>C1
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C2
VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSSooooooooooooooo
>C3
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C4
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C5
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C6
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=313
C1 VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
C2 ---------------VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
C3 VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
C4 VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
C5 VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
C6 VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
***********************************
C1 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
C2 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
C3 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
C4 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
C5 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
C6 TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
**************************************************
C1 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
C2 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
C3 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
C4 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
C5 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
C6 ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
**************************************************
C1 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
C2 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
C3 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
C4 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
C5 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
C6 RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
**************************************************
C1 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
C2 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
C3 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
C4 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
C5 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
C6 LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
**************************************************
C1 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS--
C2 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSSoo
C3 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS--
C4 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS--
C5 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS--
C6 KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS--
************************************************
C1 -------------
C2 ooooooooooooo
C3 -------------
C4 -------------
C5 -------------
C6 -------------
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 298 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 298 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9010]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9010]--->[8960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.852 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
C2 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
C3 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
C4 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
C5 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
C6 VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGG
**************************************************
C1 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
C2 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
C3 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
C4 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
C5 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
C6 FALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMV
**************************************************
C1 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
C2 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
C3 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
C4 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
C5 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
C6 CSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRAS
**************************************************
C1 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
C2 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
C3 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
C4 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
C5 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
C6 TLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFR
**************************************************
C1 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
C2 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
C3 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
C4 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
C5 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
C6 PILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFL
**************************************************
C1 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
C2 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
C3 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
C4 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
C5 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
C6 VIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
*********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
C2 ---------------------------------------------GTGCT
C3 GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
C4 GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
C5 GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
C6 GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
*****
C1 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
C2 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
C3 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
C4 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
C5 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
C6 GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
**************************************************
C1 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
C2 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
C3 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
C4 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
C5 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
C6 GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
**************************************************
C1 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
C2 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
C3 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
C4 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
C5 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
C6 ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
**************************************************
C1 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
C2 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
C3 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
C4 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
C5 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
C6 GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
**************************************************
C1 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
C2 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
C3 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
C4 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
C5 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
C6 CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
**************************************************
C1 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
C2 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
C3 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
C4 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
C5 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
C6 GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
**************************************************
C1 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
C2 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
C3 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
C4 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
C5 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
C6 CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
**************************************************
C1 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
C2 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
C3 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
C4 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
C5 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
C6 GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
**************************************************
C1 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
C2 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
C3 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
C4 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
C5 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
C6 CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
**************************************************
C1 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
C2 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
C3 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
C4 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
C5 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
C6 AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
**************************************************
C1 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
C2 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
C3 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
C4 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
C5 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
C6 TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
**************************************************
C1 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
C2 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
C3 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
C4 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
C5 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
C6 CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
**************************************************
C1 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
C2 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
C3 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
C4 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
C5 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
C6 CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
**************************************************
C1 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
C2 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
C3 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
C4 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
C5 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
C6 TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
**************************************************
C1 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
C2 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
C3 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
C4 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
C5 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
C6 AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
**************************************************
C1 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
C2 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
C3 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
C4 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
C5 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
C6 CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
**************************************************
C1 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
C2 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
C3 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
C4 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
C5 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
C6 GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
********************************************
C1 ---------------------------------------
C2 ---------------------------------------
C3 ---------------------------------------
C4 ---------------------------------------
C5 ---------------------------------------
C6 ---------------------------------------
>C1
GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C2
---------------------------------------------GTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C3
GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C4
GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C5
GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C6
GTGGTTACCCACCGGCGTCCCGGCGAGCTAGCCAAGGCGTTGGATGTGCT
GAGCACCCAGACCCGGTTACCTGATCACTTGATCGTGGTGGATAACGACG
GTGCTGAACACAGCCGGGTGCGCGATCTTGTTGACGGTCAACCAATCCCA
ACCACTTACTTGGGTTCACGCAAAAACCTAGGAGGGGCAGGAGGTTTCGC
GCTAGGAATGTTGCACGCTCTGACGCTGGGCGCTGATTGGGTTTGGCTGG
CCGACGACGACGGGATCCCGCAGGACACCCGGATGCTTGCGACCCTCTTG
GCATGCGCCGATAAGTACGGCCTAGCTGAGGTGTCACCGATGGTGTGTAG
CCTGGACGATCCGGAACTGCTTGCGTTTCCGTTGCGGCGCGGCCTAGGCT
GGCATAGGCGAGCAAGCGAATTGCGTACCAAAGAGGGGCAAGATCTGCTG
CGGGGTATCGCATCGCTATTCAACGGCGCGCTGTTTCGGGCGTCCACCTT
AGACTCGATCGGCGTTCCGGATATGCGACTGTTCATACGAGGCGACGAGG
TGGAGTTGCATCGGCGGCTGGCACGTTCCGGCCTGCCATTCGGGACCTGC
CTGGAGACAATCTACCTACATCCCTGTGGATCCGACGAGTTCCGGCCGAT
CCTGGGCGGCCGCATGCACACCCAGTATCCCGACGACCCCATCAAGCGAT
TCTTCACTTACCGAAACCGCGGCTACCTGATGGCACAACCGGGTCTGCGC
AAGCTGGTAGCCCAAGAGTGGTTTCGGTTCAGCTGGTTCTTCCTCGTTAT
CCGCCGCGACCCCAAGGGGCTACGAGAGTGGATTCGCTTGCATCGCTTGG
GACGTCGCGAGAATTTCGGTAAGCCCGACATGAGAGGATCATCA------
---------------------------------------
>C1
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C2
oooooooooooooooVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C3
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C4
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C5
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
>C6
VVTHRRPGELAKALDVLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIP
TTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLL
ACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLL
RGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTC
LETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLR
KLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 939 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789014
Setting output file names to "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1279218454
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0696608714
Seed = 1521547946
Swapseed = 1579789014
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 9 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1996.532713 -- -24.965149
Chain 2 -- -1996.526275 -- -24.965149
Chain 3 -- -1996.532717 -- -24.965149
Chain 4 -- -1996.526384 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1996.526386 -- -24.965149
Chain 2 -- -1996.532149 -- -24.965149
Chain 3 -- -1996.526384 -- -24.965149
Chain 4 -- -1996.532713 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1996.533] (-1996.526) (-1996.533) (-1996.526) * [-1996.526] (-1996.532) (-1996.526) (-1996.533)
500 -- (-1240.286) [-1225.221] (-1262.676) (-1242.729) * [-1229.971] (-1230.667) (-1233.511) (-1228.256) -- 0:00:00
1000 -- (-1227.962) [-1230.440] (-1246.023) (-1235.720) * (-1237.364) [-1234.353] (-1234.700) (-1234.957) -- 0:00:00
1500 -- (-1226.959) (-1229.008) (-1226.824) [-1229.923] * (-1229.997) (-1234.408) (-1237.899) [-1227.730] -- 0:00:00
2000 -- [-1230.425] (-1237.473) (-1239.925) (-1232.492) * (-1232.077) (-1234.103) (-1231.117) [-1233.644] -- 0:00:00
2500 -- (-1237.752) (-1233.366) (-1233.463) [-1231.864] * (-1241.585) [-1228.793] (-1235.773) (-1235.090) -- 0:00:00
3000 -- (-1233.442) (-1230.935) [-1226.125] (-1227.484) * (-1234.905) (-1228.184) [-1228.189] (-1232.759) -- 0:00:00
3500 -- [-1233.668] (-1232.823) (-1230.092) (-1235.122) * [-1229.245] (-1230.760) (-1239.331) (-1232.337) -- 0:00:00
4000 -- (-1231.432) [-1226.560] (-1234.403) (-1230.605) * (-1236.801) (-1228.255) (-1226.912) [-1231.948] -- 0:00:00
4500 -- (-1232.483) (-1227.134) (-1229.977) [-1229.154] * [-1229.970] (-1230.921) (-1247.451) (-1232.870) -- 0:00:00
5000 -- (-1236.064) (-1236.047) (-1235.935) [-1229.623] * [-1230.875] (-1229.110) (-1229.157) (-1230.020) -- 0:00:00
Average standard deviation of split frequencies: 0.087996
5500 -- [-1229.814] (-1227.146) (-1234.345) (-1231.450) * (-1235.289) (-1235.028) [-1238.827] (-1234.236) -- 0:03:00
6000 -- [-1228.348] (-1233.914) (-1225.006) (-1234.698) * [-1226.977] (-1231.184) (-1232.370) (-1231.789) -- 0:02:45
6500 -- (-1231.007) (-1232.680) (-1230.261) [-1236.275] * [-1237.293] (-1237.208) (-1234.917) (-1228.061) -- 0:02:32
7000 -- (-1229.134) [-1233.651] (-1229.547) (-1236.602) * (-1229.527) [-1235.587] (-1232.132) (-1235.594) -- 0:02:21
7500 -- (-1227.368) (-1233.745) (-1232.930) [-1232.951] * [-1233.990] (-1231.979) (-1237.474) (-1229.100) -- 0:02:12
8000 -- [-1231.431] (-1234.577) (-1237.237) (-1234.196) * (-1237.036) [-1239.144] (-1231.315) (-1236.762) -- 0:02:04
8500 -- (-1230.587) [-1238.968] (-1238.248) (-1239.613) * [-1231.297] (-1229.357) (-1233.902) (-1238.867) -- 0:01:56
9000 -- (-1231.304) (-1231.834) (-1236.794) [-1222.004] * (-1236.499) (-1228.208) (-1236.777) [-1235.105] -- 0:01:50
9500 -- (-1237.319) (-1233.330) (-1229.219) [-1222.985] * [-1229.252] (-1240.939) (-1234.921) (-1233.471) -- 0:01:44
10000 -- (-1238.901) (-1237.470) [-1228.939] (-1222.987) * (-1233.007) (-1234.593) (-1232.572) [-1235.971] -- 0:01:39
Average standard deviation of split frequencies: 0.065239
10500 -- (-1234.953) (-1229.115) (-1232.777) [-1222.367] * [-1233.502] (-1234.683) (-1233.532) (-1241.061) -- 0:01:34
11000 -- (-1232.947) (-1230.159) [-1225.765] (-1223.713) * (-1228.214) [-1238.133] (-1233.299) (-1232.341) -- 0:01:29
11500 -- (-1232.876) (-1230.595) (-1231.060) [-1223.745] * [-1233.480] (-1231.673) (-1234.869) (-1233.693) -- 0:01:25
12000 -- (-1230.063) (-1235.122) [-1228.127] (-1223.563) * (-1230.888) [-1230.264] (-1229.421) (-1234.808) -- 0:01:22
12500 -- [-1239.676] (-1233.806) (-1237.195) (-1223.887) * [-1229.737] (-1239.683) (-1232.287) (-1234.962) -- 0:01:19
13000 -- (-1237.920) (-1229.416) [-1231.153] (-1223.865) * [-1234.498] (-1238.332) (-1233.587) (-1227.948) -- 0:01:15
13500 -- (-1233.000) (-1229.537) (-1230.276) [-1224.764] * (-1232.053) [-1234.037] (-1231.960) (-1233.104) -- 0:01:13
14000 -- (-1231.048) (-1229.335) [-1233.807] (-1224.770) * (-1232.170) (-1234.373) (-1227.182) [-1229.480] -- 0:01:10
14500 -- (-1228.341) (-1243.012) (-1226.578) [-1225.436] * (-1231.024) (-1230.455) (-1237.205) [-1233.545] -- 0:01:07
15000 -- [-1227.553] (-1229.833) (-1231.595) (-1222.125) * (-1229.382) [-1227.280] (-1230.151) (-1239.005) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-1231.806) [-1230.092] (-1228.924) (-1221.599) * [-1230.639] (-1234.668) (-1229.607) (-1230.381) -- 0:01:03
16000 -- (-1231.134) [-1231.269] (-1230.185) (-1223.494) * (-1244.715) (-1226.306) [-1229.412] (-1239.214) -- 0:01:01
16500 -- (-1243.414) (-1226.066) [-1230.203] (-1224.701) * [-1233.853] (-1243.856) (-1228.917) (-1238.405) -- 0:00:59
17000 -- [-1229.399] (-1222.122) (-1239.074) (-1233.505) * [-1233.684] (-1230.141) (-1237.400) (-1230.567) -- 0:01:55
17500 -- [-1230.574] (-1221.286) (-1235.299) (-1221.073) * (-1226.778) (-1230.556) [-1229.235] (-1230.067) -- 0:01:52
18000 -- (-1230.388) (-1221.772) (-1228.875) [-1228.854] * (-1228.481) (-1240.318) (-1237.894) [-1235.772] -- 0:01:49
18500 -- [-1232.105] (-1223.001) (-1244.048) (-1223.404) * (-1231.632) (-1233.302) (-1231.861) [-1229.043] -- 0:01:46
19000 -- [-1231.212] (-1223.945) (-1228.260) (-1225.361) * [-1230.002] (-1234.449) (-1234.674) (-1228.628) -- 0:01:43
19500 -- (-1240.832) [-1221.695] (-1241.227) (-1221.925) * (-1230.473) [-1235.815] (-1234.017) (-1234.873) -- 0:01:40
20000 -- (-1237.820) (-1221.071) (-1230.543) [-1222.070] * (-1233.165) (-1227.424) (-1239.781) [-1231.582] -- 0:01:38
Average standard deviation of split frequencies: 0.041595
20500 -- (-1238.696) (-1224.666) (-1231.254) [-1223.703] * (-1231.819) (-1238.062) (-1233.794) [-1231.244] -- 0:01:35
21000 -- (-1225.721) [-1221.592] (-1240.744) (-1221.629) * (-1234.589) [-1227.638] (-1231.364) (-1242.075) -- 0:01:33
