3059.472) (-3060.755) (-3062.063) -- 0:01:09
      42000 -- [-3058.958] (-3060.292) (-3058.921) (-3064.569) * (-3063.986) (-3059.472) [-3064.249] (-3061.452) -- 0:01:08
      42500 -- [-3056.759] (-3057.721) (-3068.137) (-3062.801) * [-3064.330] (-3059.669) (-3062.180) (-3062.433) -- 0:01:07
      43000 -- (-3058.766) [-3065.726] (-3064.834) (-3067.071) * (-3062.404) (-3063.709) [-3057.969] (-3059.481) -- 0:01:06
      43500 -- (-3058.959) (-3062.270) [-3068.309] (-3062.568) * [-3063.901] (-3060.473) (-3059.178) (-3061.959) -- 0:01:05
      44000 -- (-3060.118) (-3058.443) [-3057.943] (-3063.698) * [-3061.963] (-3065.668) (-3057.685) (-3062.472) -- 0:01:05
      44500 -- (-3060.290) (-3059.859) [-3060.849] (-3063.122) * [-3060.890] (-3065.527) (-3061.405) (-3060.035) -- 0:01:04
      45000 -- (-3058.226) (-3059.511) (-3068.338) [-3059.022] * (-3065.301) (-3060.192) [-3058.898] (-3062.595) -- 0:01:03

      Average standard deviation of split frequencies: 0.035402

      45500 -- (-3058.411) [-3064.460] (-3065.388) (-3075.415) * (-3068.707) (-3058.327) [-3059.128] (-3061.388) -- 0:01:23
      46000 -- [-3060.261] (-3064.197) (-3064.828) (-3059.906) * [-3058.884] (-3064.968) (-3069.278) (-3058.812) -- 0:01:22
      46500 -- (-3059.525) (-3062.217) (-3068.096) [-3069.274] * [-3063.919] (-3063.763) (-3061.857) (-3058.382) -- 0:01:22
      47000 -- (-3060.219) (-3060.343) (-3060.845) [-3062.945] * [-3061.502] (-3064.100) (-3060.242) (-3060.613) -- 0:01:21
      47500 -- (-3061.006) (-3065.874) (-3060.425) [-3070.759] * [-3064.832] (-3062.852) (-3058.988) (-3062.584) -- 0:01:20
      48000 -- (-3059.554) (-3064.190) [-3060.852] (-3063.667) * [-3063.363] (-3062.113) (-3065.283) (-3062.031) -- 0:01:19
      48500 -- (-3061.414) [-3068.838] (-3064.537) (-3066.095) * (-3061.229) (-3059.402) (-3066.158) [-3061.279] -- 0:01:18
      49000 -- [-3060.721] (-3064.995) (-3064.643) (-3067.222) * (-3062.246) (-3060.625) [-3057.658] (-3059.397) -- 0:01:17
      49500 -- (-3058.487) (-3067.842) (-3061.842) [-3063.724] * [-3066.277] (-3060.907) (-3063.085) (-3061.295) -- 0:01:16
      50000 -- (-3058.485) [-3062.092] (-3063.955) (-3065.336) * (-3070.992) (-3062.230) [-3061.715] (-3062.453) -- 0:01:16

      Average standard deviation of split frequencies: 0.024529

      50500 -- (-3058.383) (-3064.583) [-3058.729] (-3067.673) * (-3062.337) (-3061.210) (-3058.679) [-3059.401] -- 0:01:15
      51000 -- (-3059.572) (-3065.175) (-3061.892) [-3056.815] * (-3063.187) (-3060.687) [-3065.905] (-3059.221) -- 0:01:14
      51500 -- (-3060.677) [-3059.756] (-3072.735) (-3062.469) * (-3062.629) (-3062.319) (-3061.758) [-3059.043] -- 0:01:13
      52000 -- (-3058.108) (-3067.265) (-3063.608) [-3058.791] * (-3061.806) (-3059.621) [-3062.872] (-3059.860) -- 0:01:12
      52500 -- (-3058.508) (-3067.292) (-3066.147) [-3062.016] * (-3056.636) (-3059.770) [-3067.435] (-3057.874) -- 0:01:12
      53000 -- (-3061.781) (-3066.528) [-3060.264] (-3061.526) * [-3066.647] (-3059.005) (-3060.419) (-3057.963) -- 0:01:11
      53500 -- (-3061.470) (-3064.951) [-3062.085] (-3064.993) * (-3070.660) (-3058.125) [-3062.040] (-3058.257) -- 0:01:10
      54000 -- (-3060.944) [-3067.576] (-3060.914) (-3064.647) * [-3057.978] (-3057.576) (-3056.239) (-3057.646) -- 0:01:10
      54500 -- [-3058.210] (-3062.321) (-3063.409) (-3062.620) * (-3067.860) (-3057.119) (-3066.057) [-3059.241] -- 0:01:09
      55000 -- (-3065.285) [-3059.995] (-3065.449) (-3059.404) * (-3064.469) [-3058.204] (-3064.842) (-3058.982) -- 0:01:08