21500 -- (-1233.284) [-1223.188] (-1229.224) (-1227.138) * (-1228.604) (-1232.746) (-1227.153) [-1231.130] -- 0:01:31
22000 -- (-1239.144) (-1224.187) [-1229.215] (-1223.273) * (-1231.776) (-1234.055) (-1238.308) [-1231.434] -- 0:01:28
22500 -- (-1240.875) (-1223.403) (-1231.178) [-1224.575] * [-1236.575] (-1236.577) (-1230.423) (-1235.313) -- 0:01:26
23000 -- [-1231.256] (-1227.679) (-1227.037) (-1222.075) * (-1226.778) (-1230.285) [-1227.036] (-1232.616) -- 0:01:24
23500 -- (-1232.177) (-1224.140) (-1231.239) [-1220.743] * [-1231.481] (-1240.143) (-1232.218) (-1243.693) -- 0:01:23
24000 -- (-1234.625) (-1224.295) (-1229.230) [-1221.084] * (-1233.304) (-1229.777) [-1231.259] (-1227.836) -- 0:01:21
24500 -- (-1241.271) [-1225.812] (-1230.919) (-1220.859) * (-1242.387) [-1220.874] (-1237.732) (-1231.612) -- 0:01:19
25000 -- (-1228.207) (-1224.070) [-1225.607] (-1221.477) * (-1232.302) [-1220.722] (-1229.686) (-1231.855) -- 0:01:18
Average standard deviation of split frequencies: 0.049860
25500 -- (-1227.767) (-1223.546) (-1241.868) [-1223.677] * (-1234.101) [-1220.840] (-1233.392) (-1229.072) -- 0:01:16
26000 -- (-1230.423) [-1221.794] (-1238.609) (-1222.241) * [-1238.496] (-1220.820) (-1226.261) (-1234.414) -- 0:01:14
26500 -- (-1226.201) [-1221.881] (-1236.326) (-1223.227) * (-1229.952) (-1220.568) [-1227.050] (-1231.344) -- 0:01:13
27000 -- [-1226.086] (-1221.484) (-1230.953) (-1229.797) * (-1222.988) (-1221.800) [-1228.602] (-1231.607) -- 0:01:12
27500 -- (-1220.929) [-1222.172] (-1241.186) (-1224.888) * (-1223.049) [-1222.338] (-1233.283) (-1241.428) -- 0:01:10
28000 -- (-1223.611) (-1222.263) [-1230.049] (-1224.941) * (-1223.775) (-1225.799) [-1233.086] (-1229.459) -- 0:01:09
28500 -- [-1221.282] (-1224.028) (-1229.304) (-1225.565) * [-1223.464] (-1224.807) (-1235.121) (-1233.176) -- 0:01:08
29000 -- (-1221.550) (-1223.116) (-1230.169) [-1222.898] * (-1227.325) (-1222.507) [-1230.550] (-1234.104) -- 0:01:40
29500 -- (-1222.735) (-1225.079) (-1235.832) [-1225.467] * [-1221.210] (-1221.713) (-1238.304) (-1229.347) -- 0:01:38
30000 -- (-1223.231) (-1224.161) [-1230.768] (-1221.598) * [-1221.280] (-1223.207) (-1235.176) (-1232.468) -- 0:01:37
Average standard deviation of split frequencies: 0.047653
30500 -- [-1223.064] (-1223.285) (-1230.999) (-1222.194) * (-1224.381) [-1221.448] (-1234.297) (-1230.888) -- 0:01:35
31000 -- (-1221.947) [-1221.078] (-1234.753) (-1221.428) * (-1222.735) (-1221.862) (-1235.819) [-1230.234] -- 0:01:33
31500 -- (-1222.923) [-1222.239] (-1235.214) (-1222.500) * (-1221.990) (-1222.776) (-1229.101) [-1229.377] -- 0:01:32
32000 -- (-1223.152) (-1224.416) [-1229.795] (-1223.758) * (-1221.872) (-1223.136) (-1233.633) [-1228.368] -- 0:01:30
32500 -- (-1222.160) (-1226.789) [-1229.571] (-1221.745) * (-1221.462) (-1227.114) (-1228.077) [-1231.040] -- 0:01:29
33000 -- [-1222.519] (-1224.670) (-1235.282) (-1224.303) * (-1223.853) (-1225.538) [-1228.323] (-1228.959) -- 0:01:27
33500 -- (-1222.097) (-1224.105) (-1236.054) [-1223.258] * (-1224.694) (-1222.454) (-1237.177) [-1228.496] -- 0:01:26
34000 -- (-1221.918) (-1224.997) [-1230.274] (-1221.206) * [-1221.370] (-1225.296) (-1228.681) (-1234.364) -- 0:01:25
34500 -- [-1221.752] (-1221.478) (-1235.232) (-1221.526) * [-1221.329] (-1226.237) (-1229.222) (-1236.075) -- 0:01:23
35000 -- [-1223.304] (-1229.918) (-1234.233) (-1221.579) * (-1221.192) (-1225.314) (-1233.579) [-1232.196] -- 0:01:22
Average standard deviation of split frequencies: 0.039907
35500 -- (-1221.743) (-1226.143) [-1227.437] (-1223.444) * (-1221.322) [-1221.188] (-1230.137) (-1230.754) -- 0:01:21
36000 -- (-1221.380) [-1222.141] (-1236.070) (-1224.718) * (-1222.024) (-1223.543) (-1235.104) [-1225.322] -- 0:01:20
36500 -- [-1221.006] (-1223.793) (-1230.652) (-1221.030) * (-1223.289) [-1221.983] (-1235.012) (-1231.362) -- 0:01:19
37000 -- (-1223.603) [-1221.382] (-1232.467) (-1225.222) * [-1221.808] (-1223.976) (-1235.886) (-1232.368) -- 0:01:18
37500 -- (-1222.771) (-1221.830) (-1232.687) [-1226.027] * (-1224.535) (-1224.118) [-1230.635] (-1232.680) -- 0:01:17
38000 -- [-1225.277] (-1222.337) (-1230.285) (-1225.060) * [-1223.275] (-1224.244) (-1228.543) (-1238.502) -- 0:01:15
38500 -- [-1222.241] (-1221.818) (-1232.237) (-1222.365) * (-1223.486) [-1222.232] (-1230.342) (-1232.224) -- 0:01:14
39000 -- (-1221.832) [-1221.092] (-1235.234) (-1221.276) * (-1226.053) (-1223.806) [-1234.440] (-1232.903) -- 0:01:13
39500 -- (-1226.198) (-1221.687) [-1228.256] (-1223.589) * (-1225.465) (-1225.100) [-1231.990] (-1231.039) -- 0:01:12
40000 -- (-1224.790) (-1221.790) [-1230.378] (-1221.054) * [-1222.860] (-1224.301) (-1236.359) (-1234.442) -- 0:01:12
Average standard deviation of split frequencies: 0.048198
40500 -- (-1221.722) [-1221.301] (-1238.408) (-1221.302) * (-1222.643) (-1230.180) [-1230.125] (-1230.218) -- 0:01:34
41000 -- (-1222.533) (-1222.100) [-1233.340] (-1220.801) * (-1222.430) [-1223.548] (-1237.051) (-1229.950) -- 0:01:33
41500 -- [-1222.303] (-1225.499) (-1232.815) (-1225.974) * [-1223.711] (-1222.278) (-1227.166) (-1230.186) -- 0:01:32
42000 -- (-1227.336) [-1223.738] (-1237.476) (-1226.241) * (-1224.321) [-1224.306] (-1239.578) (-1230.242) -- 0:01:31
42500 -- (-1226.384) (-1223.417) [-1231.565] (-1221.906) * (-1224.806) [-1225.519] (-1225.684) (-1239.486) -- 0:01:30
43000 -- (-1222.001) (-1226.857) (-1231.920) [-1223.858] * (-1225.731) [-1222.458] (-1225.358) (-1238.503) -- 0:01:29
43500 -- (-1221.713) (-1227.765) [-1227.273] (-1226.000) * (-1222.513) [-1222.262] (-1226.313) (-1242.802) -- 0:01:27
44000 -- [-1225.777] (-1228.474) (-1232.601) (-1222.887) * (-1222.001) [-1227.727] (-1223.153) (-1234.303) -- 0:01:26
44500 -- (-1225.855) (-1223.540) [-1229.968] (-1224.819) * (-1222.903) (-1226.646) [-1223.797] (-1225.938) -- 0:01:25
45000 -- (-1227.184) [-1222.772] (-1235.190) (-1222.729) * [-1222.494] (-1221.619) (-1222.686) (-1228.246) -- 0:01:24
Average standard deviation of split frequencies: 0.043321
45500 -- [-1225.765] (-1222.316) (-1226.049) (-1223.490) * (-1224.693) (-1221.915) (-1221.104) [-1227.655] -- 0:01:23
46000 -- (-1221.808) [-1221.008] (-1235.139) (-1222.602) * (-1225.607) [-1221.977] (-1220.952) (-1234.444) -- 0:01:22
46500 -- (-1223.596) (-1223.248) (-1233.094) [-1223.367] * (-1224.379) (-1221.393) [-1222.647] (-1237.228) -- 0:01:22
47000 -- (-1226.539) (-1222.944) [-1230.867] (-1223.285) * (-1222.274) (-1221.403) [-1225.321] (-1230.686) -- 0:01:21
47500 -- (-1222.923) [-1222.698] (-1235.414) (-1224.444) * [-1225.137] (-1220.989) (-1221.529) (-1232.434) -- 0:01:20
48000 -- (-1227.728) (-1221.711) (-1231.014) [-1225.668] * (-1223.861) (-1221.179) (-1222.988) [-1230.484] -- 0:01:19
48500 -- (-1224.191) (-1222.014) [-1231.597] (-1224.846) * (-1227.362) (-1223.252) [-1223.325] (-1230.197) -- 0:01:18
49000 -- [-1223.243] (-1225.452) (-1233.938) (-1224.109) * (-1225.176) (-1224.221) (-1222.781) [-1239.732] -- 0:01:17
49500 -- (-1222.146) (-1226.122) (-1229.357) [-1223.240] * [-1223.595] (-1227.249) (-1222.844) (-1225.043) -- 0:01:16
50000 -- [-1222.895] (-1224.168) (-1231.680) (-1224.089) * (-1225.527) (-1222.424) [-1223.095] (-1237.427) -- 0:01:16
Average standard deviation of split frequencies: 0.036286
50500 -- (-1221.363) [-1225.285] (-1231.922) (-1224.663) * (-1225.912) (-1221.913) [-1224.746] (-1227.370) -- 0:01:15
51000 -- (-1223.103) (-1221.073) [-1234.143] (-1223.003) * (-1226.750) [-1223.982] (-1223.895) (-1241.298) -- 0:01:14
51500 -- (-1221.657) [-1223.175] (-1229.560) (-1224.929) * (-1224.537) (-1221.959) (-1223.228) [-1235.387] -- 0:01:13
52000 -- (-1224.168) [-1220.968] (-1238.956) (-1223.658) * (-1222.427) (-1222.383) [-1225.044] (-1232.797) -- 0:01:31
52500 -- (-1223.113) (-1225.255) [-1235.600] (-1222.036) * [-1222.547] (-1222.381) (-1223.951) (-1233.886) -- 0:01:30
53000 -- [-1223.986] (-1230.061) (-1228.194) (-1221.529) * (-1226.169) (-1226.979) (-1223.342) [-1231.928] -- 0:01:29
53500 -- (-1222.656) [-1225.495] (-1229.859) (-1223.871) * (-1224.094) [-1222.979] (-1226.038) (-1230.983) -- 0:01:28
54000 -- (-1224.066) [-1225.250] (-1229.766) (-1223.403) * [-1221.967] (-1223.132) (-1223.248) (-1231.017) -- 0:01:27
54500 -- (-1223.487) (-1222.677) [-1229.970] (-1222.347) * (-1222.041) (-1225.107) (-1223.249) [-1234.309] -- 0:01:26
55000 -- (-1222.985) [-1222.246] (-1233.579) (-1222.592) * (-1223.418) (-1224.372) [-1222.123] (-1240.108) -- 0:01:25
Average standard deviation of split frequencies: 0.027912
55500 -- (-1224.170) (-1222.923) [-1228.936] (-1222.765) * (-1221.003) (-1222.240) (-1221.609) [-1227.328] -- 0:01:25
56000 -- (-1222.481) (-1226.715) [-1232.591] (-1222.267) * (-1220.634) [-1222.117] (-1221.604) (-1230.643) -- 0:01:24
56500 -- (-1221.099) (-1224.639) (-1235.750) [-1222.798] * (-1222.196) (-1221.822) [-1222.811] (-1231.522) -- 0:01:23
57000 -- (-1222.946) (-1222.284) (-1229.924) [-1223.125] * (-1221.636) (-1221.584) (-1222.092) [-1231.265] -- 0:01:22
57500 -- (-1224.402) (-1224.117) (-1238.866) [-1222.452] * [-1221.623] (-1221.219) (-1222.092) (-1236.204) -- 0:01:21
58000 -- [-1226.514] (-1221.915) (-1233.519) (-1220.802) * (-1220.766) (-1220.961) (-1222.090) [-1236.288] -- 0:01:21
58500 -- (-1223.861) (-1222.824) [-1229.900] (-1223.848) * (-1225.748) [-1223.445] (-1223.668) (-1236.307) -- 0:01:20
59000 -- [-1222.903] (-1223.082) (-1235.438) (-1225.845) * [-1224.301] (-1223.607) (-1225.944) (-1232.018) -- 0:01:19
59500 -- (-1223.970) (-1221.371) (-1231.024) [-1223.295] * [-1221.852] (-1221.011) (-1222.671) (-1235.529) -- 0:01:19
60000 -- (-1222.504) (-1224.345) [-1227.098] (-1222.149) * [-1221.510] (-1222.804) (-1222.441) (-1237.611) -- 0:01:18
Average standard deviation of split frequencies: 0.034967
60500 -- (-1222.453) (-1221.276) (-1237.826) [-1223.266] * [-1222.178] (-1225.090) (-1224.872) (-1234.730) -- 0:01:17
61000 -- [-1225.124] (-1221.187) (-1229.127) (-1224.986) * (-1221.208) (-1224.025) [-1222.292] (-1244.777) -- 0:01:16
61500 -- (-1225.825) (-1222.657) [-1226.248] (-1221.499) * (-1223.559) (-1227.515) (-1223.430) [-1241.234] -- 0:01:16
62000 -- (-1223.606) (-1222.303) [-1230.609] (-1222.402) * (-1226.199) (-1221.349) [-1222.986] (-1237.866) -- 0:01:15
62500 -- (-1222.547) [-1220.995] (-1234.017) (-1222.283) * (-1226.899) [-1223.525] (-1222.506) (-1229.721) -- 0:01:15
63000 -- (-1222.093) (-1223.414) (-1231.903) [-1221.777] * (-1223.666) [-1221.399] (-1222.098) (-1225.589) -- 0:01:14
63500 -- (-1221.999) (-1221.355) [-1226.656] (-1221.643) * [-1221.401] (-1221.486) (-1223.979) (-1223.508) -- 0:01:13
64000 -- [-1221.767] (-1222.621) (-1231.981) (-1222.838) * (-1224.086) (-1222.161) [-1222.700] (-1223.722) -- 0:01:27
64500 -- [-1221.755] (-1222.132) (-1230.568) (-1220.656) * [-1224.671] (-1221.238) (-1223.912) (-1223.504) -- 0:01:27
65000 -- [-1221.471] (-1225.382) (-1232.562) (-1225.093) * (-1222.514) (-1221.651) [-1223.606] (-1223.240) -- 0:01:26
Average standard deviation of split frequencies: 0.032705
65500 -- (-1220.809) (-1224.018) [-1237.365] (-1221.186) * (-1224.678) (-1221.653) (-1221.990) [-1224.980] -- 0:01:25
66000 -- (-1221.228) (-1225.338) [-1226.888] (-1221.570) * (-1225.755) [-1221.839] (-1222.330) (-1222.784) -- 0:01:24
66500 -- (-1222.814) (-1221.103) [-1227.514] (-1223.446) * (-1223.656) [-1221.151] (-1223.510) (-1223.016) -- 0:01:24
67000 -- [-1221.753] (-1221.395) (-1224.441) (-1222.440) * (-1222.972) (-1222.785) (-1223.356) [-1222.369] -- 0:01:23
67500 -- (-1222.503) [-1221.563] (-1234.456) (-1223.403) * [-1222.454] (-1221.828) (-1223.338) (-1222.147) -- 0:01:22
68000 -- (-1224.936) (-1221.500) [-1230.672] (-1230.485) * (-1224.839) (-1221.803) (-1223.209) [-1221.176] -- 0:01:22
68500 -- (-1221.969) (-1224.017) [-1230.787] (-1223.095) * [-1222.742] (-1223.859) (-1225.954) (-1222.090) -- 0:01:21
69000 -- [-1221.970] (-1222.666) (-1231.279) (-1225.501) * (-1221.053) [-1225.848] (-1223.574) (-1228.563) -- 0:01:20
69500 -- (-1221.824) (-1222.609) [-1232.744] (-1221.882) * (-1221.456) (-1223.178) (-1223.669) [-1225.146] -- 0:01:20
70000 -- (-1223.110) [-1221.697] (-1235.224) (-1222.020) * (-1221.453) (-1223.700) [-1224.378] (-1221.320) -- 0:01:19
Average standard deviation of split frequencies: 0.030194
70500 -- (-1222.730) [-1221.337] (-1226.524) (-1222.105) * [-1222.619] (-1221.734) (-1224.024) (-1222.588) -- 0:01:19
71000 -- (-1221.037) (-1221.157) [-1240.548] (-1222.743) * (-1221.811) (-1223.435) (-1225.306) [-1222.210] -- 0:01:18
71500 -- (-1222.822) [-1223.313] (-1239.799) (-1227.046) * (-1222.294) (-1223.597) (-1230.077) [-1221.200] -- 0:01:17
72000 -- [-1221.479] (-1223.704) (-1241.733) (-1222.980) * (-1222.280) (-1225.825) (-1230.974) [-1221.200] -- 0:01:17
72500 -- [-1222.386] (-1226.640) (-1230.219) (-1222.766) * (-1222.733) [-1224.088] (-1223.545) (-1222.454) -- 0:01:16
73000 -- (-1222.379) (-1224.283) (-1227.010) [-1223.573] * [-1222.728] (-1223.235) (-1223.586) (-1220.603) -- 0:01:16
73500 -- (-1221.532) (-1223.397) [-1225.831] (-1225.280) * [-1224.990] (-1221.774) (-1224.978) (-1224.041) -- 0:01:15
74000 -- [-1224.474] (-1222.581) (-1224.509) (-1222.930) * (-1226.782) (-1222.783) (-1223.451) [-1222.365] -- 0:01:15
74500 -- [-1222.608] (-1225.095) (-1224.649) (-1225.297) * (-1226.299) (-1222.189) (-1227.125) [-1222.416] -- 0:01:14
75000 -- (-1223.102) (-1225.797) (-1224.458) [-1224.675] * [-1222.197] (-1221.113) (-1224.274) (-1225.107) -- 0:01:14
Average standard deviation of split frequencies: 0.028222
75500 -- (-1223.064) (-1223.106) [-1221.581] (-1222.976) * (-1221.320) (-1223.753) [-1227.385] (-1224.010) -- 0:01:25
76000 -- (-1223.056) (-1223.417) [-1221.879] (-1223.982) * (-1223.192) [-1221.909] (-1224.497) (-1222.822) -- 0:01:25
76500 -- (-1221.395) (-1223.106) [-1225.429] (-1227.113) * (-1222.072) [-1227.993] (-1225.307) (-1222.702) -- 0:01:24
77000 -- (-1221.271) [-1221.942] (-1228.398) (-1229.158) * [-1222.325] (-1220.783) (-1224.274) (-1223.285) -- 0:01:23
77500 -- (-1223.433) (-1223.474) (-1221.943) [-1221.933] * (-1228.453) (-1221.478) [-1225.731] (-1225.961) -- 0:01:23
78000 -- (-1221.727) (-1223.518) [-1222.690] (-1224.080) * [-1226.731] (-1222.763) (-1222.325) (-1229.291) -- 0:01:22
78500 -- (-1221.537) [-1223.503] (-1222.506) (-1224.131) * (-1226.669) (-1221.354) (-1221.463) [-1227.085] -- 0:01:22
79000 -- (-1221.426) (-1223.681) [-1223.373] (-1223.369) * [-1225.206] (-1222.600) (-1222.951) (-1221.074) -- 0:01:21
79500 -- [-1223.870] (-1225.454) (-1220.715) (-1224.520) * [-1223.557] (-1225.829) (-1221.679) (-1222.147) -- 0:01:21
80000 -- (-1222.403) [-1226.672] (-1222.330) (-1227.131) * (-1225.378) (-1223.814) [-1225.839] (-1222.324) -- 0:01:20
Average standard deviation of split frequencies: 0.026622
80500 -- [-1222.587] (-1222.374) (-1224.715) (-1223.495) * [-1222.290] (-1224.375) (-1224.990) (-1227.519) -- 0:01:19
81000 -- (-1220.947) [-1224.028] (-1223.594) (-1224.735) * [-1223.264] (-1224.642) (-1225.522) (-1226.226) -- 0:01:19
81500 -- (-1221.448) (-1226.534) [-1226.707] (-1224.128) * (-1223.763) (-1225.177) (-1227.619) [-1225.689] -- 0:01:18
82000 -- [-1221.111] (-1221.251) (-1224.406) (-1225.228) * (-1224.927) (-1224.042) [-1223.340] (-1222.960) -- 0:01:18
82500 -- (-1221.650) (-1221.441) (-1225.537) [-1221.160] * (-1223.549) (-1222.744) (-1226.310) [-1221.172] -- 0:01:17
83000 -- (-1221.680) (-1221.102) [-1226.411] (-1221.039) * (-1229.140) (-1222.382) [-1221.266] (-1222.327) -- 0:01:17
83500 -- (-1227.345) (-1221.240) (-1232.512) [-1222.206] * (-1224.746) [-1222.315] (-1222.855) (-1225.323) -- 0:01:16
84000 -- (-1227.892) (-1222.703) [-1224.529] (-1222.451) * (-1221.440) [-1224.639] (-1222.764) (-1224.945) -- 0:01:16
84500 -- (-1230.598) (-1224.002) [-1224.219] (-1223.349) * (-1224.544) [-1222.887] (-1222.200) (-1226.309) -- 0:01:15
85000 -- (-1227.997) [-1221.920] (-1222.470) (-1223.821) * (-1223.642) (-1221.719) [-1221.102] (-1224.331) -- 0:01:15
Average standard deviation of split frequencies: 0.028504
85500 -- (-1225.055) [-1222.900] (-1221.445) (-1222.954) * [-1224.270] (-1223.396) (-1224.951) (-1223.081) -- 0:01:14
86000 -- (-1222.978) [-1222.034] (-1221.711) (-1223.045) * (-1222.512) [-1223.291] (-1221.658) (-1224.416) -- 0:01:14
86500 -- (-1222.260) [-1221.918] (-1221.764) (-1223.985) * [-1222.192] (-1223.276) (-1224.831) (-1222.607) -- 0:01:13
87000 -- (-1222.438) (-1223.498) [-1221.507] (-1222.986) * (-1224.626) (-1221.404) (-1222.860) [-1221.145] -- 0:01:13
87500 -- [-1221.698] (-1225.346) (-1226.601) (-1221.705) * (-1222.470) (-1221.773) [-1221.242] (-1226.751) -- 0:01:23
88000 -- (-1224.782) (-1222.613) (-1222.286) [-1222.217] * [-1223.018] (-1225.675) (-1223.339) (-1231.183) -- 0:01:22
88500 -- (-1224.850) (-1222.186) (-1222.656) [-1224.590] * [-1223.915] (-1227.297) (-1222.076) (-1227.002) -- 0:01:22
89000 -- (-1226.123) [-1221.383] (-1225.645) (-1221.360) * (-1226.670) (-1227.324) [-1222.688] (-1221.014) -- 0:01:21
89500 -- (-1225.917) (-1221.682) (-1223.634) [-1221.638] * (-1223.699) [-1224.325] (-1222.631) (-1222.762) -- 0:01:21
90000 -- [-1224.100] (-1222.595) (-1221.386) (-1225.860) * (-1222.597) [-1222.896] (-1222.423) (-1225.992) -- 0:01:20
Average standard deviation of split frequencies: 0.024437
90500 -- [-1225.069] (-1222.251) (-1221.339) (-1223.797) * (-1221.353) [-1224.011] (-1223.056) (-1231.994) -- 0:01:20
91000 -- [-1221.730] (-1224.513) (-1224.053) (-1224.876) * (-1221.786) [-1223.476] (-1225.251) (-1222.080) -- 0:01:19
91500 -- (-1223.037) (-1225.819) [-1223.160] (-1221.950) * (-1221.385) (-1227.251) (-1225.409) [-1223.214] -- 0:01:19
92000 -- (-1222.748) (-1223.716) [-1222.035] (-1221.366) * (-1221.074) (-1224.613) [-1224.420] (-1223.846) -- 0:01:18
92500 -- [-1223.380] (-1223.716) (-1224.191) (-1222.105) * [-1221.425] (-1223.365) (-1222.299) (-1222.079) -- 0:01:18
93000 -- [-1222.262] (-1227.375) (-1221.955) (-1224.639) * [-1223.220] (-1227.183) (-1221.746) (-1222.292) -- 0:01:18
93500 -- [-1223.137] (-1225.644) (-1221.517) (-1225.639) * (-1223.395) [-1222.035] (-1222.194) (-1224.884) -- 0:01:17
94000 -- (-1225.990) (-1224.017) [-1220.929] (-1223.568) * (-1221.949) (-1221.851) [-1223.034] (-1223.836) -- 0:01:17
94500 -- (-1220.994) (-1226.993) [-1223.418] (-1222.731) * (-1222.268) [-1220.911] (-1222.845) (-1222.743) -- 0:01:16
95000 -- (-1221.901) (-1223.295) (-1222.829) [-1221.267] * (-1222.687) (-1221.540) (-1225.338) [-1224.630] -- 0:01:16
Average standard deviation of split frequencies: 0.023570
95500 -- [-1223.965] (-1224.346) (-1224.589) (-1221.723) * [-1223.909] (-1224.119) (-1226.069) (-1226.097) -- 0:01:15
96000 -- (-1221.933) (-1224.101) [-1224.462] (-1222.520) * [-1222.225] (-1224.846) (-1221.857) (-1226.343) -- 0:01:15
96500 -- (-1223.660) [-1223.651] (-1224.455) (-1223.663) * (-1221.978) (-1225.395) [-1221.617] (-1224.753) -- 0:01:14
97000 -- (-1222.701) [-1222.670] (-1223.050) (-1224.149) * [-1221.503] (-1230.633) (-1224.752) (-1222.900) -- 0:01:14
97500 -- (-1221.538) [-1222.026] (-1223.817) (-1224.011) * (-1221.892) (-1230.111) [-1221.585] (-1222.653) -- 0:01:14
98000 -- (-1223.063) (-1221.053) (-1230.833) [-1224.399] * (-1221.730) [-1223.236] (-1221.789) (-1224.031) -- 0:01:13
98500 -- (-1223.823) [-1222.081] (-1223.801) (-1223.490) * (-1226.395) [-1221.392] (-1222.668) (-1222.349) -- 0:01:13
99000 -- [-1224.950] (-1221.153) (-1226.113) (-1223.697) * (-1227.106) (-1222.303) [-1221.927] (-1223.913) -- 0:01:21
99500 -- [-1224.523] (-1220.614) (-1224.026) (-1223.286) * [-1223.832] (-1221.167) (-1224.707) (-1224.845) -- 0:01:21
100000 -- (-1224.003) (-1221.174) (-1223.500) [-1222.078] * (-1226.584) (-1222.519) [-1223.510] (-1223.187) -- 0:01:21
Average standard deviation of split frequencies: 0.021935
100500 -- (-1224.810) (-1220.855) (-1224.204) [-1222.656] * (-1230.616) (-1222.091) (-1231.734) [-1224.626] -- 0:01:20
101000 -- (-1223.187) (-1221.906) (-1225.315) [-1221.921] * (-1225.699) [-1221.590] (-1227.747) (-1225.210) -- 0:01:20
101500 -- (-1222.616) [-1221.077] (-1222.529) (-1222.740) * (-1227.287) [-1220.861] (-1221.278) (-1227.017) -- 0:01:19
102000 -- (-1224.687) [-1221.075] (-1222.318) (-1222.598) * (-1221.248) (-1223.764) [-1222.833] (-1222.403) -- 0:01:19
102500 -- (-1226.188) [-1221.467] (-1222.318) (-1222.511) * (-1230.534) (-1227.729) [-1221.248] (-1222.318) -- 0:01:18
103000 -- [-1225.670] (-1222.247) (-1221.663) (-1221.595) * [-1226.355] (-1231.024) (-1221.083) (-1227.897) -- 0:01:18
103500 -- [-1226.779] (-1226.354) (-1222.951) (-1222.593) * (-1221.560) (-1226.145) [-1222.259] (-1225.095) -- 0:01:17
104000 -- (-1226.860) (-1221.487) [-1221.813] (-1225.091) * (-1220.841) (-1224.595) (-1222.014) [-1225.393] -- 0:01:17
104500 -- (-1228.413) [-1221.962] (-1222.724) (-1226.981) * (-1220.964) (-1224.101) [-1222.775] (-1221.294) -- 0:01:17