      Average standard deviation of split frequencies: 0.014540

      55500 -- (-3069.576) (-3067.388) [-3059.639] (-3059.153) * (-3077.210) (-3057.493) [-3057.985] (-3058.219) -- 0:01:08
      56000 -- (-3064.745) [-3060.336] (-3062.316) (-3059.515) * (-3061.289) (-3057.989) [-3060.690] (-3058.760) -- 0:01:07
      56500 -- (-3058.970) (-3061.791) [-3060.729] (-3059.182) * (-3060.827) (-3058.312) [-3061.025] (-3057.391) -- 0:01:06
      57000 -- (-3062.493) [-3059.629] (-3068.916) (-3059.413) * [-3066.857] (-3058.133) (-3062.722) (-3058.328) -- 0:01:06
      57500 -- (-3062.534) [-3061.732] (-3064.743) (-3058.526) * (-3069.995) (-3059.435) [-3067.190] (-3058.230) -- 0:01:05
      58000 -- [-3058.682] (-3059.980) (-3062.152) (-3059.289) * (-3073.844) (-3058.760) [-3063.823] (-3060.578) -- 0:01:04
      58500 -- (-3059.147) (-3061.360) [-3067.689] (-3059.491) * [-3063.690] (-3058.143) (-3069.782) (-3059.426) -- 0:01:20
      59000 -- (-3060.928) (-3065.298) [-3056.676] (-3057.529) * [-3058.860] (-3059.219) (-3068.043) (-3059.781) -- 0:01:19
      59500 -- (-3060.894) (-3067.315) [-3063.455] (-3059.156) * (-3064.376) (-3058.234) [-3061.452] (-3059.659) -- 0:01:19
      60000 -- (-3060.879) [-3061.071] (-3061.729) (-3059.348) * (-3068.067) (-3058.220) [-3060.466] (-3060.159) -- 0:01:18

      Average standard deviation of split frequencies: 0.018366

      60500 -- (-3063.622) [-3061.976] (-3061.425) (-3061.736) * (-3063.251) (-3058.552) [-3060.545] (-3059.333) -- 0:01:17
      61000 -- (-3065.023) [-3056.784] (-3061.049) (-3061.730) * [-3060.413] (-3059.726) (-3060.889) (-3060.551) -- 0:01:16
      61500 -- (-3063.666) (-3070.929) [-3064.120] (-3059.998) * [-3059.382] (-3058.351) (-3064.343) (-3059.869) -- 0:01:16
      62000 -- (-3063.378) (-3071.134) [-3066.728] (-3058.017) * (-3063.570) [-3058.357] (-3062.403) (-3061.054) -- 0:01:15
      62500 -- (-3060.843) (-3067.083) [-3058.185] (-3058.716) * (-3065.255) (-3059.198) (-3059.718) [-3059.142] -- 0:01:15
      63000 -- (-3062.203) [-3060.979] (-3070.089) (-3058.558) * (-3066.822) (-3059.887) [-3065.157] (-3058.584) -- 0:01:14
      63500 -- (-3060.646) (-3067.639) [-3059.903] (-3058.136) * [-3064.605] (-3062.598) (-3066.985) (-3059.986) -- 0:01:13
      64000 -- [-3058.674] (-3073.506) (-3070.482) (-3059.500) * (-3070.641) (-3059.626) [-3062.622] (-3064.607) -- 0:01:13
      64500 -- (-3057.821) [-3060.368] (-3067.968) (-3060.873) * (-3068.113) (-3059.907) [-3063.720] (-3061.014) -- 0:01:12
      65000 -- (-3058.656) (-3060.943) [-3055.660] (-3059.921) * (-3063.611) (-3060.260) [-3062.490] (-3059.450) -- 0:01:11

      Average standard deviation of split frequencies: 0.016882

      65500 -- (-3059.673) (-3068.059) [-3064.702] (-3059.083) * (-3063.031) (-3060.262) [-3060.293] (-3059.281) -- 0:01:11
      66000 -- [-3060.574] (-3066.291) (-3076.007) (-3059.727) * (-3073.214) [-3059.651] (-3062.462) (-3057.500) -- 0:01:10
      66500 -- (-3060.368) (-3065.960) (-3065.069) [-3060.759] * (-3059.396) (-3057.798) [-3059.275] (-3058.200) -- 0:01:10
      67000 -- (-3060.339) (-3062.533) [-3058.816] (-3060.772) * (-3060.864) (-3058.694) (-3066.802) [-3059.848] -- 0:01:09
      67500 -- (-3060.441) [-3061.555] (-3058.257) (-3060.651) * [-3060.768] (-3057.199) (-3068.528) (-3060.055) -- 0:01:09
      68000 -- [-3064.276] (-3068.219) (-3074.735) (-3058.102) * [-3071.064] (-3059.276) (-3057.471) (-3059.989) -- 0:01:08
      68500 -- (-3061.242) (-3060.589) (-3063.455) [-3058.181] * [-3066.172] (-3058.104) (-3064.355) (-3060.248) -- 0:01:07
      69000 -- (-3059.528) (-3063.289) [-3066.566] (-3059.820) * [-3057.087] (-3058.171) (-3064.491) (-3057.980) -- 0:01:07
      69500 -- [-3059.028] (-3061.518) (-3063.587) (-3059.577) * (-3067.623) (-3057.451) (-3067.456) [-3057.107] -- 0:01:06
      70000 -- (-3059.452) (-3062.611) [-3060.808] (-3059.580) * (-3065.462) (-3061.102) [-3061.796] (-3057.374) -- 0:01:06

      Average standard deviation of split frequencies: 0.010309

      70500 -- (-3060.707) (-3061.142) [-3063.248] (-3063.386) * (-3060.894) [-3057.952] (-3071.609) (-3058.238) -- 0:01:05
      71000 -- (-3059.381) [-3063.411] (-3066.413) (-3060.173) * [-3063.220] (-3061.006) (-3063.174) (-3057.890) -- 0:01:05
      71500 -- (-3059.095) (-3061.173) [-3059.169] (-3057.106) * [-3067.265] (-3062.005) (-3061.122) (-3058.148) -- 0:01:17
      72000 -- (-3060.059) [-3062.829] (-3063.393) (-3063.408) * [-3063.366] (-3062.982) (-3063.388) (-3059.195) -- 0:01:17
      72500 -- (-3058.904) [-3063.348] (-3064.153) (-3058.696) * [-3058.898] (-3060.323) (-3061.765) (-3059.726) -- 0:01:16
      73000 -- (-3059.715) [-3057.821] (-3063.347) (-3057.813) * [-3065.636] (-3057.854) (-3067.892) (-3062.233) -- 0:01:16
      73500 -- (-3060.209) (-3063.555) [-3059.150] (-3058.995) * (-3061.417) (-3057.744) [-3070.672] (-3057.971) -- 0:01:15
      74000 -- (-3058.355) [-3064.944] (-3061.092) (-3060.546) * (-3063.143) [-3056.826] (-3069.509) (-3062.017) -- 0:01:15
      74500 -- (-3058.819) (-3072.828) [-3064.230] (-3066.897) * (-3058.682) [-3057.669] (-3062.787) (-3063.539) -- 0:01:14
      75000 -- (-3062.535) (-3062.986) [-3060.284] (-3061.331) * (-3060.428) (-3057.658) [-3060.789] (-3062.177) -- 0:01:14

      Average standard deviation of split frequencies: 0.011278

      75500 -- (-3060.216) [-3065.357] (-3062.777) (-3061.503) * (-3060.626) (-3062.716) [-3064.575] (-3063.171) -- 0:01:13
      76000 -- (-3064.393) (-3062.618) [-3062.294] (-3060.788) * (-3064.678) (-3057.031) (-3071.252) [-3061.132] -- 0:01:12
      76500 -- (-3058.294) (-3068.018) [-3062.471] (-3060.052) * (-3061.179) (-3057.464) (-3061.294) [-3059.573] -- 0:01:12
      77000 -- (-3058.395) (-3060.903) [-3062.743] (-3059.310) * (-3063.383) (-3059.438) [-3062.924] (-3059.419) -- 0:01:11
      77500 -- [-3060.732] (-3061.914) (-3063.884) (-3060.526) * (-3063.998) (-3060.210) [-3059.718] (-3058.678) -- 0:01:11
      78000 -- (-3060.924) (-3065.820) [-3059.029] (-3060.435) * (-3058.094) (-3059.571) [-3064.045] (-3061.170) -- 0:01:10
      78500 -- (-3057.795) (-3069.740) [-3061.609] (-3060.377) * [-3060.698] (-3058.225) (-3060.554) (-3059.560) -- 0:01:10
      79000 -- (-3059.204) (-3061.542) [-3061.907] (-3059.542) * (-3071.296) (-3057.601) [-3061.392] (-3059.829) -- 0:01:09
      79500 -- [-3058.625] (-3062.088) (-3062.387) (-3059.381) * [-3065.051] (-3060.562) (-3063.905) (-3059.455) -- 0:01:09
      80000 -- (-3061.776) (-3070.537) (-3064.851) [-3058.432] * (-3084.327) [-3060.757] (-3070.617) (-3059.881) -- 0:01:09

      Average standard deviation of split frequencies: 0.011156

      80500 -- (-3060.781) (-3062.732) (-3059.649) [-3058.308] * (-3060.477) [-3061.139] (-3062.747) (-3059.573) -- 0:01:08
      81000 -- (-3060.530) [-3063.080] (-3068.893) (-3057.654) * (-3060.763) (-3063.809) (-3064.324) [-3059.573] -- 0:01:08
      81500 -- [-3057.645] (-3065.349) (-3070.264) (-3059.861) * (-3060.788) (-3057.988) (-3062.163) [-3058.779] -- 0:01:07
      82000 -- (-3058.511) (-3061.054) [-3066.755] (-3059.988) * (-3063.807) [-3056.856] (-3061.528) (-3058.763) -- 0:01:07
      82500 -- [-3058.400] (-3066.395) (-3059.954) (-3062.923) * (-3062.944) (-3059.277) [-3059.997] (-3058.745) -- 0:01:06
      83000 -- (-3059.253) [-3056.800] (-3062.756) (-3061.604) * (-3061.513) (-3063.077) [-3065.252] (-3059.913) -- 0:01:06
      83500 -- (-3060.034) [-3062.463] (-3066.553) (-3059.890) * (-3060.186) [-3059.045] (-3079.665) (-3059.242) -- 0:01:05
      84000 -- (-3060.457) (-3060.361) (-3071.864) [-3059.450] * [-3059.781] (-3058.994) (-3075.139) (-3058.951) -- 0:01:05
      84500 -- (-3059.330) (-3065.261) [-3063.342] (-3058.657) * (-3057.935) [-3060.671] (-3074.540) (-3058.951) -- 0:01:15
      85000 -- (-3062.122) (-3058.565) [-3061.556] (-3058.026) * (-3057.339) (-3058.654) [-3061.114] (-3059.513) -- 0:01:15