105000 -- [-1222.634] (-1221.629) (-1222.725) (-1222.306) * [-1221.444] (-1225.806) (-1223.202) (-1222.383) -- 0:01:16
Average standard deviation of split frequencies: 0.020457
105500 -- [-1224.866] (-1221.440) (-1225.146) (-1221.754) * (-1222.504) (-1224.233) [-1222.577] (-1226.863) -- 0:01:16
106000 -- (-1222.977) [-1221.612] (-1224.852) (-1223.982) * (-1222.265) (-1222.816) (-1225.779) [-1223.349] -- 0:01:15
106500 -- [-1224.280] (-1220.641) (-1224.017) (-1223.952) * (-1223.470) (-1222.192) (-1226.845) [-1222.573] -- 0:01:15
107000 -- (-1223.500) (-1220.652) (-1223.703) [-1224.034] * [-1222.832] (-1220.910) (-1225.927) (-1222.634) -- 0:01:15
107500 -- (-1223.201) (-1223.203) [-1221.885] (-1223.452) * (-1222.114) (-1223.756) [-1223.491] (-1223.073) -- 0:01:14
108000 -- [-1224.402] (-1222.058) (-1221.606) (-1223.932) * (-1224.441) (-1224.177) [-1223.453] (-1223.000) -- 0:01:14
108500 -- (-1224.112) [-1221.341] (-1222.796) (-1223.714) * [-1224.122] (-1224.386) (-1223.707) (-1223.103) -- 0:01:13
109000 -- (-1221.186) (-1225.705) [-1220.614] (-1224.926) * [-1221.199] (-1222.701) (-1221.791) (-1224.197) -- 0:01:13
109500 -- (-1223.161) (-1221.901) (-1221.078) [-1224.653] * (-1224.189) [-1222.417] (-1222.193) (-1221.855) -- 0:01:13
110000 -- [-1221.255] (-1222.812) (-1221.881) (-1224.671) * (-1222.744) [-1223.905] (-1222.802) (-1222.013) -- 0:01:12
Average standard deviation of split frequencies: 0.021724
110500 -- (-1222.296) [-1223.312] (-1221.834) (-1222.396) * [-1223.145] (-1222.043) (-1222.114) (-1222.755) -- 0:01:12
111000 -- (-1221.238) (-1223.004) [-1222.637] (-1222.037) * (-1225.212) (-1222.381) (-1221.111) [-1223.794] -- 0:01:20
111500 -- (-1223.112) [-1221.939] (-1221.991) (-1222.996) * (-1223.184) (-1223.594) (-1225.740) [-1223.571] -- 0:01:19
112000 -- [-1223.983] (-1223.706) (-1221.713) (-1221.848) * (-1225.262) [-1224.126] (-1223.784) (-1223.586) -- 0:01:19
112500 -- (-1221.389) (-1224.174) [-1224.572] (-1222.414) * (-1222.136) (-1225.112) (-1227.939) [-1222.264] -- 0:01:18
113000 -- (-1221.089) (-1221.731) (-1223.749) [-1222.134] * [-1221.914] (-1222.197) (-1227.312) (-1222.880) -- 0:01:18
113500 -- (-1222.637) [-1223.955] (-1223.394) (-1223.260) * (-1222.848) [-1223.329] (-1228.678) (-1222.098) -- 0:01:18
114000 -- (-1222.497) (-1222.642) [-1223.531] (-1222.161) * (-1225.211) (-1224.698) (-1225.167) [-1220.680] -- 0:01:17
114500 -- (-1222.175) [-1224.589] (-1222.018) (-1224.594) * (-1223.172) (-1222.317) [-1225.982] (-1220.608) -- 0:01:17
115000 -- [-1220.635] (-1223.040) (-1221.123) (-1225.754) * (-1221.781) [-1222.340] (-1222.135) (-1220.608) -- 0:01:16
Average standard deviation of split frequencies: 0.019100
115500 -- (-1220.573) (-1223.409) (-1222.759) [-1222.058] * (-1221.545) [-1223.579] (-1224.443) (-1223.229) -- 0:01:16
116000 -- (-1224.599) (-1221.717) [-1222.738] (-1222.140) * [-1223.603] (-1222.406) (-1225.273) (-1222.754) -- 0:01:16
116500 -- (-1225.876) (-1221.476) (-1224.061) [-1222.507] * (-1221.650) [-1223.671] (-1222.695) (-1222.306) -- 0:01:15
117000 -- (-1222.538) (-1221.927) [-1223.242] (-1222.687) * (-1223.407) (-1221.927) (-1226.344) [-1224.732] -- 0:01:15
117500 -- (-1223.020) [-1221.687] (-1223.658) (-1221.910) * (-1221.636) [-1221.927] (-1226.853) (-1225.072) -- 0:01:15
118000 -- (-1221.755) (-1226.042) [-1221.603] (-1222.199) * (-1223.525) [-1221.609] (-1222.607) (-1223.549) -- 0:01:14
118500 -- [-1221.344] (-1225.590) (-1222.999) (-1222.293) * (-1224.281) (-1223.912) [-1222.640] (-1221.540) -- 0:01:14
119000 -- (-1223.200) (-1228.202) [-1222.060] (-1223.038) * (-1222.158) (-1222.859) (-1221.572) [-1221.447] -- 0:01:14
119500 -- (-1222.306) (-1224.182) (-1223.140) [-1222.216] * (-1221.557) (-1222.924) (-1223.718) [-1221.436] -- 0:01:13
120000 -- [-1223.846] (-1222.323) (-1222.836) (-1222.554) * (-1220.853) (-1224.217) (-1221.569) [-1221.834] -- 0:01:13
Average standard deviation of split frequencies: 0.020901
120500 -- (-1222.963) (-1227.856) [-1222.036] (-1222.180) * (-1221.500) [-1221.731] (-1222.651) (-1221.630) -- 0:01:12
121000 -- (-1222.587) (-1226.076) [-1222.109] (-1223.149) * [-1223.468] (-1223.957) (-1223.111) (-1223.227) -- 0:01:12
121500 -- (-1224.088) [-1224.727] (-1222.496) (-1221.647) * (-1222.836) (-1223.188) [-1222.710] (-1223.501) -- 0:01:12
122000 -- (-1223.582) (-1227.980) [-1221.468] (-1222.283) * (-1223.294) (-1226.780) (-1226.503) [-1223.979] -- 0:01:11
122500 -- [-1221.618] (-1223.371) (-1222.100) (-1225.762) * (-1224.714) (-1224.541) [-1221.639] (-1223.153) -- 0:01:18
123000 -- [-1221.022] (-1227.197) (-1223.625) (-1223.139) * (-1222.720) [-1225.415] (-1221.350) (-1221.872) -- 0:01:18
123500 -- [-1221.713] (-1225.698) (-1223.879) (-1222.287) * (-1222.763) (-1224.355) (-1222.573) [-1222.417] -- 0:01:18
124000 -- [-1220.888] (-1225.140) (-1221.077) (-1225.049) * (-1224.064) (-1225.465) (-1223.165) [-1222.434] -- 0:01:17
124500 -- (-1223.273) (-1224.548) (-1221.971) [-1223.360] * (-1221.988) [-1222.829] (-1224.605) (-1224.167) -- 0:01:17
125000 -- (-1222.182) (-1225.020) [-1221.728] (-1224.185) * (-1221.342) [-1222.645] (-1222.661) (-1221.756) -- 0:01:17
Average standard deviation of split frequencies: 0.018885
125500 -- (-1221.395) (-1221.232) [-1220.743] (-1229.961) * (-1221.369) (-1224.346) [-1223.501] (-1222.434) -- 0:01:16
126000 -- (-1223.980) [-1223.519] (-1221.870) (-1221.818) * (-1221.383) (-1224.278) [-1222.536] (-1223.954) -- 0:01:16
126500 -- (-1225.372) (-1224.324) [-1222.600] (-1222.924) * (-1221.747) [-1223.057] (-1222.305) (-1223.707) -- 0:01:15
127000 -- (-1222.696) [-1228.729] (-1226.013) (-1222.247) * [-1224.712] (-1223.523) (-1222.743) (-1222.207) -- 0:01:15
127500 -- (-1225.823) (-1222.305) (-1224.709) [-1221.465] * (-1221.540) (-1221.816) (-1221.074) [-1222.309] -- 0:01:15
128000 -- [-1223.956] (-1224.420) (-1227.781) (-1221.490) * (-1221.961) (-1221.264) [-1220.390] (-1225.564) -- 0:01:14
128500 -- (-1221.958) (-1223.687) [-1222.574] (-1222.362) * (-1223.770) (-1221.616) (-1221.279) [-1222.586] -- 0:01:14
129000 -- [-1222.630] (-1222.415) (-1222.434) (-1222.923) * [-1223.941] (-1224.248) (-1221.392) (-1225.309) -- 0:01:14
129500 -- (-1226.784) [-1223.311] (-1221.342) (-1222.629) * (-1222.326) (-1226.984) [-1220.975] (-1222.730) -- 0:01:13
130000 -- (-1222.897) [-1220.457] (-1220.991) (-1223.222) * (-1222.581) (-1225.457) (-1220.982) [-1223.612] -- 0:01:13
Average standard deviation of split frequencies: 0.019842
130500 -- (-1222.312) (-1222.531) (-1221.001) [-1220.974] * (-1224.729) (-1222.008) [-1224.032] (-1224.617) -- 0:01:13
131000 -- (-1221.122) (-1221.786) (-1222.245) [-1221.016] * (-1222.113) (-1225.570) [-1225.274] (-1222.187) -- 0:01:12
131500 -- (-1222.775) (-1223.534) [-1220.764] (-1222.330) * [-1222.562] (-1224.174) (-1223.703) (-1222.487) -- 0:01:12
132000 -- (-1221.628) [-1222.442] (-1221.216) (-1223.518) * (-1223.382) [-1221.503] (-1222.063) (-1224.248) -- 0:01:12
132500 -- [-1221.289] (-1225.465) (-1222.012) (-1221.112) * (-1224.285) [-1221.840] (-1221.102) (-1221.999) -- 0:01:12
133000 -- (-1222.308) (-1220.829) (-1221.492) [-1221.059] * (-1221.456) (-1221.224) (-1222.321) [-1222.148] -- 0:01:11
133500 -- (-1221.339) (-1223.074) (-1222.517) [-1223.307] * (-1226.374) (-1224.079) (-1221.472) [-1222.067] -- 0:01:11
134000 -- (-1221.248) (-1222.900) [-1222.072] (-1221.203) * (-1224.406) [-1223.929] (-1223.066) (-1221.256) -- 0:01:11
134500 -- (-1221.183) (-1224.444) [-1221.287] (-1221.273) * [-1225.132] (-1225.392) (-1225.314) (-1223.015) -- 0:01:17
135000 -- (-1225.535) (-1223.701) (-1224.240) [-1221.563] * [-1225.706] (-1225.481) (-1222.916) (-1223.427) -- 0:01:16
Average standard deviation of split frequencies: 0.018608
135500 -- (-1221.658) [-1223.636] (-1225.393) (-1223.118) * (-1223.753) (-1225.008) (-1222.282) [-1222.762] -- 0:01:16
136000 -- (-1225.550) (-1223.028) (-1224.235) [-1221.568] * (-1223.919) (-1225.693) [-1223.286] (-1221.657) -- 0:01:16
136500 -- (-1223.686) [-1221.922] (-1221.680) (-1221.663) * [-1221.283] (-1223.578) (-1221.561) (-1222.772) -- 0:01:15
137000 -- (-1224.344) [-1222.068] (-1222.964) (-1220.846) * (-1222.256) (-1227.228) [-1221.068] (-1224.175) -- 0:01:15
137500 -- [-1222.968] (-1224.339) (-1222.052) (-1220.905) * (-1221.656) [-1224.989] (-1223.991) (-1224.798) -- 0:01:15
138000 -- (-1226.718) (-1221.919) (-1222.905) [-1222.179] * (-1222.695) [-1221.040] (-1227.884) (-1225.433) -- 0:01:14
138500 -- (-1223.873) (-1222.022) [-1222.552] (-1221.849) * (-1223.389) [-1221.745] (-1223.960) (-1224.291) -- 0:01:14
139000 -- (-1226.588) (-1226.571) (-1222.625) [-1221.079] * (-1222.250) [-1221.537] (-1221.089) (-1226.253) -- 0:01:14
139500 -- (-1229.549) (-1225.407) (-1221.735) [-1220.965] * (-1222.699) (-1225.569) (-1221.525) [-1222.260] -- 0:01:14
140000 -- (-1222.760) (-1222.227) (-1226.841) [-1221.525] * [-1224.237] (-1225.103) (-1226.270) (-1223.016) -- 0:01:13
Average standard deviation of split frequencies: 0.019578
140500 -- [-1223.790] (-1224.856) (-1221.679) (-1222.942) * (-1224.300) [-1224.127] (-1226.497) (-1222.129) -- 0:01:13
141000 -- (-1227.994) (-1226.046) (-1222.023) [-1222.941] * (-1222.112) (-1222.473) (-1223.541) [-1222.826] -- 0:01:13
141500 -- (-1222.695) [-1224.156] (-1222.414) (-1223.560) * [-1225.052] (-1223.411) (-1224.049) (-1221.839) -- 0:01:12
142000 -- (-1222.503) (-1227.708) (-1223.125) [-1220.940] * (-1221.746) [-1222.492] (-1221.476) (-1224.167) -- 0:01:12
142500 -- (-1222.488) [-1226.367] (-1225.477) (-1221.348) * (-1226.633) (-1222.312) [-1223.001] (-1222.893) -- 0:01:12
143000 -- (-1223.877) (-1225.415) (-1221.273) [-1222.437] * (-1228.289) [-1221.764] (-1221.887) (-1221.210) -- 0:01:11
143500 -- (-1222.727) (-1224.169) [-1222.258] (-1221.948) * [-1226.738] (-1221.167) (-1222.088) (-1220.917) -- 0:01:11
144000 -- (-1226.689) (-1222.916) (-1223.236) [-1223.362] * (-1224.517) (-1221.681) (-1224.519) [-1220.709] -- 0:01:11
144500 -- (-1227.638) (-1226.029) (-1223.703) [-1221.254] * (-1223.516) (-1221.373) (-1225.563) [-1224.942] -- 0:01:11
145000 -- (-1225.075) (-1232.009) (-1225.578) [-1221.604] * (-1227.207) (-1221.720) [-1227.501] (-1224.164) -- 0:01:10
Average standard deviation of split frequencies: 0.018727
145500 -- (-1223.688) [-1222.838] (-1226.888) (-1221.604) * (-1225.139) (-1221.351) (-1223.122) [-1222.281] -- 0:01:10
146000 -- (-1221.296) (-1222.654) [-1222.051] (-1222.451) * (-1226.563) (-1221.422) (-1222.177) [-1221.759] -- 0:01:16
146500 -- [-1227.779] (-1223.529) (-1222.020) (-1222.652) * (-1226.122) [-1222.090] (-1221.944) (-1221.365) -- 0:01:15
147000 -- (-1225.001) (-1222.665) (-1224.484) [-1222.799] * (-1225.764) (-1220.972) (-1221.657) [-1221.365] -- 0:01:15
147500 -- [-1221.792] (-1221.909) (-1223.779) (-1222.212) * [-1221.939] (-1222.007) (-1223.937) (-1221.708) -- 0:01:15
148000 -- (-1221.317) (-1221.407) [-1224.127] (-1223.372) * [-1221.013] (-1224.266) (-1223.504) (-1222.440) -- 0:01:14
148500 -- [-1221.281] (-1222.739) (-1222.378) (-1222.931) * (-1222.269) [-1222.620] (-1221.009) (-1221.918) -- 0:01:14
149000 -- [-1222.127] (-1224.294) (-1221.724) (-1223.608) * (-1222.303) [-1222.431] (-1228.116) (-1221.700) -- 0:01:14
149500 -- (-1224.555) (-1221.388) [-1222.523] (-1227.540) * (-1222.566) [-1223.503] (-1222.125) (-1221.147) -- 0:01:13
150000 -- (-1226.045) (-1224.205) [-1221.814] (-1223.572) * [-1221.575] (-1224.245) (-1222.626) (-1222.501) -- 0:01:13
Average standard deviation of split frequencies: 0.015644
150500 -- (-1223.599) [-1229.464] (-1223.456) (-1223.241) * (-1222.241) [-1221.566] (-1224.331) (-1222.795) -- 0:01:13
151000 -- (-1222.346) (-1222.969) (-1222.102) [-1222.029] * [-1223.701] (-1223.287) (-1224.899) (-1222.955) -- 0:01:13
151500 -- (-1225.857) (-1223.123) (-1221.618) [-1221.324] * (-1223.427) [-1223.327] (-1222.006) (-1223.425) -- 0:01:12
152000 -- (-1221.583) (-1223.514) (-1223.386) [-1224.391] * (-1222.159) [-1222.415] (-1224.620) (-1222.991) -- 0:01:12
152500 -- (-1223.168) (-1223.020) [-1222.022] (-1222.384) * [-1221.754] (-1222.631) (-1228.978) (-1222.146) -- 0:01:12
153000 -- (-1224.984) (-1222.630) [-1223.219] (-1222.005) * (-1223.562) [-1224.783] (-1233.712) (-1224.899) -- 0:01:11
153500 -- (-1221.481) (-1222.379) (-1221.298) [-1223.010] * (-1225.784) (-1225.851) [-1220.975] (-1221.938) -- 0:01:11
154000 -- (-1222.402) [-1222.194] (-1222.204) (-1223.749) * (-1221.720) [-1221.101] (-1220.769) (-1221.099) -- 0:01:11
154500 -- (-1224.096) (-1223.466) (-1221.353) [-1222.985] * (-1222.519) [-1221.462] (-1222.377) (-1221.439) -- 0:01:11
155000 -- [-1224.518] (-1222.054) (-1222.522) (-1223.571) * [-1221.583] (-1225.891) (-1222.024) (-1220.839) -- 0:01:10
Average standard deviation of split frequencies: 0.016700
155500 -- [-1225.139] (-1224.562) (-1222.073) (-1224.736) * [-1222.286] (-1226.015) (-1221.189) (-1220.867) -- 0:01:10
156000 -- (-1222.597) [-1222.399] (-1223.259) (-1225.255) * (-1222.984) (-1224.131) (-1224.569) [-1221.554] -- 0:01:10
156500 -- (-1222.842) [-1222.004] (-1222.557) (-1226.172) * (-1222.720) (-1227.928) [-1225.631] (-1220.815) -- 0:01:10
157000 -- (-1221.850) [-1221.601] (-1220.758) (-1222.435) * (-1223.381) [-1222.932] (-1223.797) (-1222.623) -- 0:01:09
157500 -- (-1221.229) (-1222.168) (-1223.473) [-1222.405] * (-1224.783) (-1227.296) (-1226.701) [-1221.847] -- 0:01:14
158000 -- (-1224.745) (-1222.782) (-1220.752) [-1222.044] * (-1221.495) (-1223.370) [-1221.880] (-1221.596) -- 0:01:14
158500 -- (-1224.097) (-1224.253) [-1221.515] (-1222.192) * (-1220.821) [-1225.603] (-1226.591) (-1221.736) -- 0:01:14
159000 -- (-1222.272) (-1224.948) [-1221.289] (-1222.045) * (-1220.967) [-1225.900] (-1224.535) (-1222.295) -- 0:01:14
159500 -- (-1222.103) (-1222.292) [-1224.410] (-1223.741) * (-1224.232) [-1222.342] (-1223.228) (-1221.274) -- 0:01:13
160000 -- (-1221.296) [-1222.716] (-1221.965) (-1224.313) * (-1222.991) (-1220.629) (-1222.775) [-1224.954] -- 0:01:13
Average standard deviation of split frequencies: 0.017295
160500 -- [-1221.662] (-1224.998) (-1222.282) (-1223.480) * [-1222.332] (-1222.341) (-1223.404) (-1222.791) -- 0:01:13
161000 -- (-1221.238) (-1227.860) [-1222.718] (-1226.277) * (-1223.253) (-1221.409) [-1223.724] (-1222.347) -- 0:01:12
161500 -- (-1221.412) (-1221.881) [-1221.947] (-1220.870) * (-1224.628) (-1224.665) (-1226.077) [-1223.118] -- 0:01:12
162000 -- (-1223.938) (-1222.041) (-1221.631) [-1222.661] * (-1221.715) [-1222.831] (-1222.349) (-1222.350) -- 0:01:12
162500 -- (-1225.134) [-1221.467] (-1220.984) (-1228.265) * (-1221.581) (-1222.637) [-1221.273] (-1225.947) -- 0:01:12
163000 -- [-1222.578] (-1221.851) (-1220.944) (-1222.969) * (-1221.600) [-1222.394] (-1222.262) (-1228.891) -- 0:01:11
163500 -- [-1222.278] (-1220.836) (-1222.424) (-1222.348) * (-1222.443) (-1221.885) [-1221.605] (-1221.670) -- 0:01:11
164000 -- (-1222.255) (-1223.574) [-1221.411] (-1226.460) * (-1228.409) [-1223.969] (-1221.527) (-1225.860) -- 0:01:11
164500 -- (-1225.757) (-1222.445) (-1222.640) [-1223.546] * (-1223.449) (-1226.493) (-1226.792) [-1222.489] -- 0:01:11
165000 -- (-1223.736) (-1223.301) (-1221.810) [-1223.903] * (-1224.272) (-1222.789) [-1222.443] (-1222.471) -- 0:01:10
Average standard deviation of split frequencies: 0.018234
165500 -- (-1226.044) [-1222.743] (-1221.130) (-1224.111) * (-1226.036) [-1223.097] (-1223.103) (-1222.598) -- 0:01:10
166000 -- (-1222.991) (-1222.043) (-1221.771) [-1226.444] * (-1225.718) (-1226.155) [-1223.175] (-1226.946) -- 0:01:10
166500 -- (-1222.465) (-1222.379) (-1222.764) [-1224.990] * [-1225.679] (-1221.633) (-1221.481) (-1222.054) -- 0:01:10
167000 -- (-1228.433) [-1224.345] (-1224.031) (-1224.781) * (-1224.364) (-1222.384) [-1221.222] (-1226.322) -- 0:01:09
167500 -- (-1226.638) (-1222.225) (-1222.209) [-1226.272] * (-1222.923) (-1225.008) (-1222.980) [-1227.089] -- 0:01:09
168000 -- [-1229.008] (-1222.768) (-1221.021) (-1224.872) * (-1225.426) (-1225.989) [-1223.493] (-1226.720) -- 0:01:09
168500 -- [-1226.251] (-1224.259) (-1224.351) (-1220.759) * (-1224.007) (-1223.849) (-1223.712) [-1228.005] -- 0:01:09
169000 -- [-1223.491] (-1223.865) (-1221.393) (-1221.830) * (-1221.640) (-1222.846) [-1223.232] (-1223.323) -- 0:01:08
169500 -- (-1222.820) (-1221.980) (-1221.970) [-1220.864] * (-1221.921) (-1222.754) [-1223.206] (-1226.527) -- 0:01:13
170000 -- (-1221.485) (-1220.908) (-1221.970) [-1221.157] * (-1221.244) [-1222.983] (-1221.653) (-1220.909) -- 0:01:13
Average standard deviation of split frequencies: 0.019480
170500 -- (-1222.707) (-1220.908) (-1222.413) [-1222.197] * [-1222.199] (-1224.600) (-1221.649) (-1222.345) -- 0:01:12
171000 -- (-1228.924) (-1221.181) [-1221.710] (-1221.415) * (-1222.131) (-1225.023) (-1221.664) [-1221.444] -- 0:01:12
171500 -- [-1227.244] (-1222.552) (-1223.129) (-1221.422) * (-1221.460) (-1222.647) (-1226.082) [-1222.782] -- 0:01:12
172000 -- (-1221.106) (-1223.556) (-1223.802) [-1221.445] * [-1224.345] (-1226.263) (-1227.393) (-1224.912) -- 0:01:12
172500 -- (-1226.486) [-1223.958] (-1226.743) (-1220.727) * (-1225.997) (-1224.426) [-1222.912] (-1222.282) -- 0:01:11
173000 -- (-1224.480) (-1221.554) [-1223.078] (-1221.334) * (-1226.368) (-1224.890) (-1225.660) [-1223.792] -- 0:01:11
173500 -- (-1225.794) [-1222.386] (-1223.406) (-1224.506) * (-1223.594) (-1222.114) [-1224.036] (-1223.866) -- 0:01:11
174000 -- (-1223.075) [-1226.660] (-1223.329) (-1221.937) * (-1223.693) [-1225.600] (-1224.836) (-1223.445) -- 0:01:11
174500 -- (-1224.741) (-1223.450) (-1222.232) [-1221.796] * (-1224.784) [-1223.639] (-1225.249) (-1224.648) -- 0:01:10
175000 -- [-1222.661] (-1224.528) (-1221.046) (-1221.240) * (-1222.823) [-1222.684] (-1222.197) (-1225.055) -- 0:01:10
Average standard deviation of split frequencies: 0.018749
175500 -- (-1222.671) (-1224.343) [-1221.046] (-1221.348) * (-1222.557) (-1222.685) [-1221.988] (-1225.877) -- 0:01:10
176000 -- [-1224.326] (-1223.543) (-1223.022) (-1221.050) * (-1223.739) [-1222.601] (-1222.130) (-1225.323) -- 0:01:10
176500 -- [-1225.463] (-1227.000) (-1220.703) (-1221.924) * (-1223.502) (-1221.935) [-1223.067] (-1224.595) -- 0:01:09
177000 -- (-1224.712) [-1224.946] (-1223.188) (-1221.916) * (-1223.485) (-1225.363) [-1221.532] (-1223.688) -- 0:01:09
177500 -- [-1222.266] (-1222.460) (-1224.410) (-1222.389) * (-1225.465) [-1226.153] (-1221.077) (-1223.159) -- 0:01:09
178000 -- (-1221.781) (-1224.682) (-1221.953) [-1221.084] * [-1225.366] (-1222.723) (-1220.638) (-1222.280) -- 0:01:09
178500 -- [-1222.662] (-1222.651) (-1222.752) (-1221.033) * (-1225.865) (-1225.435) [-1222.728] (-1222.039) -- 0:01:09
179000 -- [-1223.149] (-1222.467) (-1222.128) (-1222.358) * [-1225.756] (-1224.023) (-1224.116) (-1222.037) -- 0:01:08
179500 -- (-1223.906) (-1222.517) (-1223.906) [-1226.109] * (-1223.681) (-1223.105) [-1224.430] (-1221.568) -- 0:01:08
180000 -- [-1225.089] (-1220.990) (-1221.650) (-1226.378) * (-1221.954) (-1221.432) [-1224.500] (-1221.266) -- 0:01:08
Average standard deviation of split frequencies: 0.017303
180500 -- (-1221.769) (-1222.027) [-1224.508] (-1226.616) * (-1224.870) (-1221.259) (-1222.467) [-1221.511] -- 0:01:08
181000 -- [-1221.151] (-1221.134) (-1226.099) (-1224.510) * [-1222.387] (-1220.686) (-1224.941) (-1222.450) -- 0:01:12
181500 -- (-1220.720) [-1221.030] (-1221.382) (-1220.796) * [-1220.616] (-1221.714) (-1223.124) (-1223.262) -- 0:01:12
182000 -- (-1220.901) (-1222.814) (-1222.695) [-1222.584] * (-1228.522) [-1221.076] (-1225.665) (-1222.403) -- 0:01:11
182500 -- (-1223.744) [-1221.493] (-1224.905) (-1222.507) * (-1221.721) [-1221.459] (-1226.688) (-1223.352) -- 0:01:11
183000 -- (-1222.133) [-1221.967] (-1222.488) (-1222.787) * (-1222.944) (-1224.625) (-1226.639) [-1222.871] -- 0:01:11
183500 -- [-1222.197] (-1222.056) (-1224.215) (-1222.369) * (-1222.822) [-1222.233] (-1223.506) (-1222.597) -- 0:01:11
184000 -- (-1226.054) (-1221.840) [-1222.463] (-1223.862) * (-1224.620) (-1221.994) [-1223.481] (-1223.398) -- 0:01:10
184500 -- (-1222.286) (-1223.432) [-1222.677] (-1223.133) * [-1222.009] (-1220.566) (-1222.458) (-1221.312) -- 0:01:10
185000 -- [-1221.905] (-1226.522) (-1224.020) (-1224.153) * (-1223.593) (-1221.890) (-1225.198) [-1222.214] -- 0:01:10
Average standard deviation of split frequencies: 0.016727
185500 -- (-1222.007) (-1224.377) (-1221.084) [-1221.102] * (-1223.821) [-1222.800] (-1234.305) (-1226.075) -- 0:01:10
186000 -- (-1223.273) (-1225.488) (-1223.326) [-1222.911] * [-1226.304] (-1221.180) (-1223.732) (-1222.104) -- 0:01:10
186500 -- (-1222.879) [-1222.228] (-1226.398) (-1222.403) * (-1231.696) (-1221.971) [-1221.595] (-1223.098) -- 0:01:09
187000 -- (-1222.984) (-1221.723) [-1221.069] (-1222.602) * (-1223.786) (-1223.959) (-1221.168) [-1222.528] -- 0:01:09