      Average standard deviation of split frequencies: 0.017939

      85500 -- (-3062.427) [-3060.922] (-3061.663) (-3058.328) * (-3057.927) (-3058.673) [-3061.809] (-3058.303) -- 0:01:14
      86000 -- (-3058.071) [-3063.644] (-3063.261) (-3058.350) * (-3061.928) (-3058.135) [-3065.566] (-3058.139) -- 0:01:14
      86500 -- (-3060.026) (-3066.452) [-3068.584] (-3059.187) * (-3058.640) (-3058.716) [-3061.253] (-3058.651) -- 0:01:13
      87000 -- (-3059.169) [-3063.862] (-3064.002) (-3059.034) * (-3057.595) (-3060.582) [-3062.395] (-3059.164) -- 0:01:13
      87500 -- [-3058.830] (-3063.528) (-3067.888) (-3058.057) * [-3056.156] (-3058.249) (-3071.372) (-3059.164) -- 0:01:13
      88000 -- (-3058.567) (-3058.575) [-3061.970] (-3058.453) * [-3059.217] (-3059.073) (-3067.564) (-3060.291) -- 0:01:12
      88500 -- (-3059.110) (-3068.069) [-3065.271] (-3058.373) * (-3059.102) (-3058.641) [-3062.364] (-3060.291) -- 0:01:12
      89000 -- (-3059.633) (-3068.676) [-3055.470] (-3061.125) * [-3059.213] (-3060.477) (-3061.489) (-3058.172) -- 0:01:11
      89500 -- (-3057.392) (-3061.094) [-3060.421] (-3063.472) * (-3060.297) (-3060.424) [-3068.255] (-3058.170) -- 0:01:11
      90000 -- (-3058.491) (-3064.743) [-3059.508] (-3061.313) * (-3057.994) (-3063.925) [-3068.101] (-3059.155) -- 0:01:10

      Average standard deviation of split frequencies: 0.023633

      90500 -- (-3060.879) [-3062.530] (-3066.707) (-3060.074) * [-3056.277] (-3063.608) (-3075.287) (-3058.582) -- 0:01:10
      91000 -- (-3057.883) (-3060.231) [-3063.123] (-3058.899) * (-3057.169) (-3060.432) [-3059.572] (-3058.766) -- 0:01:09
      91500 -- (-3057.748) (-3063.635) [-3059.797] (-3059.426) * (-3060.250) (-3061.742) (-3060.372) [-3058.760] -- 0:01:09
      92000 -- (-3058.552) [-3063.196] (-3070.255) (-3065.257) * (-3059.987) (-3058.881) (-3062.349) [-3060.039] -- 0:01:09
      92500 -- (-3058.538) (-3062.040) [-3069.266] (-3065.016) * [-3057.688] (-3058.758) (-3066.913) (-3059.037) -- 0:01:08
      93000 -- (-3060.619) [-3059.285] (-3060.366) (-3058.962) * [-3058.420] (-3061.450) (-3062.305) (-3061.187) -- 0:01:08
      93500 -- (-3061.348) (-3068.440) [-3065.164] (-3057.583) * (-3058.087) [-3058.246] (-3067.308) (-3063.002) -- 0:01:07
      94000 -- [-3061.621] (-3066.775) (-3067.219) (-3058.831) * [-3059.987] (-3063.341) (-3060.997) (-3061.261) -- 0:01:07
      94500 -- (-3058.996) (-3061.509) (-3066.311) [-3059.259] * (-3060.205) [-3060.472] (-3060.843) (-3060.256) -- 0:01:07
      95000 -- (-3060.015) (-3067.365) [-3059.429] (-3058.840) * (-3059.897) (-3059.615) [-3060.249] (-3062.964) -- 0:01:06

      Average standard deviation of split frequencies: 0.023660

      95500 -- (-3058.685) (-3059.459) [-3059.528] (-3059.484) * (-3058.349) (-3059.615) (-3059.896) [-3063.342] -- 0:01:06
      96000 -- (-3057.984) (-3074.263) [-3058.479] (-3059.415) * (-3058.813) [-3058.547] (-3058.333) (-3058.418) -- 0:01:05
      96500 -- (-3060.377) [-3061.877] (-3062.023) (-3058.674) * (-3059.781) (-3059.584) [-3058.691] (-3062.359) -- 0:01:05
      97000 -- (-3061.267) (-3063.746) [-3057.902] (-3058.105) * (-3059.169) (-3062.657) (-3059.660) [-3059.834] -- 0:01:14
      97500 -- (-3059.271) (-3067.399) [-3061.590] (-3060.154) * [-3060.361] (-3058.341) (-3060.249) (-3062.279) -- 0:01:14
      98000 -- (-3059.339) (-3067.682) [-3062.097] (-3058.566) * (-3059.866) (-3060.382) [-3058.967] (-3063.430) -- 0:01:13
      98500 -- (-3059.497) [-3056.396] (-3075.690) (-3059.343) * (-3060.841) (-3060.259) [-3058.367] (-3061.824) -- 0:01:13
      99000 -- (-3058.677) (-3064.008) (-3067.458) [-3060.459] * (-3060.812) (-3059.128) (-3055.897) [-3062.413] -- 0:01:12
      99500 -- (-3058.317) [-3063.694] (-3063.623) (-3062.457) * (-3060.136) [-3058.521] (-3056.413) (-3061.581) -- 0:01:12
      100000 -- (-3058.966) (-3059.506) [-3062.158] (-3059.487) * [-3058.830] (-3061.148) (-3060.182) (-3064.679) -- 0:01:12