187500 -- (-1222.247) (-1222.153) [-1221.470] (-1223.407) * [-1223.503] (-1224.349) (-1221.597) (-1221.783) -- 0:01:09
188000 -- (-1222.828) (-1223.570) (-1220.978) [-1221.345] * [-1222.815] (-1225.419) (-1223.044) (-1221.245) -- 0:01:09
188500 -- [-1222.172] (-1223.566) (-1221.249) (-1222.352) * (-1222.687) (-1221.774) [-1222.350] (-1221.842) -- 0:01:08
189000 -- (-1222.136) [-1224.332] (-1221.656) (-1221.834) * (-1224.545) (-1221.329) (-1221.482) [-1221.320] -- 0:01:08
189500 -- [-1226.511] (-1224.521) (-1221.260) (-1223.384) * (-1222.923) (-1220.803) (-1221.688) [-1221.566] -- 0:01:08
190000 -- (-1222.110) (-1221.243) (-1220.846) [-1223.384] * (-1222.742) [-1222.063] (-1221.906) (-1222.203) -- 0:01:08
Average standard deviation of split frequencies: 0.015453
190500 -- (-1221.349) [-1220.981] (-1226.623) (-1225.346) * (-1221.337) [-1222.935] (-1222.515) (-1222.482) -- 0:01:07
191000 -- (-1223.053) [-1223.552] (-1222.238) (-1222.666) * (-1222.718) (-1222.876) [-1225.403] (-1223.131) -- 0:01:07
191500 -- (-1222.623) (-1222.714) (-1224.113) [-1223.866] * (-1223.153) [-1226.761] (-1224.060) (-1221.660) -- 0:01:07
192000 -- (-1223.391) (-1223.083) [-1224.539] (-1223.331) * [-1222.632] (-1223.943) (-1222.667) (-1225.510) -- 0:01:07
192500 -- (-1221.614) (-1223.009) (-1225.638) [-1221.726] * (-1225.503) (-1222.714) (-1221.853) [-1223.875] -- 0:01:11
193000 -- (-1221.640) (-1221.491) (-1226.113) [-1221.820] * (-1221.623) (-1223.229) [-1222.284] (-1226.815) -- 0:01:11
193500 -- (-1223.044) [-1220.753] (-1223.847) (-1223.309) * [-1224.212] (-1221.511) (-1223.160) (-1228.611) -- 0:01:10
194000 -- [-1221.585] (-1220.766) (-1223.269) (-1221.443) * [-1223.820] (-1221.671) (-1222.653) (-1222.794) -- 0:01:10
194500 -- (-1224.479) (-1223.576) [-1221.391] (-1220.991) * (-1223.854) [-1225.620] (-1223.815) (-1224.375) -- 0:01:10
195000 -- [-1222.439] (-1224.334) (-1221.382) (-1220.932) * [-1226.235] (-1228.439) (-1223.583) (-1222.599) -- 0:01:10
Average standard deviation of split frequencies: 0.014684
195500 -- [-1221.482] (-1221.168) (-1221.478) (-1221.941) * (-1225.063) [-1226.722] (-1223.808) (-1222.449) -- 0:01:09
196000 -- [-1223.527] (-1221.159) (-1222.379) (-1221.057) * [-1222.597] (-1221.232) (-1226.548) (-1223.463) -- 0:01:09
196500 -- (-1221.413) (-1221.734) (-1222.589) [-1221.642] * (-1226.289) (-1220.860) (-1220.992) [-1221.918] -- 0:01:09
197000 -- [-1221.740] (-1221.778) (-1223.547) (-1221.659) * (-1222.774) [-1221.494] (-1225.233) (-1223.142) -- 0:01:09
197500 -- (-1222.912) (-1228.385) (-1221.897) [-1221.811] * [-1222.623] (-1221.879) (-1222.578) (-1223.890) -- 0:01:09
198000 -- (-1222.831) [-1223.871] (-1222.391) (-1223.270) * (-1224.671) (-1225.674) (-1222.621) [-1225.283] -- 0:01:08
198500 -- [-1222.343] (-1222.241) (-1224.210) (-1223.329) * [-1221.199] (-1223.969) (-1222.450) (-1226.793) -- 0:01:08
199000 -- (-1221.639) (-1221.675) (-1222.268) [-1222.291] * (-1222.657) (-1225.755) [-1221.910] (-1227.992) -- 0:01:08
199500 -- (-1221.903) [-1222.927] (-1223.076) (-1222.932) * (-1221.385) (-1226.298) [-1224.940] (-1225.218) -- 0:01:08
200000 -- (-1222.599) [-1222.386] (-1223.338) (-1225.285) * (-1229.745) [-1221.373] (-1223.990) (-1224.224) -- 0:01:08
Average standard deviation of split frequencies: 0.014961
200500 -- (-1223.143) [-1224.818] (-1224.470) (-1228.465) * (-1225.564) (-1221.209) [-1224.925] (-1223.541) -- 0:01:07
201000 -- (-1224.523) (-1225.157) (-1221.141) [-1222.234] * (-1221.449) [-1222.293] (-1223.589) (-1224.897) -- 0:01:07
201500 -- (-1220.474) (-1223.688) [-1221.077] (-1221.328) * (-1223.295) [-1222.067] (-1222.869) (-1224.602) -- 0:01:07
202000 -- [-1221.122] (-1224.744) (-1224.052) (-1221.165) * (-1221.392) (-1224.598) [-1220.877] (-1221.504) -- 0:01:07
202500 -- [-1224.157] (-1225.181) (-1223.482) (-1222.520) * [-1220.844] (-1222.391) (-1225.697) (-1222.971) -- 0:01:06
203000 -- [-1223.412] (-1224.166) (-1223.380) (-1222.412) * [-1220.808] (-1223.757) (-1225.492) (-1223.278) -- 0:01:06
203500 -- (-1223.308) [-1221.047] (-1226.987) (-1222.725) * [-1221.286] (-1223.848) (-1224.381) (-1222.119) -- 0:01:06
204000 -- (-1222.537) (-1220.903) (-1223.821) [-1223.310] * [-1221.017] (-1224.604) (-1222.047) (-1222.360) -- 0:01:06
204500 -- (-1221.897) (-1221.966) [-1224.417] (-1223.972) * (-1227.769) (-1224.308) [-1224.858] (-1221.043) -- 0:01:10
205000 -- (-1224.272) (-1222.509) [-1225.893] (-1222.896) * (-1225.927) (-1222.026) (-1222.851) [-1223.471] -- 0:01:09
Average standard deviation of split frequencies: 0.014453
205500 -- (-1224.436) (-1223.770) [-1225.603] (-1221.718) * (-1226.754) (-1225.689) (-1224.923) [-1224.151] -- 0:01:09
206000 -- [-1224.352] (-1222.726) (-1223.412) (-1221.992) * (-1223.820) [-1223.956] (-1222.569) (-1225.099) -- 0:01:09
206500 -- (-1227.567) [-1222.489] (-1225.415) (-1223.951) * (-1221.695) (-1224.872) [-1225.477] (-1226.703) -- 0:01:09
207000 -- (-1222.247) (-1223.641) [-1223.282] (-1222.498) * (-1224.164) (-1226.463) (-1224.756) [-1226.396] -- 0:01:08
207500 -- (-1221.316) [-1221.607] (-1226.175) (-1222.822) * (-1227.600) [-1223.525] (-1224.876) (-1229.789) -- 0:01:08
208000 -- (-1223.694) [-1221.614] (-1225.350) (-1224.952) * [-1225.164] (-1222.548) (-1222.228) (-1224.517) -- 0:01:08
208500 -- (-1223.653) [-1221.520] (-1227.070) (-1221.448) * [-1226.845] (-1221.009) (-1223.906) (-1222.140) -- 0:01:08
209000 -- (-1223.143) [-1221.159] (-1224.914) (-1222.557) * (-1224.687) (-1221.392) (-1222.275) [-1223.991] -- 0:01:08
209500 -- [-1226.271] (-1224.676) (-1224.741) (-1220.652) * (-1225.256) [-1223.269] (-1222.685) (-1224.894) -- 0:01:07
210000 -- [-1221.355] (-1222.042) (-1221.347) (-1220.853) * (-1223.055) [-1222.480] (-1221.349) (-1225.762) -- 0:01:07
Average standard deviation of split frequencies: 0.014015
210500 -- (-1222.095) (-1222.849) (-1221.403) [-1222.331] * [-1223.071] (-1222.480) (-1221.779) (-1222.454) -- 0:01:07
211000 -- [-1222.394] (-1224.032) (-1224.538) (-1222.220) * (-1224.148) (-1225.179) [-1221.976] (-1222.071) -- 0:01:07
211500 -- (-1223.566) (-1224.994) [-1224.420] (-1222.683) * (-1223.152) (-1227.266) (-1221.593) [-1221.131] -- 0:01:07
212000 -- (-1221.434) [-1222.686] (-1224.697) (-1224.419) * [-1224.283] (-1225.343) (-1221.302) (-1222.733) -- 0:01:06
212500 -- [-1224.860] (-1222.186) (-1227.894) (-1227.252) * (-1223.600) [-1225.392] (-1223.276) (-1224.201) -- 0:01:06
213000 -- (-1222.889) (-1222.733) [-1222.053] (-1228.014) * [-1225.296] (-1222.821) (-1229.044) (-1223.817) -- 0:01:06
213500 -- [-1222.748] (-1221.795) (-1221.775) (-1221.518) * (-1224.018) (-1222.290) (-1228.194) [-1221.299] -- 0:01:06
214000 -- [-1223.529] (-1224.409) (-1224.375) (-1222.632) * (-1222.695) (-1223.368) (-1223.192) [-1222.137] -- 0:01:06
214500 -- (-1223.058) (-1221.094) [-1223.759] (-1221.663) * [-1222.942] (-1223.848) (-1221.699) (-1221.808) -- 0:01:05
215000 -- (-1220.911) (-1221.094) (-1222.687) [-1221.736] * [-1220.950] (-1221.521) (-1226.461) (-1229.253) -- 0:01:05
Average standard deviation of split frequencies: 0.013458
215500 -- [-1222.248] (-1221.259) (-1222.484) (-1222.135) * [-1223.105] (-1223.914) (-1223.925) (-1228.680) -- 0:01:09
216000 -- (-1222.451) (-1221.259) (-1221.346) [-1222.209] * [-1220.953] (-1223.785) (-1222.783) (-1223.567) -- 0:01:08
216500 -- [-1221.787] (-1226.659) (-1223.318) (-1221.431) * (-1221.471) (-1221.095) [-1222.754] (-1223.348) -- 0:01:08
217000 -- [-1224.948] (-1222.802) (-1227.182) (-1220.816) * [-1222.411] (-1222.706) (-1225.840) (-1222.610) -- 0:01:08
217500 -- [-1223.698] (-1222.783) (-1224.756) (-1221.514) * (-1227.163) (-1222.042) [-1224.133] (-1221.514) -- 0:01:08
218000 -- (-1223.256) (-1223.729) (-1223.247) [-1221.997] * (-1222.023) [-1221.007] (-1222.321) (-1221.926) -- 0:01:08
218500 -- (-1226.442) (-1224.308) (-1225.226) [-1220.805] * [-1221.686] (-1221.572) (-1225.444) (-1222.700) -- 0:01:07
219000 -- (-1229.151) (-1223.774) (-1223.855) [-1222.263] * (-1224.559) (-1221.525) [-1221.521] (-1223.187) -- 0:01:07
219500 -- (-1225.788) (-1224.014) [-1224.393] (-1221.311) * (-1222.977) (-1221.579) [-1225.117] (-1223.053) -- 0:01:07
220000 -- [-1221.427] (-1223.372) (-1223.878) (-1221.005) * (-1221.810) (-1222.474) [-1222.581] (-1223.262) -- 0:01:07
Average standard deviation of split frequencies: 0.014167
220500 -- (-1221.936) (-1222.609) (-1224.752) [-1223.552] * (-1222.078) (-1223.060) (-1224.675) [-1224.768] -- 0:01:07
221000 -- (-1221.936) [-1221.008] (-1221.746) (-1222.775) * (-1223.871) (-1222.532) [-1222.513] (-1228.235) -- 0:01:06
221500 -- (-1224.981) [-1221.456] (-1220.858) (-1222.488) * (-1223.648) (-1220.865) (-1224.358) [-1221.872] -- 0:01:06
222000 -- (-1222.717) (-1222.358) (-1225.009) [-1222.783] * (-1221.374) (-1220.987) (-1222.727) [-1222.292] -- 0:01:06
222500 -- (-1227.969) [-1222.275] (-1222.552) (-1222.063) * (-1222.513) [-1224.466] (-1226.221) (-1224.249) -- 0:01:06
223000 -- [-1224.365] (-1222.329) (-1221.663) (-1221.711) * (-1222.710) (-1224.457) [-1225.176] (-1223.626) -- 0:01:06
223500 -- (-1222.082) (-1224.022) (-1223.045) [-1220.637] * (-1221.323) [-1222.462] (-1222.549) (-1223.658) -- 0:01:06
224000 -- (-1220.989) (-1222.690) (-1225.709) [-1220.973] * (-1225.403) (-1223.310) [-1222.741] (-1223.083) -- 0:01:05
224500 -- (-1223.474) (-1222.676) (-1225.033) [-1221.664] * (-1229.859) [-1223.752] (-1221.078) (-1224.870) -- 0:01:05
225000 -- (-1223.689) (-1222.690) [-1227.575] (-1222.046) * (-1235.638) (-1225.918) (-1221.103) [-1224.014] -- 0:01:05
Average standard deviation of split frequencies: 0.013723
225500 -- (-1224.744) (-1222.489) (-1223.217) [-1221.602] * (-1227.099) [-1223.168] (-1221.379) (-1222.382) -- 0:01:05
226000 -- [-1226.290] (-1221.170) (-1223.217) (-1222.449) * (-1222.786) [-1222.283] (-1220.782) (-1221.938) -- 0:01:05
226500 -- (-1225.256) (-1224.568) [-1221.732] (-1222.856) * [-1224.584] (-1221.936) (-1222.128) (-1222.794) -- 0:01:04
227000 -- (-1226.631) (-1226.597) (-1225.611) [-1221.509] * (-1224.129) (-1221.620) [-1223.415] (-1221.610) -- 0:01:04
227500 -- (-1221.996) [-1224.874] (-1222.582) (-1221.325) * (-1226.175) (-1222.268) [-1223.935] (-1221.419) -- 0:01:07
228000 -- (-1222.694) (-1227.013) (-1222.714) [-1221.503] * [-1221.425] (-1222.228) (-1221.810) (-1221.705) -- 0:01:07
228500 -- [-1223.408] (-1227.538) (-1225.997) (-1223.676) * (-1221.501) (-1223.799) [-1221.781] (-1222.875) -- 0:01:07
229000 -- (-1224.168) (-1223.424) (-1225.301) [-1224.976] * (-1221.915) (-1222.486) (-1224.800) [-1221.864] -- 0:01:07
229500 -- (-1222.257) (-1225.751) (-1223.296) [-1225.329] * (-1223.200) [-1222.385] (-1222.822) (-1221.869) -- 0:01:07
230000 -- [-1221.562] (-1225.144) (-1225.437) (-1227.440) * [-1221.167] (-1221.132) (-1222.514) (-1221.589) -- 0:01:06
Average standard deviation of split frequencies: 0.012907
230500 -- (-1222.640) [-1224.100] (-1225.194) (-1221.854) * (-1221.101) (-1221.874) [-1222.098] (-1222.611) -- 0:01:06
231000 -- [-1223.669] (-1224.456) (-1224.617) (-1222.711) * (-1222.714) (-1220.976) [-1221.496] (-1223.935) -- 0:01:06
231500 -- (-1222.641) [-1222.202] (-1224.137) (-1221.802) * (-1221.849) (-1221.515) (-1222.146) [-1221.427] -- 0:01:06
232000 -- (-1230.191) [-1223.284] (-1222.206) (-1222.103) * (-1221.849) [-1224.012] (-1226.050) (-1221.428) -- 0:01:06
232500 -- (-1226.903) (-1222.072) (-1223.023) [-1223.225] * (-1221.659) (-1223.504) [-1224.573] (-1223.792) -- 0:01:06
233000 -- (-1230.929) (-1226.167) [-1221.993] (-1224.805) * [-1223.754] (-1222.236) (-1221.446) (-1223.425) -- 0:01:05
233500 -- (-1224.007) (-1222.724) (-1228.111) [-1226.122] * (-1222.948) (-1222.303) [-1221.905] (-1222.255) -- 0:01:05
234000 -- (-1222.754) (-1222.402) [-1224.179] (-1224.122) * [-1221.382] (-1222.641) (-1220.565) (-1222.274) -- 0:01:05
234500 -- (-1222.532) [-1226.521] (-1223.021) (-1227.025) * (-1224.092) (-1221.513) [-1222.809] (-1222.235) -- 0:01:05
235000 -- (-1221.770) [-1221.611] (-1222.895) (-1226.531) * (-1221.296) [-1221.513] (-1227.218) (-1220.836) -- 0:01:05
Average standard deviation of split frequencies: 0.014537
235500 -- (-1221.105) (-1222.244) (-1223.141) [-1224.709] * (-1222.253) [-1221.513] (-1231.745) (-1222.213) -- 0:01:04
236000 -- [-1223.425] (-1225.005) (-1222.234) (-1222.868) * (-1224.015) (-1224.308) (-1227.774) [-1223.867] -- 0:01:04
236500 -- (-1223.525) (-1223.735) (-1222.324) [-1221.570] * (-1222.530) (-1226.567) (-1223.942) [-1224.437] -- 0:01:04
237000 -- (-1222.356) (-1224.855) (-1221.946) [-1222.060] * (-1223.056) (-1224.182) [-1223.253] (-1224.101) -- 0:01:04
237500 -- (-1220.649) (-1226.795) (-1222.402) [-1221.122] * (-1222.990) (-1224.272) [-1221.364] (-1224.749) -- 0:01:04
238000 -- [-1222.023] (-1227.196) (-1222.581) (-1228.248) * (-1223.986) (-1222.507) (-1220.979) [-1223.137] -- 0:01:04
238500 -- (-1220.881) [-1222.034] (-1221.353) (-1222.096) * (-1225.276) (-1222.888) [-1221.203] (-1221.605) -- 0:01:03
239000 -- [-1220.773] (-1223.872) (-1227.492) (-1221.957) * (-1224.050) (-1224.634) [-1222.707] (-1222.077) -- 0:01:06
239500 -- [-1222.364] (-1221.864) (-1223.999) (-1222.814) * (-1223.790) (-1227.227) [-1221.467] (-1222.628) -- 0:01:06
240000 -- (-1222.713) (-1227.226) [-1221.974] (-1224.507) * (-1222.766) [-1222.005] (-1221.309) (-1222.674) -- 0:01:06
Average standard deviation of split frequencies: 0.014330
240500 -- (-1222.338) (-1224.059) [-1223.365] (-1222.351) * (-1222.543) [-1223.255] (-1221.330) (-1220.997) -- 0:01:06
241000 -- (-1223.816) (-1225.388) [-1224.432] (-1222.833) * (-1224.481) [-1224.721] (-1222.572) (-1222.506) -- 0:01:06
241500 -- [-1222.212] (-1222.981) (-1223.357) (-1221.879) * (-1221.599) (-1223.002) (-1223.016) [-1222.242] -- 0:01:05
242000 -- [-1223.448] (-1221.729) (-1222.806) (-1221.766) * (-1224.811) (-1224.477) [-1224.265] (-1223.161) -- 0:01:05
242500 -- (-1226.524) (-1223.536) (-1223.981) [-1221.171] * [-1224.186] (-1223.085) (-1225.700) (-1222.022) -- 0:01:05
243000 -- (-1221.441) (-1222.760) [-1224.853] (-1226.226) * (-1224.151) (-1221.853) [-1220.812] (-1222.625) -- 0:01:05
243500 -- (-1221.206) (-1223.354) [-1225.103] (-1224.965) * (-1224.106) (-1223.034) (-1224.255) [-1223.084] -- 0:01:05
244000 -- (-1222.283) [-1221.914] (-1225.205) (-1221.726) * (-1224.209) [-1221.203] (-1223.926) (-1222.031) -- 0:01:05
244500 -- [-1222.455] (-1223.493) (-1222.133) (-1225.428) * [-1221.222] (-1221.134) (-1224.248) (-1222.176) -- 0:01:04
245000 -- (-1222.461) [-1223.775] (-1221.647) (-1228.125) * [-1221.784] (-1222.939) (-1223.339) (-1223.510) -- 0:01:04
Average standard deviation of split frequencies: 0.013797
245500 -- [-1221.368] (-1223.461) (-1223.524) (-1224.312) * (-1223.607) (-1229.752) (-1224.654) [-1222.392] -- 0:01:04
246000 -- (-1221.833) [-1223.713] (-1223.691) (-1223.744) * (-1223.621) [-1222.763] (-1226.654) (-1223.079) -- 0:01:04
246500 -- [-1225.015] (-1223.750) (-1225.029) (-1223.206) * (-1223.638) (-1221.380) (-1223.799) [-1221.442] -- 0:01:04
247000 -- (-1225.513) (-1225.745) [-1222.932] (-1221.644) * [-1221.684] (-1223.066) (-1223.268) (-1225.685) -- 0:01:04
247500 -- (-1223.568) (-1224.462) (-1227.635) [-1221.615] * (-1221.719) (-1225.266) (-1222.548) [-1222.529] -- 0:01:03
248000 -- [-1223.776] (-1223.513) (-1222.085) (-1222.287) * (-1221.018) (-1222.653) (-1224.294) [-1224.013] -- 0:01:03
248500 -- (-1223.879) [-1223.920] (-1224.074) (-1223.662) * (-1221.035) (-1223.115) [-1223.680] (-1222.266) -- 0:01:03
249000 -- (-1222.875) (-1222.630) (-1222.212) [-1221.807] * [-1221.132] (-1225.610) (-1223.913) (-1222.374) -- 0:01:03
249500 -- (-1221.796) (-1223.286) (-1222.159) [-1224.334] * (-1221.139) [-1224.517] (-1222.047) (-1221.770) -- 0:01:03
250000 -- (-1225.306) (-1225.404) [-1222.619] (-1223.446) * [-1221.113] (-1221.250) (-1222.536) (-1221.290) -- 0:01:03
Average standard deviation of split frequencies: 0.013728
250500 -- [-1224.250] (-1226.303) (-1222.322) (-1224.612) * [-1222.184] (-1221.228) (-1224.179) (-1223.936) -- 0:01:05
251000 -- (-1225.567) [-1225.495] (-1222.117) (-1223.589) * (-1221.278) (-1225.522) (-1224.179) [-1222.485] -- 0:01:05
251500 -- [-1225.054] (-1223.460) (-1223.828) (-1223.271) * (-1225.604) (-1224.439) [-1221.048] (-1224.526) -- 0:01:05
252000 -- [-1227.236] (-1224.648) (-1223.253) (-1225.367) * (-1225.116) (-1223.039) (-1222.134) [-1224.186] -- 0:01:05
252500 -- (-1224.397) [-1223.145] (-1225.153) (-1224.117) * [-1225.258] (-1224.167) (-1224.599) (-1226.474) -- 0:01:05
253000 -- (-1221.922) (-1221.504) (-1221.482) [-1223.443] * (-1225.327) (-1223.530) [-1222.373] (-1223.471) -- 0:01:04
253500 -- (-1221.535) [-1221.652] (-1222.318) (-1226.276) * (-1227.345) [-1222.128] (-1222.964) (-1224.436) -- 0:01:04
254000 -- [-1221.103] (-1222.097) (-1221.980) (-1226.180) * (-1223.375) (-1223.841) (-1222.004) [-1225.690] -- 0:01:04
254500 -- (-1222.131) (-1220.977) (-1226.026) [-1225.021] * (-1222.833) (-1224.698) [-1222.038] (-1223.078) -- 0:01:04
255000 -- (-1225.752) [-1221.400] (-1224.893) (-1221.836) * (-1223.325) (-1225.308) [-1224.553] (-1223.320) -- 0:01:04
Average standard deviation of split frequencies: 0.014298
255500 -- (-1221.099) (-1221.229) [-1223.928] (-1222.128) * [-1220.932] (-1225.280) (-1223.431) (-1222.834) -- 0:01:04
256000 -- [-1221.178] (-1223.320) (-1223.187) (-1221.294) * (-1220.913) (-1224.166) [-1224.745] (-1222.970) -- 0:01:03
256500 -- (-1221.144) (-1222.335) (-1222.890) [-1221.368] * (-1223.917) (-1223.093) [-1225.180] (-1224.368) -- 0:01:03
257000 -- (-1221.607) (-1223.317) (-1225.117) [-1221.410] * [-1226.546] (-1226.029) (-1224.996) (-1225.390) -- 0:01:03
257500 -- (-1222.532) (-1222.235) [-1225.214] (-1224.041) * (-1222.592) (-1221.264) [-1222.851] (-1229.355) -- 0:01:03
258000 -- [-1223.950] (-1223.204) (-1223.843) (-1220.852) * (-1222.263) (-1222.040) (-1227.315) [-1222.753] -- 0:01:03
258500 -- (-1225.166) [-1221.331] (-1222.145) (-1220.948) * (-1223.177) [-1223.277] (-1228.251) (-1224.579) -- 0:01:03
259000 -- (-1224.093) [-1222.003] (-1221.424) (-1220.953) * (-1221.460) (-1225.856) [-1222.572] (-1223.789) -- 0:01:02
259500 -- (-1221.352) (-1223.797) (-1222.609) [-1222.887] * (-1222.695) (-1224.404) (-1222.578) [-1221.169] -- 0:01:02
260000 -- [-1222.855] (-1222.490) (-1223.135) (-1222.800) * (-1228.281) (-1222.771) (-1224.466) [-1221.600] -- 0:01:02
Average standard deviation of split frequencies: 0.015033
260500 -- [-1221.949] (-1222.350) (-1221.886) (-1223.066) * (-1223.811) (-1223.150) [-1223.207] (-1221.143) -- 0:01:02
261000 -- (-1221.776) (-1223.360) (-1221.857) [-1227.154] * (-1222.107) (-1223.876) [-1221.653] (-1223.188) -- 0:01:02
261500 -- (-1223.992) [-1224.773] (-1222.292) (-1223.465) * [-1222.857] (-1221.375) (-1221.719) (-1224.613) -- 0:01:02
262000 -- [-1222.198] (-1222.365) (-1221.084) (-1226.201) * (-1221.883) [-1220.935] (-1222.201) (-1223.558) -- 0:01:01
262500 -- (-1223.406) (-1222.022) [-1221.024] (-1228.459) * (-1222.467) [-1222.269] (-1223.616) (-1223.464) -- 0:01:04
263000 -- (-1222.162) (-1221.980) [-1221.848] (-1226.754) * (-1221.493) (-1221.846) [-1224.450] (-1224.135) -- 0:01:04
263500 -- (-1223.425) [-1221.479] (-1223.034) (-1224.893) * (-1223.726) (-1222.775) [-1223.450] (-1226.880) -- 0:01:04
264000 -- (-1221.820) [-1221.511] (-1225.307) (-1224.155) * (-1224.330) (-1225.399) [-1222.366] (-1224.749) -- 0:01:04
264500 -- [-1221.100] (-1221.449) (-1229.188) (-1221.241) * (-1222.829) (-1221.325) (-1223.348) [-1223.368] -- 0:01:03
265000 -- (-1221.270) (-1223.615) (-1222.700) [-1221.315] * (-1223.249) (-1222.712) [-1223.126] (-1222.582) -- 0:01:03
Average standard deviation of split frequencies: 0.015950
265500 -- (-1221.370) (-1220.934) (-1222.920) [-1222.440] * (-1221.077) (-1220.854) [-1222.149] (-1222.286) -- 0:01:03
266000 -- (-1223.336) (-1221.554) [-1224.281] (-1221.900) * (-1222.344) (-1221.208) (-1222.400) [-1221.472] -- 0:01:03
266500 -- (-1222.784) (-1226.774) (-1224.193) [-1221.245] * (-1224.000) (-1221.365) [-1223.885] (-1221.108) -- 0:01:03
267000 -- (-1221.921) (-1227.847) (-1223.280) [-1222.745] * (-1222.643) [-1224.693] (-1221.624) (-1221.108) -- 0:01:03
267500 -- (-1224.793) (-1221.466) [-1221.378] (-1222.407) * (-1222.179) (-1223.953) [-1220.749] (-1223.460) -- 0:01:02
268000 -- (-1222.755) (-1221.962) [-1221.691] (-1222.271) * (-1223.640) (-1223.275) [-1223.854] (-1222.792) -- 0:01:02
268500 -- (-1222.300) (-1224.388) [-1222.095] (-1223.515) * (-1222.892) (-1223.839) (-1225.791) [-1221.093] -- 0:01:02
269000 -- [-1222.810] (-1221.747) (-1220.898) (-1221.648) * (-1223.084) (-1223.061) [-1223.534] (-1220.870) -- 0:01:02
269500 -- [-1223.262] (-1222.634) (-1221.727) (-1221.804) * (-1223.044) (-1221.892) [-1225.092] (-1220.744) -- 0:01:02
270000 -- (-1224.857) (-1221.916) (-1225.526) [-1223.614] * (-1223.698) (-1222.543) [-1226.839] (-1225.687) -- 0:01:02