      Average standard deviation of split frequencies: 0.027246

      100500 -- [-3059.441] (-3062.457) (-3059.036) (-3062.223) * [-3059.371] (-3060.948) (-3058.490) (-3058.106) -- 0:01:11
      101000 -- (-3059.032) [-3059.037] (-3059.636) (-3059.364) * (-3060.679) (-3058.324) (-3058.622) [-3060.324] -- 0:01:11
      101500 -- [-3059.958] (-3061.218) (-3058.194) (-3057.617) * (-3058.852) (-3058.907) (-3058.465) [-3059.044] -- 0:01:10
      102000 -- (-3059.118) (-3061.997) (-3057.913) [-3058.074] * (-3058.329) (-3058.819) (-3057.389) [-3060.232] -- 0:01:10
      102500 -- (-3058.076) [-3057.995] (-3056.448) (-3057.982) * (-3057.787) (-3060.336) (-3057.318) [-3060.667] -- 0:01:10
      103000 -- (-3058.172) (-3070.584) [-3058.416] (-3061.736) * [-3057.782] (-3060.156) (-3057.463) (-3062.281) -- 0:01:09
      103500 -- [-3058.519] (-3068.724) (-3057.355) (-3059.224) * [-3057.467] (-3062.484) (-3059.038) (-3062.376) -- 0:01:09
      104000 -- (-3059.805) (-3068.337) [-3057.671] (-3058.859) * (-3057.522) (-3059.405) [-3061.962] (-3061.646) -- 0:01:08
      104500 -- (-3059.908) (-3061.014) [-3059.356] (-3058.918) * [-3057.665] (-3056.345) (-3058.869) (-3058.479) -- 0:01:08
      105000 -- (-3060.582) [-3060.617] (-3062.755) (-3062.927) * [-3057.859] (-3056.962) (-3059.882) (-3058.458) -- 0:01:08

      Average standard deviation of split frequencies: 0.025470

      105500 -- (-3061.444) [-3068.260] (-3055.957) (-3059.916) * (-3058.311) [-3061.903] (-3061.688) (-3057.709) -- 0:01:07
      106000 -- (-3058.766) (-3074.014) [-3058.111] (-3059.520) * (-3057.746) [-3062.481] (-3057.467) (-3061.554) -- 0:01:07
      106500 -- [-3057.967] (-3064.047) (-3057.935) (-3059.594) * [-3058.427] (-3059.847) (-3057.652) (-3060.246) -- 0:01:07
      107000 -- (-3058.140) (-3059.701) [-3056.741] (-3058.786) * (-3058.392) (-3058.918) [-3057.508] (-3063.724) -- 0:01:06
      107500 -- [-3058.083] (-3061.527) (-3061.051) (-3059.504) * (-3063.555) (-3060.128) [-3058.657] (-3061.503) -- 0:01:06
      108000 -- (-3058.488) [-3061.524] (-3062.345) (-3059.762) * (-3058.908) (-3057.512) (-3060.854) [-3059.228] -- 0:01:06
      108500 -- (-3058.115) [-3061.663] (-3059.575) (-3060.070) * (-3059.821) [-3059.182] (-3058.847) (-3063.240) -- 0:01:05
      109000 -- (-3057.546) [-3060.173] (-3059.107) (-3060.685) * (-3058.573) [-3062.660] (-3059.785) (-3068.622) -- 0:01:05
      109500 -- (-3059.037) [-3058.468] (-3061.155) (-3060.450) * (-3061.511) (-3060.980) (-3058.607) [-3067.797] -- 0:01:05
      110000 -- (-3058.263) [-3058.468] (-3062.460) (-3059.409) * (-3061.262) [-3059.719] (-3062.345) (-3065.845) -- 0:01:04

      Average standard deviation of split frequencies: 0.027107

      110500 -- (-3058.143) [-3063.946] (-3064.594) (-3060.028) * (-3060.201) [-3056.829] (-3061.806) (-3063.642) -- 0:01:12
      111000 -- [-3063.091] (-3071.148) (-3064.610) (-3058.344) * (-3061.623) [-3058.309] (-3062.819) (-3061.592) -- 0:01:12
      111500 -- (-3059.125) (-3066.347) (-3065.508) [-3059.171] * (-3060.756) [-3056.387] (-3059.249) (-3062.870) -- 0:01:11
      112000 -- (-3058.308) (-3069.474) (-3059.553) [-3059.736] * (-3060.412) [-3058.818] (-3059.409) (-3061.652) -- 0:01:11
      112500 -- (-3058.613) [-3060.549] (-3059.293) (-3058.189) * (-3063.200) (-3058.630) [-3057.952] (-3069.421) -- 0:01:11
      113000 -- (-3058.982) [-3062.881] (-3063.156) (-3058.244) * [-3061.476] (-3057.144) (-3062.554) (-3057.158) -- 0:01:10
      113500 -- (-3058.817) [-3062.025] (-3060.706) (-3060.250) * (-3059.488) [-3058.753] (-3061.115) (-3058.500) -- 0:01:10
      114000 -- (-3058.754) [-3058.377] (-3060.192) (-3060.854) * (-3057.907) (-3056.806) (-3061.330) [-3058.430] -- 0:01:09
      114500 -- (-3059.935) [-3057.491] (-3059.184) (-3058.247) * [-3057.525] (-3058.377) (-3065.726) (-3060.250) -- 0:01:09
      115000 -- [-3060.429] (-3067.869) (-3058.727) (-3059.685) * [-3057.426] (-3057.836) (-3065.982) (-3060.279) -- 0:01:09

      Average standard deviation of split frequencies: 0.026600

      115500 -- [-3060.402] (-3062.277) (-3065.313) (-3060.892) * [-3056.713] (-3057.943) (-3061.597) (-3061.204) -- 0:01:08
      116000 -- (-3058.789) (-3066.261) (-3058.810) [-3061.831] * (-3060.526) [-3058.090] (-3059.760) (-3059.101) -- 0:01:08
      116500 -- (-3059.544) (-3066.889) [-3061.055] (-3059.169) * [-3059.865] (-3057.978) (-3061.321) (-3057.936) -- 0:01:08
      117000 -- (-3060.280) (-3063.600) (-3059.610) [-3059.098] * (-3058.322) [-3057.059] (-3064.154) (-3058.491) -- 0:01:07
      117500 -- [-3058.119] (-3066.465) (-3058.137) (-3059.579) * (-3058.399) (-3059.510) (-3062.523) [-3058.661] -- 0:01:07
      118000 -- (-3058.064) [-3067.870] (-3059.533) (-3059.733) * [-3057.136] (-3059.692) (-3060.527) (-3058.772) -- 0:01:07
      118500 -- (-3060.364) [-3061.462] (-3058.133) (-3062.075) * (-3058.721) (-3057.499) (-3060.510) [-3060.861] -- 0:01:06
      119000 -- (-3059.305) (-3062.573) [-3059.710] (-3062.971) * (-3058.327) (-3058.586) [-3060.417] (-3061.932) -- 0:01:06
      119500 -- (-3059.853) [-3059.819] (-3058.131) (-3061.740) * (-3058.188) [-3057.874] (-3059.957) (-3061.321) -- 0:01:06
      120000 -- [-3058.799] (-3058.697) (-3056.183) (-3061.859) * [-3059.117] (-3058.503) (-3062.239) (-3059.996) -- 0:01:06

      Average standard deviation of split frequencies: 0.027702

      120500 -- (-3059.675) (-3064.568) (-3057.566) [-3059.757] * [-3058.589] (-3059.594) (-3058.478) (-3059.701) -- 0:01:05
      121000 -- (-3059.675) (-3058.691) [-3057.690] (-3063.271) * (-3058.961) [-3059.354] (-3058.306) (-3059.591) -- 0:01:05
      121500 -- (-3058.759) [-3063.766] (-3059.915) (-3062.300) * [-3060.429] (-3058.424) (-3058.332) (-3060.322) -- 0:01:05
      122000 -- (-3058.676) (-3057.667) (-3061.000) [-3062.781] * [-3060.003] (-3057.721) (-3058.124) (-3060.478) -- 0:01:04
      122500 -- (-3057.892) [-3057.652] (-3058.912) (-3059.853) * (-3057.614) (-3058.362) (-3058.549) [-3060.632] -- 0:01:04
      123000 -- [-3058.754] (-3066.153) (-3059.277) (-3060.176) * [-3059.347] (-3058.907) (-3058.168) (-3057.998) -- 0:01:04
      123500 -- (-3058.412) [-3062.985] (-3058.134) (-3061.258) * (-3058.503) [-3058.851] (-3060.372) (-3058.895) -- 0:01:10
      124000 -- (-3058.286) (-3062.201) [-3058.364] (-3061.319) * (-3058.736) (-3058.297) [-3060.294] (-3057.082) -- 0:01:10
      124500 -- (-3059.130) (-3055.311) [-3059.494] (-3061.054) * (-3057.557) (-3058.837) (-3062.194) [-3058.538] -- 0:01:10
      125000 -- (-3060.201) (-3059.590) [-3059.935] (-3059.839) * (-3059.290) [-3059.479] (-3058.981) (-3058.281) -- 0:01:10

      Average standard deviation of split frequencies: 0.030794

      125500 -- [-3059.489] (-3063.885) (-3061.333) (-3059.072) * [-3059.560] (-3060.382) (-3059.044) (-3058.487) -- 0:01:09
      126000 -- (-3059.955) [-3058.005] (-3059.059) (-3059.807) * (-3060.482) (-3061.141) (-3059.286) [-3059.016] -- 0:01:09
      126500 -- (-3060.738) (-3062.518) (-3058.697) [-3062.636] * (-3061.157) (-3056.585) (-3060.204) [-3059.331] -- 0:01:09
      127000 -- (-3060.263) (-3064.775) (-3057.212) [-3059.571] * (-3058.837) [-3058.627] (-3059.343) (-3059.238) -- 0:01:08
      127500 -- (-3061.121) (-3072.697) [-3057.779] (-3057.723) * (-3058.818) (-3060.110) [-3060.598] (-3060.173) -- 0:01:08
      128000 -- (-3061.476) (-3061.116) (-3057.580) [-3058.212] * (-3059.091) (-3060.425) (-3060.526) [-3060.492] -- 0:01:08
      128500 -- (-3061.496) [-3064.611] (-3058.150) (-3059.009) * [-3059.246] (-3060.477) (-3060.316) (-3060.854) -- 0:01:07
      129000 -- (-3061.272) (-3065.047) (-3058.282) [-3058.884] * (-3059.152) (-3059.976) [-3059.721] (-3060.144) -- 0:01:07
      129500 -- (-3066.650) [-3065.983] (-3059.766) (-3058.892) * [-3059.468] (-3059.977) (-3059.187) (-3059.750) -- 0:01:07
      130000 -- (-3059.698) (-3059.793) [-3057.615] (-3059.398) * [-3059.610] (-3059.095) (-3059.101) (-3060.491) -- 0:01:06