Average standard deviation of split frequencies: 0.014445
270500 -- (-1224.097) (-1221.224) [-1222.204] (-1223.185) * [-1222.747] (-1225.428) (-1228.128) (-1222.826) -- 0:01:02
271000 -- (-1222.849) [-1222.878] (-1222.261) (-1221.352) * (-1223.747) (-1228.645) [-1228.855] (-1223.334) -- 0:01:01
271500 -- (-1225.691) (-1222.319) [-1221.929] (-1221.932) * [-1224.197] (-1225.624) (-1222.974) (-1222.373) -- 0:01:01
272000 -- (-1221.761) (-1223.421) [-1221.758] (-1223.111) * (-1225.443) (-1224.291) [-1221.689] (-1222.853) -- 0:01:01
272500 -- (-1221.920) (-1224.229) [-1223.305] (-1222.164) * (-1225.832) [-1223.293] (-1221.808) (-1224.291) -- 0:01:01
273000 -- (-1225.317) (-1221.708) [-1224.216] (-1222.278) * (-1221.771) [-1223.699] (-1223.004) (-1222.788) -- 0:01:01
273500 -- (-1222.163) (-1224.938) (-1224.702) [-1222.218] * (-1222.917) (-1222.470) [-1220.488] (-1226.469) -- 0:01:01
274000 -- (-1224.883) (-1222.298) [-1223.096] (-1221.128) * (-1222.433) [-1222.378] (-1221.669) (-1225.919) -- 0:01:03
274500 -- [-1226.647] (-1220.900) (-1223.867) (-1221.976) * (-1228.951) [-1223.802] (-1229.847) (-1225.775) -- 0:01:03
275000 -- (-1221.127) [-1221.961] (-1224.642) (-1221.470) * (-1225.850) [-1225.672] (-1230.794) (-1222.541) -- 0:01:03
Average standard deviation of split frequencies: 0.013463
275500 -- (-1221.101) (-1226.043) [-1223.861] (-1221.443) * (-1221.837) (-1223.303) [-1222.764] (-1223.018) -- 0:01:03
276000 -- (-1221.267) (-1225.739) (-1223.443) [-1222.344] * [-1226.895] (-1222.587) (-1222.761) (-1223.509) -- 0:01:02
276500 -- (-1222.737) (-1224.122) [-1227.109] (-1223.015) * (-1222.788) (-1221.515) (-1223.514) [-1224.565] -- 0:01:02
277000 -- (-1222.222) (-1223.092) (-1227.122) [-1223.046] * (-1224.366) (-1221.168) (-1223.832) [-1224.655] -- 0:01:02
277500 -- [-1221.860] (-1225.649) (-1226.558) (-1221.399) * (-1223.680) (-1221.667) [-1222.441] (-1223.759) -- 0:01:02
278000 -- (-1221.262) [-1226.313] (-1226.600) (-1225.346) * [-1224.965] (-1224.072) (-1220.839) (-1223.527) -- 0:01:02
278500 -- (-1222.644) (-1227.643) (-1224.781) [-1221.614] * [-1224.489] (-1223.354) (-1223.554) (-1226.348) -- 0:01:02
279000 -- (-1227.579) (-1223.978) (-1223.853) [-1222.013] * (-1221.170) (-1226.516) [-1223.523] (-1223.949) -- 0:01:02
279500 -- [-1222.436] (-1222.844) (-1225.739) (-1223.341) * (-1223.056) (-1223.358) [-1223.148] (-1224.105) -- 0:01:01
280000 -- [-1220.924] (-1222.800) (-1227.364) (-1222.797) * [-1221.524] (-1221.873) (-1225.025) (-1223.179) -- 0:01:01
Average standard deviation of split frequencies: 0.014381
280500 -- [-1224.228] (-1221.942) (-1225.204) (-1222.812) * (-1224.801) (-1222.045) [-1224.892] (-1223.282) -- 0:01:01
281000 -- (-1223.243) [-1224.710] (-1222.930) (-1221.962) * [-1224.875] (-1223.804) (-1223.090) (-1222.293) -- 0:01:01
281500 -- (-1221.771) (-1226.014) (-1223.409) [-1221.263] * (-1220.954) (-1222.482) (-1220.654) [-1222.249] -- 0:01:01
282000 -- [-1221.204] (-1224.745) (-1223.999) (-1221.182) * [-1221.482] (-1224.449) (-1223.691) (-1223.937) -- 0:01:01
282500 -- (-1221.169) (-1220.968) (-1226.246) [-1221.965] * (-1221.622) [-1224.405] (-1221.917) (-1226.723) -- 0:01:00
283000 -- (-1222.093) (-1220.942) (-1221.608) [-1220.707] * (-1231.297) (-1221.374) (-1225.021) [-1221.708] -- 0:01:00
283500 -- (-1223.276) [-1220.924] (-1223.144) (-1220.745) * [-1223.098] (-1221.922) (-1223.042) (-1221.419) -- 0:01:00
284000 -- (-1226.450) (-1221.571) [-1223.557] (-1223.515) * (-1223.302) (-1221.819) (-1222.218) [-1221.465] -- 0:01:00
284500 -- (-1225.080) (-1224.954) (-1225.254) [-1223.238] * [-1223.596] (-1221.925) (-1222.227) (-1222.338) -- 0:01:00
285000 -- (-1223.191) [-1222.170] (-1221.767) (-1223.728) * (-1224.694) (-1223.044) [-1221.761] (-1222.819) -- 0:01:00
Average standard deviation of split frequencies: 0.013089
285500 -- (-1221.447) (-1223.714) (-1222.449) [-1222.399] * (-1227.202) (-1224.352) [-1223.100] (-1222.951) -- 0:01:02
286000 -- (-1221.395) (-1224.539) [-1222.583] (-1221.416) * [-1226.855] (-1224.203) (-1223.548) (-1222.144) -- 0:01:02
286500 -- (-1230.712) [-1225.001] (-1221.402) (-1221.957) * (-1224.337) (-1223.965) [-1223.591] (-1222.247) -- 0:01:02
287000 -- (-1226.771) (-1225.456) [-1223.319] (-1225.377) * (-1223.445) (-1222.275) [-1222.815] (-1222.051) -- 0:01:02
287500 -- (-1221.785) (-1224.442) (-1222.606) [-1222.259] * [-1223.065] (-1222.336) (-1227.238) (-1221.843) -- 0:01:01
288000 -- (-1221.999) [-1222.546] (-1222.803) (-1222.053) * (-1223.065) [-1221.440] (-1225.378) (-1221.488) -- 0:01:01
288500 -- (-1221.241) [-1223.770] (-1222.102) (-1221.970) * (-1221.868) [-1222.195] (-1222.984) (-1221.139) -- 0:01:01
289000 -- (-1221.780) [-1224.623] (-1224.999) (-1221.970) * (-1221.740) [-1221.267] (-1222.747) (-1223.013) -- 0:01:01
289500 -- (-1222.132) (-1223.030) [-1223.086] (-1222.262) * (-1221.419) [-1221.225] (-1222.680) (-1227.511) -- 0:01:01
290000 -- (-1221.786) [-1221.672] (-1223.602) (-1222.444) * (-1222.972) [-1221.430] (-1222.759) (-1225.764) -- 0:01:01
Average standard deviation of split frequencies: 0.012772
290500 -- (-1223.025) (-1222.016) [-1222.935] (-1223.084) * (-1225.003) (-1222.591) [-1221.925] (-1228.099) -- 0:01:01
291000 -- (-1224.678) (-1222.009) [-1223.844] (-1223.845) * [-1225.394] (-1222.495) (-1222.106) (-1223.801) -- 0:01:00
291500 -- (-1225.538) [-1224.370] (-1222.086) (-1222.004) * (-1224.344) (-1220.532) (-1224.372) [-1221.882] -- 0:01:00
292000 -- (-1221.595) (-1221.862) (-1225.644) [-1223.559] * (-1223.204) (-1221.157) [-1221.172] (-1223.550) -- 0:01:00
292500 -- (-1225.478) (-1222.925) (-1222.051) [-1221.988] * (-1223.373) (-1221.318) [-1223.398] (-1222.886) -- 0:01:00
293000 -- (-1225.128) (-1221.450) [-1221.663] (-1220.680) * (-1221.431) [-1222.564] (-1224.166) (-1221.884) -- 0:01:00
293500 -- (-1229.019) [-1221.409] (-1220.888) (-1222.524) * (-1223.464) (-1222.238) (-1221.349) [-1221.825] -- 0:01:00
294000 -- (-1222.227) [-1221.425] (-1222.722) (-1223.370) * (-1221.977) (-1220.985) [-1221.388] (-1222.307) -- 0:01:00
294500 -- (-1223.387) (-1222.447) [-1223.046] (-1223.909) * (-1223.128) (-1221.375) (-1221.863) [-1221.935] -- 0:00:59
295000 -- (-1220.832) (-1222.406) (-1222.255) [-1221.562] * (-1221.263) (-1223.295) [-1220.654] (-1222.866) -- 0:00:59
Average standard deviation of split frequencies: 0.013139
295500 -- [-1222.621] (-1224.229) (-1221.594) (-1221.768) * (-1221.453) [-1221.583] (-1220.938) (-1228.413) -- 0:00:59
296000 -- (-1222.234) [-1222.923] (-1221.521) (-1221.198) * [-1221.108] (-1223.002) (-1221.688) (-1224.027) -- 0:00:59
296500 -- (-1222.052) (-1222.895) [-1221.993] (-1224.901) * (-1221.159) (-1221.311) [-1220.829] (-1222.057) -- 0:00:59
297000 -- (-1225.319) (-1225.602) [-1222.107] (-1223.901) * (-1223.312) (-1223.206) (-1223.883) [-1220.461] -- 0:01:01
297500 -- (-1222.971) (-1224.306) (-1222.101) [-1222.556] * (-1223.176) [-1221.629] (-1221.734) (-1226.778) -- 0:01:01
298000 -- (-1223.121) (-1222.872) (-1226.876) [-1223.194] * (-1221.580) (-1225.521) [-1221.700] (-1225.080) -- 0:01:01
298500 -- [-1224.331] (-1224.399) (-1222.100) (-1221.480) * [-1222.408] (-1224.584) (-1221.421) (-1224.584) -- 0:01:01
299000 -- (-1222.924) (-1221.679) (-1223.211) [-1222.158] * (-1222.459) [-1220.762] (-1222.676) (-1225.174) -- 0:01:00
299500 -- [-1223.427] (-1222.779) (-1224.526) (-1225.079) * (-1223.082) (-1224.495) [-1220.742] (-1221.552) -- 0:01:00
300000 -- (-1223.818) (-1223.179) [-1222.323] (-1223.517) * (-1221.925) (-1226.030) (-1222.441) [-1221.768] -- 0:01:00
Average standard deviation of split frequencies: 0.012053
300500 -- (-1223.083) (-1227.352) [-1223.866] (-1223.721) * (-1224.052) (-1225.612) [-1226.054] (-1222.352) -- 0:01:00
301000 -- (-1220.770) [-1222.238] (-1223.364) (-1223.635) * (-1223.872) (-1225.882) (-1225.975) [-1225.912] -- 0:01:00
301500 -- (-1220.727) (-1224.263) (-1224.606) [-1223.436] * [-1222.608] (-1222.392) (-1222.271) (-1222.733) -- 0:01:00
302000 -- (-1222.173) (-1226.825) (-1222.384) [-1222.172] * (-1223.177) (-1223.195) [-1222.295] (-1222.148) -- 0:01:00
302500 -- (-1221.699) (-1223.966) [-1221.681] (-1222.685) * [-1222.811] (-1224.109) (-1222.238) (-1222.244) -- 0:00:59
303000 -- [-1224.508] (-1222.222) (-1221.812) (-1226.495) * (-1223.518) (-1222.739) [-1222.573] (-1223.994) -- 0:00:59
303500 -- (-1224.511) [-1224.482] (-1222.213) (-1224.246) * (-1221.933) [-1224.281] (-1223.499) (-1222.012) -- 0:00:59
304000 -- (-1226.737) (-1222.201) (-1225.249) [-1222.338] * (-1225.665) (-1225.082) (-1224.379) [-1220.718] -- 0:00:59
304500 -- (-1224.686) (-1222.105) [-1223.647] (-1222.333) * (-1226.090) (-1225.106) [-1223.670] (-1221.771) -- 0:00:59
305000 -- [-1220.576] (-1221.104) (-1222.734) (-1221.321) * (-1225.320) [-1223.599] (-1224.407) (-1222.469) -- 0:00:59
Average standard deviation of split frequencies: 0.011509
305500 -- [-1221.844] (-1221.068) (-1223.292) (-1221.275) * (-1224.858) (-1224.369) (-1222.220) [-1222.792] -- 0:00:59
306000 -- (-1222.151) (-1220.940) [-1224.306] (-1220.911) * (-1221.718) (-1226.263) [-1221.744] (-1221.975) -- 0:00:58
306500 -- (-1223.049) [-1222.429] (-1224.803) (-1221.007) * (-1226.153) (-1225.132) [-1221.744] (-1223.445) -- 0:00:58
307000 -- [-1223.426] (-1222.544) (-1223.866) (-1222.935) * (-1225.879) (-1221.313) (-1221.532) [-1222.178] -- 0:00:58
307500 -- (-1227.385) (-1222.026) [-1220.923] (-1224.507) * (-1226.846) [-1220.743] (-1221.867) (-1227.246) -- 0:00:58
308000 -- (-1222.799) (-1222.648) [-1223.399] (-1225.278) * (-1224.571) (-1221.648) (-1222.930) [-1226.595] -- 0:00:58
308500 -- (-1227.437) [-1221.153] (-1221.841) (-1222.562) * (-1223.591) [-1221.559] (-1221.439) (-1224.575) -- 0:00:58
309000 -- [-1224.997] (-1220.860) (-1226.653) (-1222.446) * (-1222.671) [-1222.137] (-1222.293) (-1222.498) -- 0:01:00
309500 -- (-1224.884) (-1220.962) [-1227.470] (-1222.054) * [-1221.399] (-1222.090) (-1225.894) (-1221.847) -- 0:01:00
310000 -- [-1223.410] (-1225.858) (-1221.753) (-1227.278) * (-1221.992) (-1225.531) (-1222.344) [-1222.457] -- 0:01:00
Average standard deviation of split frequencies: 0.010432
310500 -- (-1223.946) [-1221.885] (-1220.999) (-1225.463) * (-1225.460) (-1222.877) (-1229.542) [-1221.568] -- 0:00:59
311000 -- (-1222.240) [-1221.157] (-1222.819) (-1226.381) * (-1225.439) (-1224.117) (-1224.863) [-1221.269] -- 0:00:59
311500 -- (-1227.801) (-1223.048) [-1224.257] (-1228.457) * (-1224.234) [-1222.462] (-1226.778) (-1221.251) -- 0:00:59
312000 -- (-1227.280) (-1223.427) (-1221.331) [-1224.849] * (-1227.740) [-1222.541] (-1224.607) (-1223.694) -- 0:00:59
312500 -- (-1226.350) [-1224.579] (-1224.657) (-1224.619) * [-1222.065] (-1224.501) (-1222.477) (-1220.777) -- 0:00:59
313000 -- (-1224.608) (-1225.379) [-1223.577] (-1222.214) * (-1221.905) (-1223.546) (-1222.646) [-1221.840] -- 0:00:59
313500 -- (-1223.178) (-1226.211) [-1223.276] (-1223.603) * (-1220.980) (-1223.156) [-1221.492] (-1221.971) -- 0:00:59
314000 -- (-1227.558) (-1225.228) [-1224.253] (-1221.669) * [-1221.233] (-1226.169) (-1221.470) (-1220.776) -- 0:00:58
314500 -- (-1224.654) (-1224.770) [-1221.349] (-1221.652) * [-1221.735] (-1227.803) (-1223.856) (-1222.177) -- 0:00:58
315000 -- (-1225.436) (-1222.717) [-1224.635] (-1220.932) * (-1225.039) (-1227.910) [-1220.751] (-1223.553) -- 0:00:58
Average standard deviation of split frequencies: 0.009603
315500 -- (-1222.316) (-1223.045) [-1223.718] (-1221.275) * [-1222.599] (-1222.483) (-1221.835) (-1223.870) -- 0:00:58
316000 -- (-1222.169) [-1222.018] (-1225.659) (-1222.888) * (-1223.760) (-1223.292) [-1220.736] (-1221.190) -- 0:00:58
316500 -- [-1221.312] (-1222.417) (-1225.655) (-1223.021) * (-1223.110) (-1222.733) [-1223.659] (-1221.462) -- 0:00:58
317000 -- (-1222.744) (-1225.491) [-1225.112] (-1224.768) * (-1223.792) (-1221.855) [-1222.760] (-1222.564) -- 0:00:58
317500 -- (-1224.118) [-1221.512] (-1227.283) (-1226.999) * (-1225.891) [-1222.195] (-1222.633) (-1223.965) -- 0:00:58
318000 -- (-1221.264) (-1220.971) (-1230.769) [-1223.978] * (-1227.388) (-1221.581) (-1223.357) [-1225.959] -- 0:00:57
318500 -- (-1221.415) [-1221.010] (-1227.592) (-1223.093) * (-1225.095) (-1220.893) (-1223.357) [-1221.802] -- 0:00:57
319000 -- (-1220.786) (-1220.863) [-1224.147] (-1225.356) * (-1226.191) (-1225.873) (-1222.168) [-1221.371] -- 0:00:57
319500 -- (-1221.828) (-1221.712) (-1224.463) [-1221.672] * (-1228.737) (-1222.569) [-1225.950] (-1226.974) -- 0:00:57
320000 -- (-1221.423) [-1223.080] (-1221.669) (-1222.413) * (-1227.146) (-1221.926) [-1224.987] (-1223.780) -- 0:00:57
Average standard deviation of split frequencies: 0.009004
320500 -- (-1221.444) [-1221.480] (-1222.276) (-1221.525) * [-1227.856] (-1222.687) (-1223.936) (-1222.410) -- 0:00:59
321000 -- (-1225.240) (-1221.595) [-1221.327] (-1225.350) * (-1232.835) (-1220.835) [-1222.613] (-1229.628) -- 0:00:59
321500 -- (-1221.893) (-1223.790) (-1222.527) [-1222.889] * (-1225.892) [-1220.802] (-1223.763) (-1223.609) -- 0:00:59
322000 -- (-1222.545) [-1221.180] (-1223.306) (-1222.011) * [-1226.611] (-1221.627) (-1224.167) (-1221.285) -- 0:00:58
322500 -- (-1224.201) (-1221.738) [-1222.353] (-1221.981) * (-1226.763) [-1221.586] (-1222.841) (-1223.014) -- 0:00:58
323000 -- (-1226.990) (-1223.185) (-1224.323) [-1222.839] * (-1222.267) [-1223.359] (-1222.881) (-1221.310) -- 0:00:58
323500 -- (-1221.914) (-1225.299) (-1226.378) [-1221.036] * (-1220.890) (-1223.130) (-1220.908) [-1220.716] -- 0:00:58
324000 -- (-1223.119) [-1221.899] (-1225.040) (-1220.884) * (-1224.428) (-1224.918) [-1223.151] (-1220.727) -- 0:00:58
324500 -- (-1220.857) [-1223.651] (-1224.102) (-1221.770) * [-1221.516] (-1222.257) (-1221.434) (-1222.387) -- 0:00:58
325000 -- (-1223.221) (-1221.028) (-1223.295) [-1221.527] * (-1220.550) [-1221.816] (-1221.582) (-1224.775) -- 0:00:58
Average standard deviation of split frequencies: 0.009941
325500 -- (-1223.594) [-1223.892] (-1223.391) (-1221.910) * [-1221.065] (-1222.770) (-1221.670) (-1222.740) -- 0:00:58
326000 -- (-1221.976) [-1224.255] (-1223.342) (-1221.635) * (-1221.551) (-1222.204) (-1222.229) [-1225.074] -- 0:00:57
326500 -- (-1221.208) (-1221.972) (-1227.505) [-1225.707] * (-1222.075) (-1223.794) (-1222.303) [-1222.424] -- 0:00:57
327000 -- (-1223.586) (-1222.160) (-1228.388) [-1224.129] * [-1223.021] (-1222.099) (-1221.897) (-1221.639) -- 0:00:57
327500 -- (-1221.916) [-1221.630] (-1224.172) (-1226.792) * (-1223.394) (-1222.649) [-1224.395] (-1224.473) -- 0:00:57
328000 -- (-1223.165) [-1221.200] (-1222.445) (-1225.839) * [-1223.378] (-1225.126) (-1221.315) (-1224.044) -- 0:00:57
328500 -- (-1227.522) [-1221.399] (-1222.903) (-1222.172) * (-1222.889) (-1223.079) [-1221.553] (-1221.733) -- 0:00:57
329000 -- (-1226.886) [-1221.399] (-1220.816) (-1223.932) * [-1225.183] (-1221.259) (-1226.014) (-1221.338) -- 0:00:57
329500 -- (-1227.588) (-1221.511) (-1223.573) [-1222.362] * (-1222.513) (-1222.884) [-1223.686] (-1222.363) -- 0:00:56
330000 -- (-1228.439) (-1221.534) (-1221.666) [-1223.173] * (-1225.659) [-1221.345] (-1221.998) (-1222.723) -- 0:00:56
Average standard deviation of split frequencies: 0.009445
330500 -- (-1223.692) (-1221.134) [-1221.652] (-1225.472) * (-1223.772) (-1223.301) [-1221.693] (-1223.207) -- 0:00:56
331000 -- (-1223.887) (-1222.509) (-1224.901) [-1223.548] * (-1225.947) (-1222.502) [-1224.642] (-1224.802) -- 0:00:56
331500 -- (-1223.027) [-1222.983] (-1223.158) (-1223.271) * [-1223.364] (-1222.549) (-1222.535) (-1222.627) -- 0:00:56
332000 -- (-1224.058) [-1223.581] (-1223.869) (-1224.539) * (-1221.693) [-1223.098] (-1223.335) (-1221.608) -- 0:00:56
332500 -- (-1225.525) [-1221.410] (-1226.333) (-1221.900) * (-1223.454) (-1226.274) (-1222.766) [-1220.832] -- 0:00:58
333000 -- (-1227.183) (-1223.983) (-1224.372) [-1222.095] * (-1222.068) [-1221.578] (-1223.564) (-1221.114) -- 0:00:58
333500 -- (-1224.154) (-1224.406) [-1222.077] (-1222.146) * (-1221.700) (-1227.528) [-1223.533] (-1224.446) -- 0:00:57
334000 -- (-1223.731) (-1223.301) (-1224.686) [-1224.119] * (-1226.780) [-1225.892] (-1223.269) (-1223.259) -- 0:00:57
334500 -- (-1223.601) [-1222.485] (-1223.372) (-1222.088) * (-1223.396) (-1223.440) [-1222.231] (-1225.052) -- 0:00:57
335000 -- (-1222.709) [-1222.806] (-1222.500) (-1222.250) * [-1223.374] (-1222.960) (-1225.962) (-1221.729) -- 0:00:57
Average standard deviation of split frequencies: 0.008681
335500 -- (-1222.081) [-1225.651] (-1223.815) (-1223.511) * [-1224.637] (-1222.824) (-1227.208) (-1222.033) -- 0:00:57
336000 -- (-1222.537) (-1227.929) (-1222.112) [-1220.772] * (-1223.717) (-1225.146) [-1223.305] (-1220.818) -- 0:00:57
336500 -- [-1221.556] (-1224.003) (-1222.709) (-1223.490) * (-1223.848) [-1220.756] (-1221.199) (-1225.418) -- 0:00:57
337000 -- (-1222.608) (-1222.585) (-1223.130) [-1224.634] * [-1223.728] (-1223.574) (-1223.632) (-1222.418) -- 0:00:57
337500 -- (-1223.454) (-1222.533) [-1223.253] (-1224.906) * (-1225.106) (-1223.653) [-1224.548] (-1222.097) -- 0:00:56
338000 -- (-1221.908) (-1221.666) [-1222.286] (-1225.183) * [-1226.645] (-1220.725) (-1223.310) (-1222.158) -- 0:00:56
338500 -- (-1222.376) (-1221.521) (-1226.710) [-1222.220] * (-1224.564) (-1222.401) (-1224.327) [-1222.377] -- 0:00:56
339000 -- (-1221.143) (-1221.830) (-1224.301) [-1224.608] * (-1221.747) (-1223.817) (-1227.400) [-1222.253] -- 0:00:56
339500 -- [-1223.697] (-1221.877) (-1225.693) (-1223.044) * [-1223.139] (-1221.758) (-1224.293) (-1224.270) -- 0:00:56
340000 -- (-1224.525) (-1221.433) [-1221.574] (-1220.593) * (-1222.502) (-1224.377) [-1223.952] (-1224.508) -- 0:00:56
Average standard deviation of split frequencies: 0.009254
340500 -- [-1225.632] (-1221.299) (-1223.083) (-1222.705) * (-1222.757) [-1222.724] (-1224.696) (-1224.763) -- 0:00:56
341000 -- (-1223.144) [-1221.710] (-1224.095) (-1223.158) * (-1222.849) [-1223.277] (-1222.996) (-1220.961) -- 0:00:56
341500 -- (-1223.149) (-1222.786) (-1221.861) [-1222.926] * (-1226.315) [-1222.756] (-1221.025) (-1222.370) -- 0:00:55
342000 -- (-1223.873) [-1221.590] (-1223.004) (-1223.450) * [-1223.726] (-1227.257) (-1221.094) (-1223.156) -- 0:00:55
342500 -- [-1221.496] (-1221.732) (-1223.516) (-1221.095) * (-1223.013) (-1220.902) (-1222.913) [-1220.835] -- 0:00:55
343000 -- [-1221.763] (-1221.820) (-1226.576) (-1222.954) * [-1225.276] (-1222.140) (-1225.738) (-1224.863) -- 0:00:55
343500 -- [-1223.393] (-1226.357) (-1228.649) (-1223.106) * (-1224.242) (-1223.461) [-1221.531] (-1226.649) -- 0:00:55
344000 -- [-1226.283] (-1224.145) (-1225.406) (-1222.641) * (-1228.948) (-1222.020) [-1224.631] (-1223.654) -- 0:00:55
344500 -- [-1222.675] (-1221.762) (-1223.951) (-1227.308) * [-1226.912] (-1222.048) (-1225.118) (-1226.085) -- 0:00:57
345000 -- (-1223.424) (-1222.390) [-1221.867] (-1222.756) * [-1222.959] (-1221.961) (-1226.878) (-1221.046) -- 0:00:56
Average standard deviation of split frequencies: 0.008771
345500 -- (-1223.905) (-1225.763) [-1221.795] (-1221.336) * (-1222.197) (-1222.905) (-1221.772) [-1221.241] -- 0:00:56
346000 -- (-1221.153) (-1223.174) [-1221.415] (-1221.423) * (-1223.663) (-1223.196) [-1223.057] (-1221.546) -- 0:00:56
346500 -- (-1221.172) (-1221.971) [-1221.193] (-1222.186) * (-1227.992) (-1223.410) (-1224.654) [-1221.851] -- 0:00:56
347000 -- [-1221.285] (-1221.111) (-1222.379) (-1222.143) * (-1221.276) (-1222.449) (-1223.314) [-1222.260] -- 0:00:56
347500 -- (-1223.902) [-1221.827] (-1221.987) (-1225.161) * (-1221.435) (-1221.882) [-1222.263] (-1223.754) -- 0:00:56
348000 -- (-1222.145) (-1223.941) (-1225.723) [-1225.082] * (-1221.414) [-1223.501] (-1221.184) (-1221.098) -- 0:00:56
348500 -- [-1221.472] (-1222.404) (-1222.820) (-1224.006) * (-1223.176) [-1224.622] (-1222.420) (-1223.326) -- 0:00:56
349000 -- (-1221.684) (-1221.893) [-1222.794] (-1222.759) * (-1224.424) (-1224.647) [-1221.786] (-1223.265) -- 0:00:55
349500 -- (-1221.673) (-1220.980) [-1221.304] (-1222.091) * (-1225.933) (-1223.597) [-1222.192] (-1221.804) -- 0:00:55
350000 -- (-1227.486) (-1222.022) (-1222.690) [-1220.970] * [-1223.390] (-1223.797) (-1224.058) (-1222.401) -- 0:00:55
Average standard deviation of split frequencies: 0.008318
350500 -- (-1224.302) [-1220.872] (-1223.503) (-1220.959) * [-1221.306] (-1221.426) (-1225.248) (-1221.714) -- 0:00:55
351000 -- (-1223.879) (-1221.104) [-1223.521] (-1222.354) * (-1221.473) (-1221.702) (-1227.105) [-1221.714] -- 0:00:55
351500 -- (-1222.468) (-1221.869) [-1222.155] (-1221.713) * (-1222.166) (-1222.311) (-1228.053) [-1224.594] -- 0:00:55
352000 -- (-1223.479) [-1221.527] (-1229.204) (-1220.770) * [-1221.702] (-1222.116) (-1230.958) (-1224.040) -- 0:00:55
352500 -- (-1226.375) (-1221.627) [-1227.160] (-1225.251) * [-1223.152] (-1223.103) (-1224.135) (-1223.175) -- 0:00:55
353000 -- (-1227.101) [-1222.616] (-1228.437) (-1225.978) * (-1223.884) (-1224.559) [-1223.972] (-1222.436) -- 0:00:54