      Average standard deviation of split frequencies: 0.028206

      130500 -- [-3060.042] (-3071.701) (-3060.182) (-3061.953) * [-3060.592] (-3058.127) (-3057.582) (-3063.864) -- 0:01:06
      131000 -- (-3061.210) (-3070.761) [-3058.739] (-3057.457) * (-3061.065) [-3059.266] (-3059.299) (-3062.637) -- 0:01:06
      131500 -- (-3060.314) (-3063.719) (-3064.436) [-3057.624] * [-3063.398] (-3060.432) (-3058.822) (-3059.561) -- 0:01:06
      132000 -- (-3060.276) [-3057.769] (-3060.654) (-3056.860) * (-3063.405) (-3060.628) (-3058.132) [-3059.456] -- 0:01:05
      132500 -- [-3058.056] (-3057.204) (-3061.194) (-3057.123) * (-3057.731) [-3058.811] (-3059.708) (-3058.884) -- 0:01:05
      133000 -- (-3060.990) (-3058.325) (-3060.146) [-3057.908] * [-3058.462] (-3059.839) (-3061.512) (-3059.379) -- 0:01:05
      133500 -- [-3059.977] (-3059.382) (-3057.708) (-3059.315) * [-3059.311] (-3057.927) (-3061.243) (-3057.021) -- 0:01:04
      134000 -- (-3059.981) (-3059.102) (-3057.064) [-3062.649] * (-3059.268) (-3057.720) (-3060.014) [-3058.922] -- 0:01:04
      134500 -- [-3055.542] (-3059.911) (-3059.308) (-3060.760) * (-3058.329) (-3059.195) [-3058.608] (-3058.327) -- 0:01:04
      135000 -- [-3056.551] (-3058.558) (-3059.343) (-3063.887) * [-3058.329] (-3059.780) (-3062.318) (-3058.607) -- 0:01:04

      Average standard deviation of split frequencies: 0.030881

      135500 -- [-3057.832] (-3059.194) (-3058.591) (-3060.686) * (-3058.963) (-3059.170) [-3061.833] (-3058.116) -- 0:01:03
      136000 -- (-3058.483) [-3060.973] (-3063.017) (-3060.440) * [-3058.120] (-3060.934) (-3058.151) (-3060.059) -- 0:01:03
      136500 -- (-3058.037) (-3057.691) (-3060.018) [-3058.333] * (-3059.382) [-3059.366] (-3062.156) (-3060.119) -- 0:01:09
      137000 -- [-3057.396] (-3059.614) (-3059.130) (-3059.334) * (-3059.783) [-3058.505] (-3062.546) (-3059.881) -- 0:01:09
      137500 -- [-3058.457] (-3058.186) (-3060.153) (-3057.259) * (-3058.752) (-3058.578) (-3061.511) [-3060.022] -- 0:01:09
      138000 -- [-3058.718] (-3058.141) (-3059.684) (-3058.946) * (-3058.061) [-3058.683] (-3061.126) (-3064.102) -- 0:01:08
      138500 -- (-3059.460) (-3057.935) [-3057.949] (-3058.612) * [-3059.129] (-3059.176) (-3061.634) (-3063.555) -- 0:01:08
      139000 -- (-3058.460) [-3059.228] (-3058.670) (-3057.216) * (-3060.148) (-3059.895) (-3058.117) [-3057.883] -- 0:01:08
      139500 -- [-3060.029] (-3058.107) (-3060.048) (-3059.365) * (-3057.856) (-3059.742) [-3058.442] (-3056.976) -- 0:01:07
      140000 -- (-3058.243) (-3063.062) [-3060.231] (-3058.131) * (-3057.643) (-3057.919) (-3059.998) [-3060.488] -- 0:01:07