353500 -- (-1226.041) (-1222.377) [-1229.097] (-1223.229) * [-1223.122] (-1224.219) (-1223.982) (-1223.015) -- 0:00:54
354000 -- (-1221.407) (-1223.606) (-1223.414) [-1221.826] * (-1225.464) [-1224.473] (-1222.759) (-1227.292) -- 0:00:54
354500 -- (-1221.504) (-1227.916) (-1223.225) [-1221.636] * (-1223.119) (-1226.160) [-1222.895] (-1227.839) -- 0:00:54
355000 -- (-1221.156) (-1224.805) [-1221.392] (-1221.859) * [-1225.500] (-1222.859) (-1222.510) (-1226.317) -- 0:00:54
Average standard deviation of split frequencies: 0.008524
355500 -- (-1222.058) (-1225.322) [-1221.343] (-1223.243) * (-1222.854) (-1221.529) [-1221.378] (-1228.573) -- 0:00:54
356000 -- (-1223.058) (-1223.770) (-1221.049) [-1222.533] * (-1227.392) [-1223.626] (-1221.245) (-1226.122) -- 0:00:56
356500 -- [-1222.225] (-1221.624) (-1221.402) (-1221.727) * (-1222.033) (-1221.333) [-1222.432] (-1222.574) -- 0:00:55
357000 -- (-1222.235) [-1223.254] (-1221.680) (-1222.205) * (-1221.144) (-1221.901) (-1224.946) [-1224.969] -- 0:00:55
357500 -- (-1222.294) (-1225.131) [-1222.775] (-1222.094) * [-1221.141] (-1221.827) (-1225.553) (-1223.736) -- 0:00:55
358000 -- (-1221.614) (-1221.912) [-1224.376] (-1222.435) * (-1223.840) (-1223.455) (-1223.374) [-1224.297] -- 0:00:55
358500 -- (-1223.301) (-1223.137) (-1223.077) [-1221.163] * [-1221.907] (-1224.549) (-1222.199) (-1225.026) -- 0:00:55
359000 -- (-1224.382) [-1223.875] (-1224.000) (-1222.292) * (-1223.740) (-1222.865) (-1221.168) [-1225.142] -- 0:00:55
359500 -- (-1221.067) (-1222.861) [-1222.275] (-1221.128) * (-1222.015) [-1222.784] (-1221.130) (-1223.623) -- 0:00:55
360000 -- (-1225.843) (-1223.415) (-1222.942) [-1224.808] * (-1223.654) (-1221.749) [-1221.805] (-1227.008) -- 0:00:55
Average standard deviation of split frequencies: 0.008251
360500 -- [-1227.210] (-1221.190) (-1223.282) (-1221.378) * [-1223.681] (-1221.201) (-1220.719) (-1222.944) -- 0:00:54
361000 -- [-1222.122] (-1221.070) (-1222.324) (-1223.515) * (-1223.573) (-1221.007) [-1221.348] (-1227.270) -- 0:00:54
361500 -- (-1221.958) [-1223.201] (-1220.564) (-1222.999) * (-1222.941) [-1221.585] (-1222.541) (-1226.197) -- 0:00:54
362000 -- (-1224.920) (-1221.343) [-1220.907] (-1220.975) * (-1221.535) (-1221.751) [-1223.070] (-1225.846) -- 0:00:54
362500 -- [-1222.948] (-1221.283) (-1223.515) (-1222.399) * (-1221.334) (-1221.859) (-1225.496) [-1222.319] -- 0:00:54
363000 -- [-1222.978] (-1221.510) (-1223.419) (-1223.765) * (-1220.548) [-1221.516] (-1224.288) (-1224.959) -- 0:00:54
363500 -- [-1223.737] (-1221.545) (-1221.820) (-1225.098) * [-1222.847] (-1221.721) (-1224.231) (-1230.561) -- 0:00:54
364000 -- (-1222.819) (-1221.460) (-1224.351) [-1222.497] * (-1222.280) [-1224.335] (-1225.618) (-1223.226) -- 0:00:54
364500 -- (-1224.134) (-1221.081) [-1223.431] (-1224.460) * (-1220.614) (-1226.273) (-1226.562) [-1223.278] -- 0:00:54
365000 -- (-1220.937) [-1220.963] (-1222.261) (-1224.792) * [-1222.545] (-1221.557) (-1222.758) (-1223.488) -- 0:00:53
Average standard deviation of split frequencies: 0.008940
365500 -- [-1221.439] (-1222.938) (-1224.908) (-1225.164) * (-1222.127) [-1222.472] (-1225.079) (-1222.486) -- 0:00:53
366000 -- (-1226.320) (-1221.811) [-1222.479] (-1223.877) * [-1223.849] (-1223.186) (-1225.222) (-1222.345) -- 0:00:53
366500 -- [-1222.308] (-1227.037) (-1221.631) (-1224.749) * (-1223.722) (-1222.631) [-1224.329] (-1221.573) -- 0:00:53
367000 -- (-1220.924) (-1222.654) (-1221.668) [-1223.184] * (-1224.777) [-1225.814] (-1225.269) (-1221.321) -- 0:00:53
367500 -- [-1222.414] (-1223.216) (-1221.919) (-1224.508) * (-1223.948) (-1228.319) (-1224.499) [-1221.294] -- 0:00:53
368000 -- (-1224.006) (-1225.059) (-1222.331) [-1221.888] * (-1221.932) (-1224.898) [-1225.142] (-1221.668) -- 0:00:54
368500 -- (-1222.126) (-1223.690) [-1222.616] (-1221.786) * (-1225.115) (-1224.794) [-1225.022] (-1224.836) -- 0:00:54
369000 -- (-1221.611) (-1223.365) [-1220.900] (-1224.894) * (-1223.295) (-1224.315) [-1220.626] (-1222.446) -- 0:00:54
369500 -- (-1223.625) (-1223.355) [-1220.975] (-1221.569) * (-1223.322) [-1224.525] (-1220.514) (-1222.721) -- 0:00:54
370000 -- (-1223.396) (-1222.122) (-1221.513) [-1222.053] * [-1221.381] (-1223.699) (-1220.513) (-1222.716) -- 0:00:54
Average standard deviation of split frequencies: 0.009052
370500 -- (-1227.297) (-1220.966) [-1222.325] (-1222.052) * (-1221.458) (-1225.037) [-1220.684] (-1223.568) -- 0:00:54
371000 -- (-1227.598) [-1220.991] (-1222.398) (-1221.126) * [-1222.802] (-1223.835) (-1221.199) (-1222.373) -- 0:00:54
371500 -- (-1222.728) [-1221.839] (-1221.230) (-1222.744) * (-1223.378) (-1221.009) (-1233.608) [-1221.887] -- 0:00:54
372000 -- (-1222.300) (-1221.910) [-1221.280] (-1221.729) * (-1222.534) (-1221.444) [-1224.549] (-1222.616) -- 0:00:54
372500 -- [-1222.816] (-1226.181) (-1222.722) (-1223.036) * (-1222.372) [-1220.752] (-1225.122) (-1226.425) -- 0:00:53
373000 -- [-1222.756] (-1224.892) (-1222.078) (-1225.006) * (-1222.297) (-1220.916) (-1222.962) [-1222.624] -- 0:00:53
373500 -- (-1221.442) (-1223.484) (-1222.034) [-1222.929] * [-1222.240] (-1225.937) (-1223.651) (-1220.941) -- 0:00:53
374000 -- (-1223.403) (-1222.982) [-1223.942] (-1223.793) * (-1223.669) (-1225.276) (-1224.292) [-1225.329] -- 0:00:53
374500 -- [-1224.140] (-1222.143) (-1229.051) (-1225.647) * [-1223.619] (-1222.543) (-1229.364) (-1225.754) -- 0:00:53
375000 -- (-1224.779) [-1221.871] (-1227.309) (-1222.456) * (-1224.483) (-1221.168) (-1222.110) [-1225.798] -- 0:00:53
Average standard deviation of split frequencies: 0.008228
375500 -- (-1223.842) [-1225.454] (-1229.123) (-1223.228) * (-1224.127) [-1222.094] (-1223.344) (-1225.724) -- 0:00:53
376000 -- [-1223.460] (-1226.202) (-1227.145) (-1223.815) * (-1222.343) (-1223.409) (-1223.708) [-1223.762] -- 0:00:53
376500 -- [-1221.779] (-1223.399) (-1225.704) (-1225.027) * (-1225.688) [-1224.651] (-1222.498) (-1222.611) -- 0:00:52
377000 -- (-1222.639) (-1223.362) [-1223.540] (-1225.657) * (-1228.494) [-1223.429] (-1220.740) (-1222.653) -- 0:00:52
377500 -- (-1225.010) (-1224.476) [-1223.586] (-1222.258) * (-1226.819) (-1222.714) (-1221.460) [-1222.350] -- 0:00:52
378000 -- (-1224.992) (-1224.144) (-1225.319) [-1222.034] * (-1223.534) (-1221.608) (-1221.869) [-1221.671] -- 0:00:52
378500 -- (-1224.517) (-1224.213) [-1221.004] (-1223.822) * (-1223.756) (-1223.862) (-1222.121) [-1222.740] -- 0:00:52
379000 -- (-1226.154) (-1221.550) [-1221.152] (-1223.926) * (-1226.531) (-1225.066) [-1222.192] (-1222.271) -- 0:00:52
379500 -- (-1222.954) [-1223.073] (-1221.100) (-1226.195) * [-1224.147] (-1223.502) (-1222.534) (-1222.154) -- 0:00:53
380000 -- (-1222.669) (-1224.664) (-1221.524) [-1225.248] * [-1223.485] (-1223.263) (-1224.687) (-1222.532) -- 0:00:53
Average standard deviation of split frequencies: 0.009210
380500 -- [-1221.651] (-1223.417) (-1220.713) (-1221.631) * (-1223.470) (-1225.783) [-1224.214] (-1223.212) -- 0:00:53
381000 -- (-1221.696) (-1220.859) [-1221.253] (-1221.540) * (-1223.815) (-1228.261) (-1222.979) [-1223.319] -- 0:00:53
381500 -- (-1221.619) (-1223.588) (-1221.647) [-1223.464] * (-1222.876) (-1225.421) (-1230.057) [-1222.728] -- 0:00:53
382000 -- (-1224.053) (-1221.318) [-1224.157] (-1223.691) * (-1225.833) (-1223.540) (-1226.076) [-1222.758] -- 0:00:53
382500 -- (-1224.890) [-1221.627] (-1220.989) (-1222.598) * (-1221.230) (-1221.448) [-1226.339] (-1224.296) -- 0:00:53
383000 -- [-1225.582] (-1223.847) (-1221.866) (-1222.353) * (-1222.271) (-1222.565) [-1222.115] (-1221.722) -- 0:00:53
383500 -- (-1225.425) (-1222.602) [-1222.809] (-1222.660) * (-1222.361) (-1223.093) (-1222.360) [-1222.134] -- 0:00:53
384000 -- (-1224.678) (-1222.886) [-1222.580] (-1221.557) * (-1222.691) (-1223.108) (-1221.858) [-1221.546] -- 0:00:52
384500 -- [-1224.531] (-1221.184) (-1223.550) (-1223.075) * [-1222.399] (-1221.967) (-1221.705) (-1222.278) -- 0:00:52
385000 -- (-1222.729) (-1222.006) [-1222.776] (-1224.241) * (-1227.459) (-1223.891) [-1221.658] (-1222.990) -- 0:00:52
Average standard deviation of split frequencies: 0.008692
385500 -- [-1224.737] (-1221.338) (-1224.632) (-1224.447) * (-1224.952) (-1223.510) (-1222.924) [-1222.717] -- 0:00:52
386000 -- (-1227.184) (-1221.701) [-1222.721] (-1226.627) * (-1227.485) (-1226.020) [-1221.317] (-1225.256) -- 0:00:52
386500 -- (-1222.945) (-1221.821) [-1222.687] (-1224.050) * (-1225.504) (-1224.313) (-1221.139) [-1222.930] -- 0:00:52
387000 -- (-1222.323) (-1222.355) (-1221.858) [-1224.174] * (-1229.756) (-1221.941) (-1221.454) [-1222.905] -- 0:00:52
387500 -- (-1225.271) (-1220.980) (-1221.624) [-1222.386] * [-1221.271] (-1221.881) (-1221.176) (-1229.370) -- 0:00:52
388000 -- (-1230.043) [-1222.024] (-1223.341) (-1223.745) * (-1222.028) (-1222.226) [-1223.107] (-1225.026) -- 0:00:52
388500 -- (-1221.969) [-1220.989] (-1221.975) (-1222.528) * (-1221.436) (-1224.486) [-1221.158] (-1224.562) -- 0:00:51
389000 -- (-1226.084) [-1221.948] (-1225.568) (-1222.385) * (-1222.322) [-1223.016] (-1222.644) (-1224.521) -- 0:00:51
389500 -- (-1226.261) [-1222.914] (-1225.987) (-1224.886) * [-1223.701] (-1222.835) (-1225.153) (-1223.386) -- 0:00:51
390000 -- (-1224.907) [-1222.865] (-1225.675) (-1225.207) * (-1225.513) [-1222.942] (-1221.660) (-1225.752) -- 0:00:51
Average standard deviation of split frequencies: 0.008518
390500 -- [-1223.084] (-1222.079) (-1221.833) (-1225.669) * (-1221.453) [-1222.656] (-1221.418) (-1223.263) -- 0:00:51
391000 -- [-1221.737] (-1226.994) (-1222.921) (-1223.786) * (-1222.073) (-1226.289) (-1223.822) [-1222.368] -- 0:00:52
391500 -- (-1222.529) (-1221.034) [-1224.417] (-1224.903) * (-1223.954) [-1224.067] (-1222.479) (-1223.092) -- 0:00:52
392000 -- (-1221.839) (-1222.961) [-1223.619] (-1223.897) * (-1222.953) [-1225.663] (-1224.614) (-1220.926) -- 0:00:52
392500 -- (-1223.336) (-1221.065) [-1223.065] (-1222.182) * [-1223.204] (-1221.213) (-1223.459) (-1221.548) -- 0:00:52
393000 -- (-1226.318) (-1224.582) (-1222.496) [-1222.626] * (-1225.600) [-1221.227] (-1224.588) (-1226.635) -- 0:00:52
393500 -- (-1222.643) [-1221.829] (-1226.299) (-1221.849) * (-1225.080) (-1222.702) (-1228.727) [-1225.734] -- 0:00:52
394000 -- (-1223.138) (-1222.465) (-1226.788) [-1222.278] * [-1222.379] (-1222.698) (-1226.338) (-1223.738) -- 0:00:52
394500 -- (-1224.887) (-1222.147) [-1224.573] (-1225.922) * (-1224.797) (-1222.937) [-1222.095] (-1224.031) -- 0:00:52
395000 -- (-1223.455) (-1222.333) [-1224.010] (-1221.081) * [-1223.371] (-1224.768) (-1223.700) (-1223.838) -- 0:00:52
Average standard deviation of split frequencies: 0.008053
395500 -- (-1224.916) (-1226.482) (-1225.172) [-1222.130] * [-1222.846] (-1223.209) (-1224.680) (-1221.691) -- 0:00:51
396000 -- (-1223.287) (-1226.482) [-1226.061] (-1221.807) * (-1221.297) (-1223.253) [-1222.323] (-1220.571) -- 0:00:51
396500 -- (-1225.399) [-1222.718] (-1222.573) (-1225.281) * (-1223.282) (-1222.223) (-1221.052) [-1221.655] -- 0:00:51
397000 -- [-1223.814] (-1222.712) (-1222.396) (-1225.540) * (-1223.186) [-1224.201] (-1221.044) (-1225.550) -- 0:00:51
397500 -- (-1223.590) [-1223.094] (-1221.903) (-1221.373) * (-1223.269) [-1222.444] (-1221.613) (-1221.767) -- 0:00:51
398000 -- (-1221.794) (-1224.365) [-1221.645] (-1224.462) * [-1224.228] (-1224.609) (-1221.613) (-1220.656) -- 0:00:51
398500 -- (-1223.079) (-1222.409) (-1224.492) [-1223.539] * (-1222.205) (-1221.014) [-1222.420] (-1222.173) -- 0:00:51
399000 -- (-1221.344) [-1221.367] (-1221.801) (-1221.487) * (-1226.524) [-1222.973] (-1224.943) (-1222.364) -- 0:00:51
399500 -- (-1222.043) [-1221.723] (-1224.570) (-1223.724) * (-1224.341) [-1220.882] (-1227.446) (-1221.415) -- 0:00:51
400000 -- [-1221.435] (-1221.721) (-1223.050) (-1222.625) * (-1224.006) [-1224.148] (-1222.356) (-1221.179) -- 0:00:51
Average standard deviation of split frequencies: 0.008374
400500 -- (-1221.409) [-1224.701] (-1220.818) (-1222.989) * (-1221.962) (-1223.398) (-1221.696) [-1221.972] -- 0:00:50
401000 -- (-1221.335) (-1226.419) [-1221.389] (-1223.224) * (-1221.897) (-1225.349) (-1222.300) [-1224.567] -- 0:00:50
401500 -- (-1223.173) (-1222.452) [-1223.909] (-1221.352) * (-1224.711) [-1225.629] (-1221.023) (-1221.091) -- 0:00:50
402000 -- (-1224.829) (-1224.156) (-1224.849) [-1223.771] * (-1223.586) (-1224.701) (-1222.950) [-1221.095] -- 0:00:50
402500 -- (-1223.231) (-1221.763) (-1227.986) [-1223.975] * [-1220.966] (-1221.347) (-1222.437) (-1221.166) -- 0:00:50
403000 -- [-1221.816] (-1223.406) (-1223.868) (-1222.993) * (-1221.631) [-1222.304] (-1222.949) (-1222.642) -- 0:00:51
403500 -- (-1223.504) [-1221.562] (-1220.974) (-1220.657) * (-1227.038) [-1223.125] (-1222.308) (-1220.918) -- 0:00:51
404000 -- [-1225.563] (-1226.050) (-1222.938) (-1223.909) * (-1221.433) [-1224.054] (-1223.024) (-1221.908) -- 0:00:51
404500 -- (-1222.752) [-1226.384] (-1221.470) (-1224.317) * (-1220.890) (-1224.054) [-1225.251] (-1224.230) -- 0:00:51
405000 -- (-1225.856) (-1223.563) (-1221.495) [-1224.134] * (-1222.286) (-1226.945) (-1225.443) [-1225.617] -- 0:00:51
Average standard deviation of split frequencies: 0.008537
405500 -- [-1223.259] (-1225.015) (-1220.770) (-1222.881) * (-1221.509) (-1221.972) (-1222.688) [-1222.729] -- 0:00:51
406000 -- (-1221.516) (-1223.193) (-1222.585) [-1223.019] * (-1223.717) (-1223.053) (-1222.956) [-1221.795] -- 0:00:51
406500 -- (-1227.117) (-1225.133) [-1221.723] (-1221.606) * [-1229.831] (-1222.350) (-1223.599) (-1222.695) -- 0:00:51
407000 -- (-1226.143) (-1225.978) [-1222.445] (-1223.128) * (-1225.164) (-1223.511) [-1224.595] (-1223.166) -- 0:00:50
407500 -- (-1224.784) (-1226.612) [-1220.907] (-1221.511) * (-1222.354) [-1224.470] (-1224.238) (-1221.828) -- 0:00:50
408000 -- (-1221.723) [-1223.890] (-1225.185) (-1221.370) * [-1221.956] (-1222.054) (-1223.916) (-1225.325) -- 0:00:50
408500 -- [-1220.498] (-1227.016) (-1224.970) (-1223.044) * [-1223.425] (-1222.727) (-1223.084) (-1223.634) -- 0:00:50
409000 -- (-1225.173) (-1223.734) (-1222.235) [-1222.950] * (-1221.153) (-1223.496) [-1221.050] (-1221.664) -- 0:00:50
409500 -- (-1221.672) [-1222.368] (-1221.877) (-1228.272) * (-1221.686) (-1224.760) (-1224.463) [-1221.256] -- 0:00:50
410000 -- (-1226.428) (-1225.132) [-1226.390] (-1225.448) * [-1221.945] (-1222.513) (-1223.059) (-1224.120) -- 0:00:50
Average standard deviation of split frequencies: 0.007765
410500 -- (-1226.404) (-1224.171) [-1225.447] (-1224.902) * (-1228.881) (-1223.076) [-1221.070] (-1223.919) -- 0:00:50
411000 -- (-1225.619) [-1220.980] (-1222.066) (-1222.679) * (-1223.988) [-1224.053] (-1222.178) (-1222.226) -- 0:00:50
411500 -- (-1221.864) (-1221.557) [-1221.947] (-1223.860) * [-1224.965] (-1223.005) (-1220.956) (-1223.711) -- 0:00:50
412000 -- (-1222.635) (-1222.230) (-1221.868) [-1223.916] * (-1220.996) (-1224.771) (-1220.922) [-1223.767] -- 0:00:49
412500 -- (-1221.039) (-1222.060) [-1221.331] (-1222.521) * (-1224.821) (-1222.077) (-1221.341) [-1223.123] -- 0:00:49
413000 -- (-1224.257) (-1223.480) [-1221.940] (-1222.462) * (-1225.292) (-1225.428) (-1221.756) [-1221.276] -- 0:00:49
413500 -- [-1221.918] (-1227.053) (-1222.460) (-1221.545) * (-1223.932) (-1225.213) (-1221.292) [-1221.758] -- 0:00:49
414000 -- (-1220.781) [-1222.682] (-1221.687) (-1221.724) * [-1222.711] (-1222.761) (-1221.690) (-1222.998) -- 0:00:49
414500 -- [-1220.989] (-1224.971) (-1220.833) (-1223.669) * (-1222.270) (-1222.729) (-1222.347) [-1221.843] -- 0:00:49
415000 -- (-1221.801) [-1221.469] (-1220.829) (-1225.292) * (-1221.366) (-1223.186) [-1222.162] (-1221.133) -- 0:00:50
Average standard deviation of split frequencies: 0.007799
415500 -- (-1225.007) (-1222.501) [-1221.437] (-1223.855) * [-1225.909] (-1224.936) (-1220.885) (-1220.800) -- 0:00:50
416000 -- (-1222.529) (-1221.422) [-1221.709] (-1223.740) * (-1225.259) (-1222.246) (-1225.207) [-1224.561] -- 0:00:50
416500 -- [-1223.914] (-1225.303) (-1221.902) (-1226.454) * [-1222.157] (-1222.616) (-1221.880) (-1226.364) -- 0:00:50
417000 -- (-1223.083) [-1221.975] (-1222.278) (-1231.274) * (-1222.482) (-1222.444) (-1226.340) [-1224.670] -- 0:00:50
417500 -- [-1224.006] (-1224.648) (-1221.071) (-1223.263) * [-1222.647] (-1221.482) (-1224.700) (-1226.291) -- 0:00:50
418000 -- (-1223.216) (-1223.964) [-1225.634] (-1222.671) * (-1222.246) (-1225.524) [-1224.007] (-1221.842) -- 0:00:50
418500 -- [-1224.156] (-1222.190) (-1222.529) (-1222.828) * (-1221.388) (-1222.667) (-1221.727) [-1221.505] -- 0:00:50
419000 -- (-1221.352) (-1225.861) [-1224.044] (-1222.191) * (-1222.027) (-1222.782) (-1224.719) [-1221.431] -- 0:00:49
419500 -- [-1221.297] (-1225.910) (-1222.071) (-1223.395) * (-1221.176) (-1223.761) [-1222.508] (-1221.359) -- 0:00:49
420000 -- (-1221.367) (-1224.612) [-1223.664] (-1222.625) * [-1223.726] (-1222.738) (-1224.619) (-1226.626) -- 0:00:49
Average standard deviation of split frequencies: 0.006987
420500 -- (-1222.374) (-1221.634) [-1225.252] (-1223.522) * (-1226.638) [-1224.135] (-1222.392) (-1222.152) -- 0:00:49
421000 -- (-1222.622) (-1224.980) (-1225.534) [-1223.328] * (-1221.358) (-1222.639) [-1221.869] (-1223.436) -- 0:00:49
421500 -- [-1222.820] (-1223.889) (-1226.988) (-1223.890) * (-1220.991) [-1222.744] (-1221.238) (-1223.959) -- 0:00:49
422000 -- (-1224.252) (-1221.029) (-1229.656) [-1226.906] * (-1224.077) (-1223.234) [-1223.353] (-1221.322) -- 0:00:49
422500 -- (-1222.868) (-1222.132) (-1232.147) [-1222.405] * (-1224.299) (-1223.823) (-1222.494) [-1222.376] -- 0:00:49
423000 -- (-1221.798) (-1224.400) (-1224.646) [-1221.832] * (-1224.299) [-1223.745] (-1223.803) (-1221.845) -- 0:00:49
423500 -- [-1222.669] (-1223.303) (-1221.111) (-1222.927) * [-1224.329] (-1221.449) (-1227.643) (-1226.042) -- 0:00:49
424000 -- (-1223.484) (-1222.808) [-1221.895] (-1223.522) * (-1222.777) [-1225.331] (-1221.195) (-1222.557) -- 0:00:48
424500 -- (-1221.797) [-1220.627] (-1221.073) (-1222.874) * [-1225.236] (-1222.270) (-1224.180) (-1221.732) -- 0:00:48
425000 -- (-1226.002) [-1221.838] (-1221.290) (-1223.040) * (-1222.548) (-1223.181) [-1222.116] (-1222.663) -- 0:00:48
Average standard deviation of split frequencies: 0.006770
425500 -- (-1222.128) (-1223.228) (-1221.521) [-1221.746] * (-1220.938) [-1221.577] (-1224.565) (-1221.883) -- 0:00:48
426000 -- (-1226.437) [-1222.197] (-1221.905) (-1224.893) * (-1221.507) (-1221.655) (-1222.239) [-1224.008] -- 0:00:48
426500 -- [-1222.307] (-1222.333) (-1225.602) (-1226.669) * (-1224.789) (-1221.305) [-1222.335] (-1223.480) -- 0:00:49
427000 -- [-1223.036] (-1221.163) (-1222.682) (-1223.205) * (-1222.795) (-1222.581) [-1222.353] (-1222.272) -- 0:00:49
427500 -- (-1222.764) (-1221.335) (-1222.559) [-1222.028] * [-1223.325] (-1222.514) (-1221.510) (-1223.069) -- 0:00:49
428000 -- (-1223.634) [-1220.981] (-1222.294) (-1222.140) * [-1224.925] (-1223.693) (-1224.531) (-1220.633) -- 0:00:49
428500 -- (-1221.822) (-1221.875) [-1224.185] (-1222.108) * (-1222.398) [-1224.265] (-1223.514) (-1222.723) -- 0:00:49
429000 -- (-1222.287) (-1225.469) (-1222.286) [-1221.825] * (-1223.597) (-1226.386) [-1224.145] (-1222.041) -- 0:00:49
429500 -- (-1221.227) (-1224.333) [-1222.889] (-1223.804) * (-1222.712) (-1221.242) (-1221.918) [-1221.502] -- 0:00:49
430000 -- (-1221.253) (-1225.228) [-1223.002] (-1224.389) * (-1221.795) (-1221.440) (-1224.391) [-1224.356] -- 0:00:49
Average standard deviation of split frequencies: 0.007083
430500 -- (-1220.765) [-1223.595] (-1221.705) (-1220.669) * (-1224.463) (-1224.610) [-1227.421] (-1232.953) -- 0:00:48
431000 -- (-1221.205) (-1223.997) (-1222.954) [-1221.559] * [-1222.287] (-1221.540) (-1226.543) (-1226.004) -- 0:00:48
431500 -- [-1221.924] (-1221.599) (-1222.385) (-1221.206) * (-1222.864) [-1221.383] (-1226.066) (-1222.363) -- 0:00:48
432000 -- [-1222.314] (-1221.981) (-1224.316) (-1221.068) * (-1224.237) (-1221.662) [-1223.335] (-1222.118) -- 0:00:48
432500 -- [-1221.956] (-1224.737) (-1225.596) (-1222.502) * (-1223.386) [-1224.858] (-1220.844) (-1228.607) -- 0:00:48
433000 -- [-1221.974] (-1225.775) (-1222.052) (-1221.744) * [-1222.041] (-1222.397) (-1221.929) (-1226.024) -- 0:00:48
433500 -- (-1222.568) (-1221.738) (-1223.722) [-1221.310] * (-1222.706) [-1223.025] (-1222.867) (-1225.139) -- 0:00:48
434000 -- (-1224.373) (-1221.188) (-1224.158) [-1222.895] * (-1226.823) (-1224.493) [-1221.307] (-1224.617) -- 0:00:48
434500 -- [-1226.839] (-1229.504) (-1223.001) (-1223.485) * (-1221.505) [-1220.787] (-1221.464) (-1224.566) -- 0:00:48
435000 -- [-1223.614] (-1221.238) (-1226.786) (-1220.943) * (-1225.359) [-1224.908] (-1224.436) (-1222.704) -- 0:00:48
Average standard deviation of split frequencies: 0.006551
435500 -- (-1225.665) [-1224.963] (-1224.946) (-1221.053) * (-1225.729) (-1222.010) (-1223.807) [-1221.392] -- 0:00:47