      Average standard deviation of split frequencies: 0.031837

      140500 -- [-3059.696] (-3062.097) (-3058.294) (-3060.120) * [-3057.306] (-3058.366) (-3057.565) (-3059.540) -- 0:01:07
      141000 -- [-3060.113] (-3061.829) (-3058.295) (-3059.859) * (-3057.852) (-3061.431) (-3060.852) [-3059.189] -- 0:01:07
      141500 -- (-3057.817) (-3061.364) [-3058.426] (-3057.495) * (-3058.083) (-3058.120) (-3060.073) [-3059.598] -- 0:01:06
      142000 -- (-3058.051) (-3061.349) (-3058.418) [-3057.398] * (-3058.579) [-3059.749] (-3059.023) (-3058.677) -- 0:01:06
      142500 -- [-3057.284] (-3060.027) (-3061.414) (-3058.397) * (-3057.746) (-3059.698) [-3060.137] (-3059.916) -- 0:01:06
      143000 -- [-3057.717] (-3060.933) (-3059.235) (-3058.930) * [-3060.423] (-3059.584) (-3059.044) (-3058.656) -- 0:01:05
      143500 -- [-3058.134] (-3059.127) (-3060.010) (-3058.030) * [-3060.274] (-3060.178) (-3057.923) (-3060.633) -- 0:01:05
      144000 -- (-3059.425) (-3058.130) (-3058.030) [-3057.476] * (-3059.512) (-3058.606) (-3058.786) [-3061.106] -- 0:01:05
      144500 -- (-3059.523) (-3060.057) [-3060.200] (-3056.258) * [-3060.467] (-3060.152) (-3059.672) (-3058.091) -- 0:01:05
      145000 -- [-3058.870] (-3059.721) (-3061.292) (-3059.245) * [-3060.961] (-3059.018) (-3059.967) (-3059.107) -- 0:01:04

      Average standard deviation of split frequencies: 0.032288

      145500 -- (-3059.282) (-3058.651) (-3059.248) [-3058.829] * [-3057.773] (-3059.331) (-3059.303) (-3058.225) -- 0:01:04
      146000 -- (-3061.290) (-3059.066) [-3059.348] (-3057.798) * (-3061.222) [-3058.882] (-3059.335) (-3058.779) -- 0:01:04
      146500 -- (-3061.219) (-3058.868) [-3058.710] (-3061.316) * (-3061.151) (-3060.582) [-3059.827] (-3059.771) -- 0:01:04
      147000 -- [-3059.581] (-3059.957) (-3059.614) (-3059.359) * (-3060.668) (-3059.196) (-3058.827) [-3061.966] -- 0:01:03
      147500 -- (-3059.878) (-3060.332) (-3058.516) [-3059.541] * (-3059.472) [-3058.665] (-3057.862) (-3062.346) -- 0:01:03
      148000 -- (-3061.609) [-3059.625] (-3056.595) (-3057.776) * [-3060.435] (-3062.827) (-3057.350) (-3061.138) -- 0:01:03
      148500 -- (-3060.993) (-3059.041) (-3058.397) [-3058.136] * (-3062.693) (-3058.805) [-3056.935] (-3061.160) -- 0:01:03
      149000 -- (-3064.583) (-3058.548) [-3058.452] (-3058.439) * [-3060.733] (-3058.539) (-3055.854) (-3059.495) -- 0:01:02
      149500 -- (-3063.412) [-3062.850] (-3059.632) (-3061.204) * (-3062.501) (-3057.560) (-3059.462) [-3059.055] -- 0:01:02
      150000 -- (-3060.313) (-3062.354) (-3057.549) [-3060.423] * [-3059.363] (-3061.082) (-3058.499) (-3058.821) -- 0:01:08

      Average standard deviation of split frequencies: 0.026956

      150500 -- (-3062.943) [-3058.487] (-3058.955) (-3062.981) * (-3058.857) (-3058.069) [-3057.859] (-3061.529) -- 0:01:07
      151000 -- (-3058.120) (-3058.602) (-3057.884) [-3062.252] * [-3059.482] (-3059.271) (-3057.031) (-3063.403) -- 0:01:07
      151500 -- [-3058.205] (-3059.089) (-3058.596) (-3060.304) * [-3059.889] (-3059.716) (-3059.193) (-3063.007) -- 0:01:07
      152000 -- (-3059.601) (-3058.817) [-3058.531] (-3059.045) * (-3058.988) [-3059.851] (-3064.442) (-3060.028) -- 0:01:06
      152500 -- (-3058.241) (-3062.885) [-3058.186] (-3059.045) * (-3061.452) [-3059.377] (-3064.072) (-3057.983) -- 0:01:06
      153000 -- (-3060.072) (-3061.664) [-3058.571] (-3059.045) * (-3064.494) (-3058.877) [-3059.594] (-3057.789) -- 0:01:06
      153500 -- (-3059.874) [-3058.935] (-3059.733) (-3061.394) * (-3066.954) [-3058.307] (-3060.352) (-3061.995) -- 0:01:06
      154000 -- (-3059.420) (-3059.374) [-3059.670] (-3060.237) * (-3058.766) (-3060.500) [-3059.511] (-3061.147) -- 0:01:05
      154500 -- (-3059.166) (-3059.480) [-3057.721] (-3061.278) * (-3058.547) (-3060.637) [-3059.234] (-3058.715) -- 0:01:05
      155000 -- (-3057.662) (-3058.987) (-3059.533) [-3060.754] * (-3059.194) (-3060.307) (-3059.898) [-3057.662] -- 0:01:05

      Average standard deviation of split frequencies: 0.027628

      155500 -- (-3057.992) (-3058.458) [-3059.586] (-3059.367) * (-3059.234) (-3063.901) (-3060.752) [-3057.943] -- 0:01:05
      156000 -- (-3058.248) [-3058.646] (-3058.831) (-3058.684) * [-3058.213] (-3063.013) (-3061.844) (-3060.070) -- 0:01:04
      156500 -- [-3058.558] (-3061.190) (-3058.416) (-3061.070) * (-3058.744) (-3068.980) [-3058.1