436000 -- (-1224.840) (-1221.961) [-1222.179] (-1221.826) * (-1223.673) (-1220.556) [-1221.987] (-1228.499) -- 0:00:47
436500 -- (-1223.543) (-1221.784) (-1223.548) [-1222.961] * (-1223.894) (-1223.236) [-1221.842] (-1226.045) -- 0:00:47
437000 -- (-1226.407) (-1224.765) (-1224.610) [-1222.677] * [-1223.504] (-1224.870) (-1225.042) (-1222.774) -- 0:00:47
437500 -- [-1223.323] (-1221.470) (-1222.427) (-1223.526) * (-1225.017) (-1221.813) [-1224.553] (-1221.888) -- 0:00:47
438000 -- (-1224.377) (-1221.837) (-1224.222) [-1222.775] * [-1222.762] (-1223.350) (-1225.788) (-1225.170) -- 0:00:48
438500 -- (-1222.851) (-1221.402) (-1226.608) [-1220.976] * (-1223.331) (-1223.842) (-1224.969) [-1223.178] -- 0:00:48
439000 -- (-1222.031) (-1221.055) (-1224.629) [-1223.013] * (-1225.833) (-1223.439) (-1224.219) [-1221.485] -- 0:00:48
439500 -- (-1223.008) (-1222.518) (-1221.105) [-1221.294] * [-1228.539] (-1222.062) (-1222.246) (-1222.753) -- 0:00:48
440000 -- (-1224.032) (-1222.036) (-1222.236) [-1220.633] * [-1229.622] (-1223.576) (-1224.396) (-1223.126) -- 0:00:48
Average standard deviation of split frequencies: 0.005482
440500 -- [-1224.567] (-1222.714) (-1222.262) (-1221.796) * (-1222.730) (-1230.188) [-1222.684] (-1223.714) -- 0:00:48
441000 -- (-1227.164) [-1221.351] (-1222.765) (-1221.693) * (-1223.224) [-1226.236] (-1222.909) (-1221.219) -- 0:00:48
441500 -- [-1222.285] (-1224.517) (-1222.589) (-1221.708) * [-1223.076] (-1226.291) (-1220.868) (-1222.582) -- 0:00:48
442000 -- (-1224.479) [-1222.240] (-1221.352) (-1221.538) * (-1222.207) (-1223.510) [-1220.976] (-1222.898) -- 0:00:47
442500 -- (-1221.642) [-1220.798] (-1222.431) (-1221.536) * (-1224.309) (-1223.434) (-1221.829) [-1224.530] -- 0:00:47
443000 -- (-1221.333) [-1224.692] (-1222.552) (-1228.852) * (-1222.996) (-1221.012) [-1220.754] (-1220.693) -- 0:00:47
443500 -- (-1221.519) (-1222.047) [-1223.718] (-1223.932) * (-1222.784) [-1221.651] (-1221.888) (-1221.125) -- 0:00:47
444000 -- [-1222.265] (-1224.933) (-1223.938) (-1223.852) * (-1223.517) (-1221.346) [-1221.563] (-1221.481) -- 0:00:47
444500 -- (-1220.965) (-1224.058) [-1223.183] (-1221.174) * (-1223.839) (-1220.751) (-1222.851) [-1221.649] -- 0:00:47
445000 -- (-1225.076) (-1224.988) (-1223.889) [-1221.287] * [-1222.910] (-1223.163) (-1222.402) (-1222.506) -- 0:00:47
Average standard deviation of split frequencies: 0.005285
445500 -- (-1223.247) [-1222.542] (-1224.421) (-1222.133) * (-1224.579) (-1220.778) (-1222.241) [-1224.749] -- 0:00:47
446000 -- (-1223.130) [-1221.572] (-1223.743) (-1221.179) * (-1223.826) (-1222.168) [-1222.791] (-1222.076) -- 0:00:47
446500 -- [-1222.436] (-1222.555) (-1223.145) (-1221.168) * (-1223.683) [-1222.113] (-1222.113) (-1221.323) -- 0:00:47
447000 -- [-1221.594] (-1223.747) (-1222.025) (-1222.282) * (-1223.415) (-1221.302) [-1221.336] (-1221.280) -- 0:00:47
447500 -- (-1222.474) [-1222.041] (-1222.529) (-1221.325) * [-1223.381] (-1222.576) (-1221.372) (-1222.564) -- 0:00:46
448000 -- (-1223.029) (-1223.511) [-1221.470] (-1221.489) * (-1220.837) [-1221.527] (-1221.376) (-1223.481) -- 0:00:46
448500 -- (-1221.199) (-1225.239) [-1222.600] (-1221.247) * (-1221.121) (-1221.318) (-1222.766) [-1221.434] -- 0:00:46
449000 -- [-1221.685] (-1224.473) (-1222.723) (-1224.196) * (-1221.540) (-1221.342) (-1224.564) [-1220.832] -- 0:00:46
449500 -- (-1223.034) (-1224.884) [-1222.146] (-1224.542) * (-1223.853) (-1224.379) (-1225.808) [-1222.925] -- 0:00:47
450000 -- [-1223.082] (-1223.098) (-1222.621) (-1223.966) * (-1222.156) (-1224.436) (-1222.600) [-1221.125] -- 0:00:47
Average standard deviation of split frequencies: 0.005784
450500 -- (-1222.785) (-1227.299) (-1224.014) [-1222.681] * (-1222.041) (-1221.957) [-1225.995] (-1223.503) -- 0:00:47
451000 -- (-1224.639) (-1224.381) (-1221.436) [-1226.936] * (-1221.775) [-1222.209] (-1223.833) (-1220.840) -- 0:00:47
451500 -- (-1221.365) (-1225.384) (-1221.225) [-1221.786] * (-1226.390) (-1227.253) [-1224.415] (-1221.770) -- 0:00:47
452000 -- [-1224.282] (-1226.873) (-1224.265) (-1222.613) * [-1223.885] (-1221.716) (-1223.623) (-1223.479) -- 0:00:47
452500 -- (-1223.431) [-1225.701] (-1222.141) (-1223.705) * (-1223.194) [-1221.679] (-1224.150) (-1223.410) -- 0:00:47
453000 -- (-1223.636) [-1221.453] (-1222.578) (-1224.347) * (-1222.989) [-1222.224] (-1222.271) (-1223.398) -- 0:00:47
453500 -- (-1228.948) [-1223.375] (-1225.413) (-1221.676) * (-1223.114) (-1222.325) [-1223.848] (-1224.973) -- 0:00:46
454000 -- (-1227.396) (-1222.734) [-1221.930] (-1224.484) * (-1222.616) [-1220.960] (-1231.027) (-1226.883) -- 0:00:46
454500 -- (-1220.875) [-1222.038] (-1222.317) (-1223.147) * (-1220.990) (-1223.196) [-1224.628] (-1221.742) -- 0:00:46
455000 -- (-1223.038) (-1223.844) (-1224.355) [-1221.689] * (-1221.563) (-1221.836) [-1222.720] (-1221.690) -- 0:00:46
Average standard deviation of split frequencies: 0.005716
455500 -- (-1224.370) [-1220.852] (-1223.412) (-1223.274) * (-1223.145) (-1223.221) [-1222.403] (-1221.387) -- 0:00:46
456000 -- (-1222.147) [-1227.200] (-1224.267) (-1224.068) * (-1225.527) (-1227.437) [-1222.668] (-1221.154) -- 0:00:46
456500 -- (-1224.072) (-1222.662) [-1223.550] (-1223.969) * (-1230.752) (-1226.247) [-1222.155] (-1221.154) -- 0:00:46
457000 -- (-1226.482) (-1221.713) [-1222.064] (-1224.996) * (-1222.974) [-1222.295] (-1222.698) (-1221.080) -- 0:00:46
457500 -- [-1221.630] (-1221.777) (-1222.298) (-1226.992) * [-1222.809] (-1223.202) (-1220.924) (-1221.663) -- 0:00:46
458000 -- (-1222.448) (-1222.464) [-1220.586] (-1220.889) * (-1223.278) [-1222.270] (-1220.924) (-1223.384) -- 0:00:46
458500 -- [-1226.234] (-1221.458) (-1230.548) (-1226.065) * (-1225.532) (-1221.977) [-1221.106] (-1227.055) -- 0:00:46
459000 -- (-1226.039) [-1221.608] (-1222.078) (-1224.340) * (-1223.818) (-1221.108) [-1221.591] (-1224.422) -- 0:00:45
459500 -- (-1222.282) (-1225.651) (-1221.684) [-1223.330] * [-1226.810] (-1224.502) (-1224.561) (-1224.567) -- 0:00:45
460000 -- (-1222.783) [-1228.316] (-1223.411) (-1223.519) * [-1229.953] (-1227.586) (-1221.377) (-1222.774) -- 0:00:45
Average standard deviation of split frequencies: 0.006080
460500 -- (-1222.676) (-1221.506) [-1222.235] (-1224.653) * (-1224.140) [-1221.405] (-1222.543) (-1221.278) -- 0:00:45
461000 -- (-1221.672) (-1221.252) [-1221.352] (-1223.662) * [-1224.045] (-1221.590) (-1222.670) (-1223.340) -- 0:00:45
461500 -- (-1225.894) (-1222.877) [-1225.082] (-1223.756) * (-1223.124) (-1224.086) [-1225.270] (-1221.262) -- 0:00:46
462000 -- (-1224.889) (-1222.021) [-1221.247] (-1223.327) * (-1220.984) [-1222.560] (-1224.141) (-1224.549) -- 0:00:46
462500 -- (-1224.808) (-1221.991) (-1221.207) [-1225.967] * (-1221.961) [-1222.237] (-1227.011) (-1233.026) -- 0:00:46
463000 -- (-1223.298) (-1222.409) (-1221.265) [-1224.025] * (-1223.193) [-1223.806] (-1222.783) (-1225.253) -- 0:00:46
463500 -- (-1221.380) [-1223.072] (-1221.394) (-1221.115) * (-1224.644) [-1223.232] (-1224.096) (-1222.074) -- 0:00:46
464000 -- [-1225.952] (-1224.303) (-1223.500) (-1221.180) * (-1222.577) (-1226.879) [-1224.324] (-1223.882) -- 0:00:46
464500 -- [-1222.689] (-1223.180) (-1226.048) (-1223.410) * (-1223.989) (-1226.059) (-1222.099) [-1224.291] -- 0:00:46
465000 -- (-1227.097) (-1224.310) (-1228.726) [-1222.327] * (-1227.117) (-1223.168) [-1221.313] (-1226.912) -- 0:00:46
Average standard deviation of split frequencies: 0.004426
465500 -- (-1225.486) (-1221.727) [-1223.533] (-1222.723) * [-1221.721] (-1224.178) (-1223.914) (-1227.484) -- 0:00:45
466000 -- (-1221.245) (-1226.232) [-1222.697] (-1221.716) * (-1225.792) [-1223.017] (-1222.431) (-1222.562) -- 0:00:45
466500 -- [-1221.505] (-1222.878) (-1221.926) (-1221.370) * (-1224.484) [-1224.409] (-1222.109) (-1221.948) -- 0:00:45
467000 -- (-1223.616) (-1224.217) (-1224.679) [-1221.706] * (-1225.839) (-1223.438) (-1222.206) [-1222.219] -- 0:00:45
467500 -- (-1221.513) (-1228.101) (-1222.494) [-1222.150] * (-1223.456) (-1227.446) (-1226.806) [-1222.577] -- 0:00:45
468000 -- [-1224.563] (-1226.624) (-1221.514) (-1221.712) * (-1223.249) (-1225.090) [-1224.437] (-1221.090) -- 0:00:45
468500 -- [-1223.143] (-1225.121) (-1222.333) (-1221.582) * (-1223.319) (-1222.456) [-1224.719] (-1223.698) -- 0:00:45
469000 -- (-1226.856) (-1224.167) (-1221.905) [-1222.474] * (-1229.462) (-1221.742) [-1222.283] (-1223.098) -- 0:00:45
469500 -- (-1223.202) (-1223.234) [-1221.043] (-1220.732) * (-1225.966) (-1223.748) [-1222.846] (-1226.028) -- 0:00:45
470000 -- (-1226.055) [-1221.004] (-1223.024) (-1224.438) * (-1221.675) (-1224.709) [-1222.398] (-1225.213) -- 0:00:45
Average standard deviation of split frequencies: 0.006540
470500 -- [-1224.137] (-1224.910) (-1224.442) (-1222.454) * (-1224.132) (-1227.801) (-1223.738) [-1224.707] -- 0:00:45
471000 -- (-1225.367) (-1223.434) (-1222.590) [-1223.101] * (-1223.777) [-1224.177] (-1222.138) (-1226.276) -- 0:00:44
471500 -- (-1224.578) (-1222.424) (-1220.602) [-1224.564] * [-1224.199] (-1221.730) (-1221.623) (-1223.700) -- 0:00:44
472000 -- [-1224.092] (-1221.200) (-1222.420) (-1225.462) * (-1222.896) (-1226.102) (-1221.407) [-1221.097] -- 0:00:44
472500 -- (-1225.457) (-1222.944) (-1221.525) [-1222.028] * [-1221.791] (-1226.256) (-1221.060) (-1225.112) -- 0:00:44
473000 -- [-1224.276] (-1223.916) (-1221.119) (-1221.806) * (-1221.042) (-1231.859) (-1221.602) [-1221.477] -- 0:00:45
473500 -- (-1227.590) (-1224.164) (-1223.977) [-1224.460] * [-1222.931] (-1222.704) (-1224.563) (-1221.496) -- 0:00:45
474000 -- (-1224.559) [-1224.270] (-1224.688) (-1223.266) * (-1221.537) [-1221.645] (-1223.088) (-1220.886) -- 0:00:45
474500 -- (-1223.689) (-1225.949) (-1223.986) [-1223.334] * (-1221.311) [-1221.207] (-1221.555) (-1222.110) -- 0:00:45
475000 -- (-1226.632) [-1224.774] (-1222.602) (-1222.017) * [-1222.342] (-1222.327) (-1223.426) (-1222.882) -- 0:00:45
Average standard deviation of split frequencies: 0.006466
475500 -- (-1223.094) [-1222.570] (-1221.141) (-1224.892) * (-1222.508) (-1222.280) (-1224.631) [-1224.247] -- 0:00:45
476000 -- [-1221.313] (-1226.163) (-1222.470) (-1222.657) * (-1220.444) (-1223.044) [-1223.417] (-1226.401) -- 0:00:45
476500 -- (-1220.764) [-1222.685] (-1222.432) (-1222.188) * (-1220.779) (-1223.516) (-1221.325) [-1226.264] -- 0:00:45
477000 -- (-1221.497) (-1221.851) [-1222.102] (-1221.111) * (-1223.112) [-1223.692] (-1222.226) (-1220.581) -- 0:00:44
477500 -- (-1222.966) [-1221.044] (-1222.088) (-1224.734) * (-1227.828) [-1228.446] (-1222.908) (-1221.505) -- 0:00:44
478000 -- (-1222.169) (-1222.043) [-1222.622] (-1225.590) * [-1225.405] (-1227.411) (-1221.900) (-1221.777) -- 0:00:44
478500 -- (-1222.422) (-1222.793) [-1221.074] (-1228.483) * [-1221.216] (-1230.676) (-1222.074) (-1224.638) -- 0:00:44
479000 -- (-1223.591) (-1220.989) [-1221.286] (-1222.714) * (-1221.858) (-1229.094) [-1224.976] (-1221.427) -- 0:00:44
479500 -- [-1221.969] (-1221.320) (-1222.148) (-1223.580) * (-1222.283) (-1223.908) (-1226.041) [-1221.436] -- 0:00:44
480000 -- (-1222.700) [-1222.112] (-1223.486) (-1225.588) * (-1221.578) (-1225.526) (-1223.799) [-1221.137] -- 0:00:44
Average standard deviation of split frequencies: 0.006191
480500 -- [-1222.227] (-1225.631) (-1221.516) (-1225.362) * (-1220.745) (-1221.510) (-1221.248) [-1225.192] -- 0:00:44
481000 -- (-1221.225) [-1224.796] (-1225.119) (-1222.820) * (-1224.223) [-1221.507] (-1226.392) (-1224.467) -- 0:00:44
481500 -- (-1221.333) (-1224.339) [-1223.756] (-1221.475) * (-1225.214) (-1223.783) (-1222.745) [-1221.893] -- 0:00:44
482000 -- (-1221.119) [-1224.357] (-1223.613) (-1222.362) * (-1223.112) (-1221.964) (-1224.756) [-1224.127] -- 0:00:44
482500 -- [-1221.480] (-1223.375) (-1225.631) (-1221.808) * (-1222.943) (-1223.169) (-1221.646) [-1222.644] -- 0:00:43
483000 -- (-1221.784) [-1223.024] (-1227.071) (-1221.990) * (-1223.713) (-1224.541) (-1221.189) [-1223.947] -- 0:00:43
483500 -- [-1221.484] (-1222.487) (-1223.667) (-1223.756) * (-1223.275) [-1222.477] (-1220.903) (-1221.395) -- 0:00:43
484000 -- [-1223.710] (-1222.659) (-1228.141) (-1223.808) * (-1221.878) (-1221.299) [-1221.525] (-1223.367) -- 0:00:43
484500 -- (-1221.925) (-1222.659) [-1223.150] (-1222.129) * (-1225.641) (-1223.531) [-1223.122] (-1224.520) -- 0:00:43
485000 -- (-1223.966) (-1221.959) [-1222.339] (-1225.478) * [-1224.995] (-1223.221) (-1222.655) (-1231.040) -- 0:00:44
Average standard deviation of split frequencies: 0.007132
485500 -- (-1223.870) [-1223.158] (-1222.301) (-1224.892) * [-1225.895] (-1221.146) (-1222.876) (-1227.730) -- 0:00:44
486000 -- (-1225.204) (-1221.288) [-1222.162] (-1223.526) * (-1225.634) (-1221.313) (-1221.594) [-1227.065] -- 0:00:44
486500 -- [-1223.280] (-1221.240) (-1222.375) (-1223.676) * (-1228.233) (-1221.849) [-1222.598] (-1224.249) -- 0:00:44
487000 -- [-1222.401] (-1221.240) (-1223.690) (-1223.630) * (-1223.532) (-1223.140) [-1223.172] (-1225.739) -- 0:00:44
487500 -- (-1222.400) (-1223.723) [-1223.054] (-1224.029) * [-1222.199] (-1223.515) (-1222.306) (-1224.763) -- 0:00:44
488000 -- (-1227.003) (-1222.559) [-1222.758] (-1223.614) * (-1222.022) [-1220.626] (-1222.158) (-1222.919) -- 0:00:44
488500 -- (-1224.146) (-1221.436) (-1224.786) [-1222.668] * (-1223.840) [-1221.942] (-1229.215) (-1221.539) -- 0:00:43
489000 -- (-1223.689) (-1221.808) [-1223.807] (-1222.870) * (-1221.307) (-1222.190) [-1221.786] (-1222.007) -- 0:00:43
489500 -- (-1221.711) (-1221.848) [-1223.165] (-1222.289) * (-1222.534) (-1221.993) [-1220.799] (-1226.124) -- 0:00:43
490000 -- (-1222.421) (-1223.461) (-1222.534) [-1222.369] * (-1221.897) (-1227.332) (-1223.885) [-1221.806] -- 0:00:43
Average standard deviation of split frequencies: 0.007085
490500 -- [-1221.200] (-1223.502) (-1227.159) (-1223.529) * [-1226.747] (-1222.461) (-1226.883) (-1221.055) -- 0:00:43
491000 -- (-1224.665) (-1223.234) [-1224.334] (-1224.685) * (-1225.395) (-1223.628) [-1224.112] (-1222.113) -- 0:00:43
491500 -- [-1222.151] (-1222.841) (-1225.795) (-1225.078) * (-1222.571) (-1225.250) [-1223.722] (-1223.286) -- 0:00:43
492000 -- (-1224.901) (-1223.085) [-1221.328] (-1221.639) * [-1220.824] (-1224.869) (-1223.916) (-1222.169) -- 0:00:43
492500 -- (-1223.264) (-1223.800) (-1222.094) [-1221.824] * [-1221.256] (-1221.707) (-1224.412) (-1222.097) -- 0:00:43
493000 -- (-1220.793) (-1221.747) (-1221.791) [-1222.188] * [-1222.861] (-1221.869) (-1224.473) (-1224.129) -- 0:00:43
493500 -- [-1221.600] (-1223.952) (-1222.634) (-1223.900) * (-1221.889) [-1222.824] (-1224.580) (-1225.301) -- 0:00:43
494000 -- [-1222.545] (-1222.532) (-1224.193) (-1223.508) * (-1221.676) [-1222.116] (-1223.088) (-1223.127) -- 0:00:43
494500 -- (-1226.886) (-1222.303) [-1223.160] (-1222.409) * (-1222.993) (-1223.535) (-1221.719) [-1222.114] -- 0:00:42
495000 -- (-1229.362) (-1221.789) [-1223.580] (-1222.417) * (-1224.946) (-1224.985) (-1222.441) [-1223.998] -- 0:00:42
Average standard deviation of split frequencies: 0.006415
495500 -- (-1223.713) [-1227.623] (-1222.422) (-1221.777) * (-1224.094) (-1224.727) [-1221.929] (-1223.200) -- 0:00:42
496000 -- (-1224.127) (-1226.228) [-1225.946] (-1221.771) * (-1224.090) (-1224.425) (-1223.455) [-1224.286] -- 0:00:42
496500 -- (-1228.779) (-1222.292) [-1222.040] (-1220.961) * (-1225.394) (-1221.179) [-1223.031] (-1222.375) -- 0:00:42
497000 -- [-1225.711] (-1224.863) (-1224.742) (-1224.173) * (-1224.071) [-1223.930] (-1222.137) (-1224.161) -- 0:00:43
497500 -- (-1221.063) (-1226.518) (-1224.547) [-1225.277] * (-1223.283) (-1221.180) [-1222.664] (-1227.636) -- 0:00:43
498000 -- (-1220.680) (-1222.728) [-1223.410] (-1224.572) * (-1223.714) (-1221.842) [-1223.148] (-1223.800) -- 0:00:43
498500 -- (-1225.013) (-1223.037) (-1222.813) [-1222.367] * (-1223.796) (-1221.150) [-1220.609] (-1223.001) -- 0:00:43
499000 -- (-1221.007) (-1222.893) (-1223.907) [-1224.060] * (-1222.096) [-1221.574] (-1224.296) (-1224.201) -- 0:00:43
499500 -- (-1223.410) (-1227.364) (-1223.803) [-1224.304] * (-1221.918) (-1221.751) [-1221.785] (-1221.936) -- 0:00:43
500000 -- (-1224.023) (-1224.965) (-1222.109) [-1226.929] * [-1222.509] (-1225.059) (-1222.011) (-1222.140) -- 0:00:43
Average standard deviation of split frequencies: 0.005944
500500 -- [-1222.795] (-1221.188) (-1226.604) (-1228.189) * [-1223.279] (-1224.022) (-1223.078) (-1221.884) -- 0:00:42
501000 -- (-1222.970) [-1221.434] (-1221.759) (-1224.676) * [-1222.373] (-1221.673) (-1221.923) (-1221.142) -- 0:00:42
501500 -- (-1221.622) [-1224.586] (-1225.340) (-1226.483) * [-1222.512] (-1221.729) (-1220.954) (-1223.778) -- 0:00:42
502000 -- [-1222.073] (-1222.362) (-1223.752) (-1224.047) * (-1224.052) [-1225.356] (-1222.309) (-1222.455) -- 0:00:42
502500 -- (-1225.405) (-1226.036) [-1226.706] (-1223.008) * [-1222.623] (-1224.798) (-1223.092) (-1225.251) -- 0:00:42
503000 -- [-1224.668] (-1226.668) (-1226.707) (-1222.650) * (-1225.563) (-1224.687) (-1223.119) [-1225.796] -- 0:00:42
503500 -- (-1224.884) [-1223.936] (-1222.259) (-1223.542) * (-1227.350) (-1221.538) [-1222.600] (-1228.484) -- 0:00:42
504000 -- (-1227.389) [-1224.609] (-1222.599) (-1223.758) * [-1225.155] (-1221.429) (-1222.810) (-1228.257) -- 0:00:42
504500 -- (-1221.339) (-1224.494) (-1224.412) [-1224.049] * [-1221.935] (-1222.204) (-1226.147) (-1226.050) -- 0:00:42
505000 -- (-1222.077) (-1222.097) (-1221.614) [-1223.164] * (-1220.729) (-1225.657) (-1221.152) [-1222.085] -- 0:00:42
Average standard deviation of split frequencies: 0.005648
505500 -- (-1220.964) [-1222.034] (-1221.471) (-1224.577) * [-1221.217] (-1222.590) (-1223.535) (-1225.997) -- 0:00:42
506000 -- (-1222.626) (-1223.620) (-1222.594) [-1224.429] * (-1225.495) [-1222.931] (-1223.699) (-1221.863) -- 0:00:41
506500 -- (-1222.835) (-1222.497) [-1222.166] (-1224.356) * [-1226.444] (-1224.736) (-1223.251) (-1221.883) -- 0:00:41
507000 -- (-1222.142) [-1225.391] (-1222.245) (-1223.491) * (-1225.756) (-1223.363) [-1222.822] (-1222.428) -- 0:00:41
507500 -- (-1222.849) (-1222.392) (-1221.363) [-1221.287] * [-1223.091] (-1221.346) (-1227.747) (-1222.237) -- 0:00:41
508000 -- [-1221.818] (-1229.412) (-1221.470) (-1221.252) * (-1222.408) [-1221.833] (-1223.308) (-1220.827) -- 0:00:41
508500 -- [-1220.853] (-1226.448) (-1221.575) (-1220.874) * (-1222.626) (-1220.668) (-1224.594) [-1220.765] -- 0:00:42
509000 -- (-1221.502) [-1225.644] (-1221.379) (-1222.154) * (-1224.794) [-1221.403] (-1223.014) (-1221.634) -- 0:00:42
509500 -- (-1222.938) [-1223.633] (-1222.825) (-1222.513) * (-1226.096) (-1221.837) (-1223.134) [-1221.356] -- 0:00:42
510000 -- [-1226.877] (-1221.990) (-1224.105) (-1224.605) * (-1225.281) (-1223.058) (-1221.433) [-1223.580] -- 0:00:42
Average standard deviation of split frequencies: 0.006520
510500 -- (-1224.939) [-1224.706] (-1222.121) (-1222.446) * (-1226.293) [-1222.466] (-1225.612) (-1224.323) -- 0:00:42
511000 -- (-1225.984) [-1220.671] (-1221.735) (-1223.725) * [-1221.045] (-1225.506) (-1225.779) (-1226.191) -- 0:00:42
511500 -- [-1223.993] (-1221.135) (-1222.202) (-1221.550) * (-1221.699) [-1221.692] (-1225.705) (-1227.268) -- 0:00:42
512000 -- (-1221.915) (-1221.378) (-1222.986) [-1221.775] * (-1223.850) (-1222.074) [-1223.663] (-1224.992) -- 0:00:41
512500 -- [-1221.543] (-1224.222) (-1221.104) (-1221.705) * (-1222.195) (-1222.008) (-1226.597) [-1224.706] -- 0:00:41
513000 -- [-1221.361] (-1228.147) (-1221.571) (-1222.428) * (-1222.210) (-1222.305) (-1228.133) [-1223.103] -- 0:00:41
513500 -- (-1222.584) [-1221.925] (-1221.518) (-1222.105) * (-1222.021) (-1221.622) [-1225.558] (-1222.351) -- 0:00:41
514000 -- [-1220.853] (-1221.275) (-1222.310) (-1222.217) * [-1221.815] (-1220.510) (-1231.046) (-1221.897) -- 0:00:41
514500 -- (-1221.737) (-1222.680) (-1226.452) [-1221.618] * (-1222.919) [-1221.483] (-1222.725) (-1221.768) -- 0:00:41
515000 -- (-1222.143) (-1220.770) (-1226.394) [-1225.213] * (-1225.132) (-1222.368) (-1223.195) [-1221.896] -- 0:00:41
Average standard deviation of split frequencies: 0.007023
515500 -- (-1222.967) (-1221.809) (-1225.282) [-1223.771] * (-1222.468) [-1220.984] (-1223.894) (-1223.751) -- 0:00:41
516000 -- (-1221.045) [-1222.390] (-1227.219) (-1222.646) * (-1224.154) (-1225.677) (-1224.940) [-1223.751] -- 0:00:41
516500 -- (-1221.909) (-1221.528) (-1228.492) [-1222.754] * (-1226.166) [-1222.506] (-1225.879) (-1221.987) -- 0:00:41
517000 -- (-1223.809) (-1221.579) (-1226.861) [-1222.221] * (-1224.641) [-1222.351] (-1223.120) (-1224.101) -- 0:00:41
517500 -- (-1228.533) (-1221.145) [-1223.556] (-1224.335) * (-1223.457) [-1221.775] (-1222.774) (-1221.083) -- 0:00:41
518000 -- (-1221.242) (-1225.491) (-1221.345) [-1222.892] * (-1224.314) [-1221.005] (-1222.633) (-1225.005) -- 0:00:40
518500 -- (-1222.127) (-1222.143) [-1222.324] (-1221.579) * (-1222.474) (-1222.899) (-1224.267) [-1224.722] -- 0:00:40
519000 -- (-1224.005) (-1224.184) (-1220.900) [-1221.402] * (-1222.908) [-1224.096] (-1222.949) (-1222.299) -- 0:00:40
519500 -- (-1223.766) [-1222.844] (-1228.679) (-1222.768) * (-1224.621) (-1221.922) (-1222.738) [-1223.295] -- 0:00:40
520000 -- [-1221.589] (-1225.815) (-1222.910) (-1223.992) * (-1221.795) (-1224.707) (-1223.915) [-1223.376] -- 0:00:40
Average standard deviation of split frequencies: 0.007526
520500 -- (-1224.247) (-1223.348) (-1221.792) [-1222.511] * [-1222.264] (-1222.531) (-1222.586) (-1227.481) -- 0:00:41
521000 -- [-1221.342] (-1222.716) (-1221.762) (-1222.843) * [-1223.220] (-1222.257) (-1222.119) (-1226.119) -- 0:00:41
521500 -- (-1223.007) (-1222.046) (-1223.127) [-1222.822] * (-1224.648) [-1225.922] (-1222.297) (-1224.538) -- 0:00:41
522000 -- (-1220.568) [-1220.884] (-1223.171) (-1222.061) * (-1222.869) (-1223.409) [-1221.330] (-1223.957) -- 0:00:41
522500 -- [-1222.350] (-1221.765) (-1224.249) (-1223.509) * (-1227.655) (-1226.070) (-1223.280) [-1223.464] -- 0:00:41
523000 -- (-1220.415) (-1223.772) (-1221.276) [-1223.167] * (-1223.113) (-1221.814) (-1224.348) [-1224.556] -- 0:00:41
523500 -- (-1221.896) (-1222.078) [-1224.156] (-1221.605) * (-1221.704) (-1222.248) [-1223.058] (-1223.172) -- 0:00:40
524000 -- [-1221.595] (-1221.632) (-1223.740) (-1228.108) * [-1226.699] (-1222.008) (-1222.286) (-1226.476) -- 0:00:40
524500 -- [-1220.604] (-1222.004) (-1222.354) (-1223.661) * (-1224.637) [-1222.267] (-1222.220) (-1226.435) -- 0:00:40
525000 -- (-1224.203) [-1221.400] (-1221.926) (-1223.732) * (-1227.078) (-1222.949) [-1221.735] (-1228.715) -- 0:00:40
Average standard deviation of split frequencies: 0.006778
525500 -- [-1225.525] (-1223.152) (-1221.885) (-1222.603) * (-1222.025) (-1222.578) [-1221.789] (-1224.034) -- 0:00:40
526000 -- [-1222.635] (-1223.137) (-1223.984) (-1226.710) * [-1221.078] (-1224.736) (-1221.393) (-1221.922) -- 0:00:40
526500 -- [-1220.669] (-1225.683) (-1222.469) (-1221.022) * (-1223.214) [-1221.750] (-1221.122) (-1225.138) -- 0:00:40
527000 -- (-1220.726) (-1222.195) [-1223.394] (-1224.147) * (-1220.860) [-1225.738] (-1222.754) (-1220.881) -- 0:00:40
527500 -- (-1222.978) (-1223.026) (-1222.815) [-1223.699] * (-1222.379) (-1226.600) (-1222.853) [-1221.920] -- 0:00:40
528000 -- (-1226.093) (-1226.831) (-1226.053) [-1222.863] * [-1222.770] (-1227.414) (-1223.068) (-1226.258) -- 0:00:40
528500 -- (-1224.371) (-1222.588) [-1222.729] (-1221.267) * [-1220.732] (-1228.386) (-1224.198) (-1222.746) -- 0:00:40
529000 -- (-1225.443) (-1220.910) (-1223.162) [-1220.999] * [-1222.903] (-1225.357) (-1222.047) (-1223.202) -- 0:00:40
529500 -- (-1222.858) (-1221.111) [-1221.672] (-1220.937) * (-1223.351) [-1221.849] (-1235.560) (-1224.902) -- 0:00:39
530000 -- (-1223.073) (-1226.620) (-1224.994) [-1224.102] * (-1222.232) (-1221.251) (-1223.577) [-1221.997] -- 0:00:39
Average standard deviation of split frequencies: 0.006940
530500 -- (-1221.415) (-1222.814) (-1221.724) [-1221.201] * [-1221.430] (-1221.190) (-1222.761) (-1224.560) -- 0:00:39
531000 -- (-1223.346) [-1224.743] (-1222.721) (-1227.435) * (-1221.682) [-1220.823] (-1222.076) (-1221.786) -- 0:00:39
531500 -- (-1224.125) (-1223.801) [-1222.006] (-1222.633) * (-1221.297) (-1227.285) [-1222.565] (-1221.178) -- 0:00:39
532000 -- (-1223.061) (-1228.626) (-1221.856) [-1220.759] * (-1224.330) [-1224.102] (-1221.891) (-1220.900) -- 0:00:40
532500 -- [-1222.262] (-1225.379) (-1222.366) (-1222.000) * (-1224.377) [-1222.025] (-1223.638) (-1224.225) -- 0:00:40
533000 -- [-1221.650] (-1224.763) (-1224.616) (-1223.232) * (-1222.818) (-1222.638) (-1224.988) [-1221.528] -- 0:00:40
533500 -- [-1222.633] (-1221.729) (-1225.432) (-1221.503) * (-1221.989) (-1225.202) [-1223.744] (-1224.946) -- 0:00:40
534000 -- [-1222.288] (-1221.597) (-1222.506) (-1228.127) * (-1225.557) (-1224.625) (-1223.383) [-1224.504] -- 0:00:40
534500 -- (-1222.502) (-1224.140) [-1225.551] (-1227.259) * (-1221.679) (-1230.480) (-1224.512) [-1223.927] -- 0:00:40
535000 -- (-1222.079) (-1223.126) [-1224.354] (-1222.117) * (-1224.170) [-1224.531] (-1222.151) (-1223.118) -- 0:00:39
Average standard deviation of split frequencies: 0.006743
535500 -- (-1222.214) (-1228.189) [-1226.074] (-1221.685) * (-1223.823) (-1221.935) (-1223.514) [-1222.875] -- 0:00:39
536000 -- [-1221.844] (-1227.425) (-1222.390) (-1223.341) * (-1224.752) [-1222.232] (-1222.930) (-1223.384) -- 0:00:39
536500 -- (-1222.429) (-1227.900) [-1222.699] (-1221.817) * [-1221.286] (-1221.115) (-1225.021) (-1226.710) -- 0:00:39
537000 -- (-1222.233) (-1228.797) (-1224.983) [-1223.317] * [-1221.391] (-1222.059) (-1222.523) (-1225.261) -- 0:00:39
537500 -- (-1222.104) (-1227.904) (-1224.220) [-1222.675] * (-1224.189) (-1222.174) (-1221.327) [-1222.600] -- 0:00:39
538000 -- (-1222.587) [-1226.024] (-1224.678) (-1221.864) * (-1221.554) (-1222.244) (-1223.376) [-1222.064] -- 0:00:39
538500 -- (-1221.132) [-1224.569] (-1223.793) (-1222.239) * (-1221.654) (-1223.029) (-1222.460) [-1225.414] -- 0:00:39
539000 -- (-1224.469) (-1224.357) (-1222.777) [-1220.959] * (-1222.297) (-1223.588) [-1224.283] (-1222.459) -- 0:00:39
539500 -- (-1223.564) (-1223.148) [-1221.714] (-1225.362) * (-1225.341) (-1224.288) [-1222.162] (-1222.853) -- 0:00:39
540000 -- (-1224.151) (-1221.919) [-1221.150] (-1223.113) * (-1224.378) [-1222.960] (-1221.779) (-1225.550) -- 0:00:39
Average standard deviation of split frequencies: 0.007382
540500 -- [-1222.378] (-1221.654) (-1227.860) (-1222.006) * (-1223.090) [-1221.084] (-1221.173) (-1223.421) -- 0:00:39
541000 -- [-1222.460] (-1222.079) (-1224.264) (-1221.399) * (-1223.314) (-1224.939) [-1223.100] (-1224.762) -- 0:00:39
541500 -- [-1221.500] (-1222.105) (-1229.509) (-1220.878) * (-1225.222) (-1224.975) (-1225.943) [-1221.868] -- 0:00:38
542000 -- (-1222.668) [-1222.060] (-1223.870) (-1221.129) * (-1224.138) (-1226.355) (-1221.831) [-1220.948] -- 0:00:38
542500 -- (-1226.739) (-1227.508) (-1225.275) [-1222.060] * (-1222.910) (-1223.212) (-1221.402) [-1220.863] -- 0:00:38
543000 -- [-1223.332] (-1227.377) (-1223.312) (-1222.138) * (-1224.547) (-1221.356) [-1221.563] (-1221.387) -- 0:00:38
543500 -- (-1222.439) (-1223.054) (-1230.665) [-1222.806] * (-1225.982) [-1222.313] (-1221.360) (-1224.528) -- 0:00:38
544000 -- [-1223.055] (-1224.637) (-1224.003) (-1222.943) * (-1224.139) [-1222.782] (-1222.323) (-1221.305) -- 0:00:39
544500 -- (-1221.923) (-1220.953) (-1224.063) [-1222.390] * (-1221.687) (-1221.694) [-1222.199] (-1220.923) -- 0:00:39
545000 -- (-1224.937) [-1221.085] (-1221.666) (-1222.496) * (-1223.675) [-1222.879] (-1222.827) (-1221.596) -- 0:00:39
Average standard deviation of split frequencies: 0.007598
545500 -- (-1226.004) (-1221.712) [-1224.080] (-1221.916) * (-1222.835) [-1223.661] (-1227.381) (-1223.140) -- 0:00:39
546000 -- (-1226.043) (-1221.780) [-1223.246] (-1222.917) * (-1222.889) [-1223.064] (-1234.141) (-1225.751) -- 0:00:39
546500 -- [-1222.532] (-1222.101) (-1221.944) (-1225.107) * [-1222.358] (-1224.693) (-1221.915) (-1226.344) -- 0:00:39
547000 -- (-1223.460) [-1222.831] (-1222.619) (-1222.211) * (-1222.342) (-1224.914) (-1222.474) [-1227.529] -- 0:00:38
547500 -- (-1221.279) [-1223.063] (-1221.964) (-1222.680) * (-1224.004) (-1224.950) (-1222.104) [-1222.066] -- 0:00:38
548000 -- (-1222.432) (-1228.852) [-1221.376] (-1223.128) * (-1222.252) (-1223.291) (-1221.506) [-1222.123] -- 0:00:38
548500 -- [-1222.038] (-1229.585) (-1222.238) (-1223.255) * [-1222.307] (-1220.954) (-1222.256) (-1222.193) -- 0:00:38
549000 -- (-1222.328) (-1221.477) [-1222.234] (-1222.226) * [-1221.705] (-1221.154) (-1221.600) (-1222.541) -- 0:00:38
549500 -- [-1222.086] (-1223.406) (-1222.961) (-1224.877) * (-1222.303) [-1221.689] (-1223.258) (-1225.712) -- 0:00:38
550000 -- (-1221.330) (-1223.010) [-1223.108] (-1225.592) * [-1221.428] (-1224.077) (-1223.230) (-1222.190) -- 0:00:38
Average standard deviation of split frequencies: 0.007819
550500 -- (-1225.346) [-1221.892] (-1221.986) (-1222.412) * (-1222.908) (-1225.530) [-1223.704] (-1222.624) -- 0:00:38
551000 -- (-1222.107) [-1221.579] (-1221.986) (-1224.152) * (-1227.866) [-1222.806] (-1221.725) (-1223.036) -- 0:00:38
551500 -- (-1223.415) (-1221.306) [-1224.609] (-1224.344) * (-1221.336) (-1222.578) [-1221.886] (-1223.036) -- 0:00:38
552000 -- (-1221.984) (-1226.830) (-1221.224) [-1223.805] * [-1223.074] (-1227.144) (-1221.403) (-1224.531) -- 0:00:38
552500 -- (-1221.998) [-1224.246] (-1225.379) (-1223.548) * [-1222.123] (-1224.011) (-1222.739) (-1227.201) -- 0:00:38
553000 -- (-1223.814) (-1226.569) [-1224.332] (-1228.264) * (-1222.911) (-1223.211) [-1224.237] (-1224.345) -- 0:00:37
553500 -- (-1223.602) [-1222.906] (-1226.629) (-1222.618) * (-1225.750) (-1222.969) [-1223.258] (-1223.873) -- 0:00:37
554000 -- (-1223.282) (-1225.398) [-1222.876] (-1221.863) * [-1220.753] (-1221.489) (-1220.782) (-1223.625) -- 0:00:37
554500 -- (-1222.479) [-1221.070] (-1222.584) (-1223.907) * (-1221.911) [-1223.231] (-1223.791) (-1226.150) -- 0:00:37
555000 -- (-1225.679) (-1221.008) (-1223.949) [-1224.548] * (-1223.721) (-1221.702) (-1225.582) [-1221.886] -- 0:00:37
Average standard deviation of split frequencies: 0.007405
555500 -- [-1222.411] (-1225.773) (-1222.291) (-1223.939) * (-1222.788) [-1223.893] (-1224.480) (-1222.714) -- 0:00:38
556000 -- (-1222.355) (-1222.796) [-1221.823] (-1224.725) * (-1221.725) (-1223.308) (-1225.103) [-1224.237] -- 0:00:38
556500 -- (-1221.833) [-1221.020] (-1223.719) (-1227.065) * [-1221.867] (-1222.470) (-1226.889) (-1224.851) -- 0:00:38
557000 -- [-1221.323] (-1222.617) (-1224.225) (-1222.089) * [-1221.231] (-1223.903) (-1224.421) (-1223.339) -- 0:00:38
557500 -- (-1227.686) (-1222.016) [-1223.430] (-1222.081) * [-1225.464] (-1223.241) (-1221.551) (-1222.875) -- 0:00:38
558000 -- (-1226.807) [-1220.985] (-1223.977) (-1222.173) * (-1221.213) [-1221.974] (-1222.622) (-1223.990) -- 0:00:38
558500 -- (-1222.755) (-1221.521) [-1222.493] (-1224.243) * (-1220.774) [-1224.599] (-1225.874) (-1226.774) -- 0:00:37
559000 -- (-1222.894) [-1222.922] (-1222.040) (-1225.378) * (-1222.604) (-1229.615) [-1224.191] (-1221.510) -- 0:00:37
559500 -- (-1221.755) (-1223.917) [-1222.196] (-1222.054) * (-1221.942) (-1225.114) [-1221.823] (-1221.884) -- 0:00:37
560000 -- [-1222.549] (-1226.753) (-1221.593) (-1225.433) * (-1224.383) (-1223.898) [-1221.072] (-1221.300) -- 0:00:37
Average standard deviation of split frequencies: 0.007119
560500 -- (-1222.371) [-1224.197] (-1221.077) (-1223.553) * (-1223.605) [-1225.231] (-1221.467) (-1223.336) -- 0:00:37
561000 -- [-1224.486] (-1221.872) (-1223.500) (-1225.550) * [-1222.820] (-1222.176) (-1222.938) (-1224.382) -- 0:00:37
561500 -- (-1224.719) (-1222.701) [-1222.239] (-1223.560) * (-1222.566) [-1222.082] (-1222.053) (-1225.285) -- 0:00:37
562000 -- (-1221.438) (-1222.626) [-1221.866] (-1226.038) * (-1224.340) [-1225.610] (-1222.213) (-1224.972) -- 0:00:37
562500 -- [-1221.656] (-1223.072) (-1221.824) (-1223.694) * (-1221.563) (-1221.502) (-1224.571) [-1223.931] -- 0:00:37
563000 -- (-1224.864) [-1221.537] (-1223.873) (-1222.073) * [-1221.272] (-1221.819) (-1223.033) (-1224.845) -- 0:00:37
563500 -- [-1221.878] (-1223.062) (-1221.011) (-1221.942) * (-1221.110) (-1222.567) [-1223.917] (-1223.361) -- 0:00:37
564000 -- [-1222.630] (-1223.367) (-1222.075) (-1223.717) * (-1221.110) (-1224.603) (-1225.419) [-1225.042] -- 0:00:37
564500 -- [-1222.105] (-1223.236) (-1221.322) (-1222.123) * (-1223.317) [-1221.298] (-1223.197) (-1233.781) -- 0:00:37
565000 -- (-1225.946) [-1222.546] (-1224.442) (-1225.570) * (-1220.817) (-1221.177) [-1223.477] (-1227.742) -- 0:00:36
Average standard deviation of split frequencies: 0.006774
565500 -- [-1222.400] (-1221.378) (-1221.328) (-1228.623) * (-1224.240) [-1221.490] (-1222.681) (-1224.599) -- 0:00:36
566000 -- (-1222.231) (-1221.379) [-1225.541] (-1226.017) * (-1232.013) [-1220.726] (-1227.647) (-1223.977) -- 0:00:36
566500 -- [-1225.079] (-1221.598) (-1222.909) (-1222.238) * (-1222.420) (-1222.379) [-1225.803] (-1221.492) -- 0:00:36
567000 -- [-1222.784] (-1224.001) (-1222.611) (-1221.414) * (-1223.630) (-1221.603) (-1228.468) [-1223.177] -- 0:00:37
567500 -- [-1221.292] (-1221.087) (-1221.349) (-1223.681) * [-1221.758] (-1224.465) (-1221.256) (-1224.426) -- 0:00:37
568000 -- (-1222.389) (-1222.179) (-1221.206) [-1223.199] * (-1221.696) (-1222.634) [-1222.765] (-1226.068) -- 0:00:37
568500 -- (-1222.807) (-1222.607) [-1222.926] (-1225.124) * (-1221.449) (-1221.298) (-1223.384) [-1225.839] -- 0:00:37
569000 -- (-1221.832) [-1223.712] (-1223.860) (-1223.569) * [-1222.232] (-1222.620) (-1222.720) (-1222.329) -- 0:00:37
569500 -- (-1221.550) (-1223.691) [-1222.613] (-1226.321) * (-1222.071) [-1222.639] (-1221.657) (-1229.050) -- 0:00:37
570000 -- (-1223.744) (-1222.643) [-1221.560] (-1226.670) * (-1222.828) (-1222.359) [-1221.416] (-1225.292) -- 0:00:36
Average standard deviation of split frequencies: 0.006553
570500 -- (-1223.206) (-1221.858) (-1225.966) [-1223.421] * (-1221.688) (-1222.030) [-1220.873] (-1222.971) -- 0:00:36
571000 -- (-1226.612) (-1224.900) [-1221.247] (-1222.356) * [-1221.837] (-1222.226) (-1222.531) (-1222.568) -- 0:00:36
571500 -- (-1221.775) (-1224.786) [-1222.892] (-1222.713) * (-1222.200) (-1223.240) [-1222.048] (-1221.756) -- 0:00:36
572000 -- (-1223.480) (-1226.548) [-1223.835] (-1224.397) * (-1226.175) (-1222.268) (-1222.058) [-1221.890] -- 0:00:36
572500 -- [-1221.451] (-1225.273) (-1225.299) (-1225.334) * (-1222.783) (-1222.809) (-1224.206) [-1221.755] -- 0:00:36
573000 -- (-1221.745) [-1224.658] (-1223.151) (-1224.999) * (-1227.419) (-1221.218) [-1223.840] (-1223.518) -- 0:00:36
573500 -- [-1222.872] (-1224.999) (-1226.499) (-1223.099) * (-1223.473) (-1220.866) [-1225.661] (-1226.763) -- 0:00:36
574000 -- (-1226.640) (-1224.639) [-1222.896] (-1226.911) * [-1222.510] (-1223.037) (-1228.507) (-1226.593) -- 0:00:36
574500 -- (-1227.188) (-1221.840) [-1222.944] (-1223.637) * (-1221.820) (-1227.569) (-1221.027) [-1222.528] -- 0:00:36
575000 -- (-1224.099) (-1222.923) [-1223.519] (-1221.225) * [-1222.956] (-1224.256) (-1227.389) (-1221.346) -- 0:00:36
Average standard deviation of split frequencies: 0.006438
575500 -- (-1224.944) (-1222.627) [-1221.629] (-1222.040) * (-1220.780) [-1221.533] (-1222.605) (-1223.155) -- 0:00:36
576000 -- (-1223.413) (-1222.932) [-1222.350] (-1222.425) * (-1221.945) [-1221.919] (-1222.531) (-1222.213) -- 0:00:36
576500 -- (-1222.245) [-1226.721] (-1223.284) (-1222.727) * [-1225.054] (-1221.217) (-1223.863) (-1228.458) -- 0:00:35
577000 -- (-1222.680) (-1223.513) (-1222.336) [-1223.667] * (-1221.263) (-1221.005) (-1223.045) [-1228.381] -- 0:00:35
577500 -- [-1221.549] (-1226.663) (-1222.815) (-1221.924) * (-1222.043) (-1220.473) (-1222.496) [-1223.767] -- 0:00:35
578000 -- (-1221.668) [-1223.766] (-1223.859) (-1223.950) * (-1222.470) (-1222.855) [-1223.069] (-1221.834) -- 0:00:35
578500 -- (-1221.049) [-1221.141] (-1225.282) (-1222.640) * (-1222.183) (-1223.453) [-1222.603] (-1222.881) -- 0:00:35
579000 -- (-1225.870) [-1222.151] (-1223.266) (-1223.065) * (-1221.177) [-1223.052] (-1220.720) (-1222.655) -- 0:00:36
579500 -- (-1222.294) (-1221.428) [-1222.365] (-1225.461) * (-1220.915) (-1222.120) [-1221.273] (-1225.144) -- 0:00:36
580000 -- (-1224.055) [-1223.207] (-1225.120) (-1223.399) * (-1223.055) (-1226.380) (-1225.879) [-1223.622] -- 0:00:36
Average standard deviation of split frequencies: 0.006332
580500 -- [-1223.298] (-1221.725) (-1225.875) (-1224.231) * [-1224.039] (-1223.291) (-1223.984) (-1222.656) -- 0:00:36
581000 -- (-1224.199) (-1225.062) (-1229.549) [-1223.442] * [-1222.926] (-1223.486) (-1222.703) (-1222.208) -- 0:00:36
581500 -- (-1228.562) (-1225.356) (-1227.486) [-1223.196] * [-1222.600] (-1222.727) (-1223.051) (-1223.123) -- 0:00:35
582000 -- (-1225.039) (-1221.895) (-1222.135) [-1222.591] * (-1225.465) [-1223.966] (-1223.812) (-1227.140) -- 0:00:35
582500 -- [-1221.440] (-1222.071) (-1222.115) (-1224.078) * (-1221.804) (-1227.978) (-1222.411) [-1222.137] -- 0:00:35
583000 -- [-1221.761] (-1224.764) (-1229.455) (-1225.303) * (-1223.067) [-1221.714] (-1225.444) (-1221.114) -- 0:00:35
583500 -- [-1222.170] (-1221.649) (-1228.300) (-1221.745) * (-1224.485) [-1222.328] (-1224.543) (-1224.281) -- 0:00:35
584000 -- (-1222.260) (-1222.948) [-1224.226] (-1222.726) * [-1221.497] (-1223.363) (-1231.721) (-1224.434) -- 0:00:35
584500 -- (-1221.325) [-1223.144] (-1225.417) (-1222.666) * [-1221.685] (-1221.510) (-1222.652) (-1225.680) -- 0:00:35
585000 -- (-1222.521) [-1227.350] (-1226.047) (-1226.603) * [-1221.443] (-1221.004) (-1222.656) (-1223.863) -- 0:00:35
Average standard deviation of split frequencies: 0.006114
585500 -- [-1221.660] (-1223.342) (-1222.696) (-1229.178) * (-1222.559) [-1221.079] (-1221.657) (-1223.328) -- 0:00:35
586000 -- (-1222.136) [-1223.322] (-1226.565) (-1223.601) * (-1223.794) [-1220.451] (-1222.119) (-1227.743) -- 0:00:35
586500 -- (-1222.137) (-1223.650) [-1223.425] (-1225.913) * (-1223.030) [-1221.170] (-1225.676) (-1223.355) -- 0:00:35
587000 -- [-1222.164] (-1225.912) (-1221.800) (-1225.901) * (-1221.958) [-1220.894] (-1221.027) (-1223.010) -- 0:00:35
587500 -- (-1224.942) (-1226.072) [-1222.327] (-1228.500) * (-1229.229) (-1220.846) (-1224.703) [-1224.635] -- 0:00:35
588000 -- [-1225.574] (-1223.180) (-1225.073) (-1226.778) * (-1224.840) (-1220.690) (-1226.128) [-1222.329] -- 0:00:35
588500 -- (-1223.352) (-1224.791) [-1224.002] (-1222.761) * (-1225.688) [-1221.289] (-1222.956) (-1223.298) -- 0:00:34
589000 -- [-1222.593] (-1224.223) (-1222.534) (-1225.867) * (-1226.288) (-1224.795) (-1222.791) [-1222.026] -- 0:00:34
589500 -- (-1223.715) (-1224.162) (-1230.078) [-1226.324] * (-1223.519) [-1223.624] (-1227.453) (-1225.355) -- 0:00:34
590000 -- (-1223.804) (-1222.036) (-1227.074) [-1223.400] * [-1223.351] (-1221.025) (-1223.275) (-1222.688) -- 0:00:34
Average standard deviation of split frequencies: 0.005906
590500 -- [-1224.399] (-1221.814) (-1226.700) (-1223.538) * (-1221.903) [-1221.781] (-1229.501) (-1222.398) -- 0:00:35
591000 -- (-1224.628) [-1221.625] (-1221.743) (-1221.716) * (-1226.752) (-1220.761) [-1222.831] (-1222.895) -- 0:00:35
591500 -- (-1224.130) [-1223.980] (-1222.831) (-1221.783) * (-1228.283) (-1221.949) (-1225.416) [-1223.296] -- 0:00:35
592000 -- (-1228.872) (-1221.111) [-1222.540] (-1221.767) * (-1224.286) (-1221.101) (-1227.492) [-1221.637] -- 0:00:35
592500 -- (-1224.497) (-1221.677) (-1223.393) [-1221.701] * (-1221.970) [-1226.254] (-1227.167) (-1221.416) -- 0:00:35
593000 -- [-1224.034] (-1221.904) (-1221.744) (-1224.800) * (-1223.746) (-1225.077) [-1223.782] (-1223.240) -- 0:00:35
593500 -- (-1223.794) (-1223.720) [-1222.740] (-1226.570) * (-1224.901) (-1221.613) (-1222.859) [-1224.190] -- 0:00:34
594000 -- (-1221.834) [-1224.230] (-1225.711) (-1226.080) * (-1226.567) (-1224.360) [-1223.429] (-1222.392) -- 0:00:34
594500 -- (-1221.817) (-1227.620) [-1225.835] (-1226.117) * (-1224.556) (-1227.012) (-1223.864) [-1222.233] -- 0:00:34
595000 -- (-1222.309) (-1224.539) [-1223.566] (-1225.665) * (-1220.812) (-1228.379) (-1221.400) [-1222.344] -- 0:00:34
Average standard deviation of split frequencies: 0.006644
595500 -- [-1221.277] (-1221.323) (-1224.148) (-1224.350) * (-1227.031) (-1225.653) [-1221.915] (-1221.732) -- 0:00:34
596000 -- (-1221.456) [-1221.042] (-1222.806) (-1224.044) * (-1221.537) (-1222.413) [-1223.613] (-1222.037) -- 0:00:34
596500 -- (-1226.869) [-1223.659] (-1224.385) (-1222.849) * (-1221.661) (-1222.584) (-1223.885) [-1222.980] -- 0:00:34
597000 -- (-1221.801) (-1223.303) [-1223.252] (-1222.711) * (-1221.587) (-1222.666) (-1225.224) [-1221.552] -- 0:00:34
597500 -- (-1224.740) (-1222.933) [-1223.829] (-1221.874) * (-1222.649) [-1224.385] (-1221.859) (-1221.576) -- 0:00:34
598000 -- (-1223.272) [-1222.813] (-1224.718) (-1222.330) * (-1221.349) (-1223.643) (-1223.037) [-1221.851] -- 0:00:34
598500 -- (-1221.959) (-1223.210) (-1223.459) [-1223.516] * (-1222.298) (-1222.059) (-1221.650) [-1221.180] -- 0:00:34
599000 -- (-1223.197) (-1223.200) [-1224.565] (-1221.863) * (-1222.404) (-1225.638) (-1222.621) [-1222.144] -- 0:00:34
599500 -- [-1222.124] (-1221.922) (-1224.137) (-1223.207) * (-1222.832) (-1222.208) (-1221.698) [-1221.089] -- 0:00:34
600000 -- (-1222.836) [-1227.567] (-1226.280) (-1223.587) * [-1223.110] (-1225.000) (-1224.196) (-1222.162) -- 0:00:34
Average standard deviation of split frequencies: 0.005964
600500 -- (-1223.385) [-1222.833] (-1223.186) (-1221.288) * (-1222.444) [-1221.194] (-1224.645) (-1221.726) -- 0:00:33
601000 -- (-1223.906) (-1222.677) [-1221.209] (-1221.385) * [-1220.717] (-1228.175) (-1223.825) (-1223.254) -- 0:00:33
601500 -- (-1222.123) (-1221.744) [-1221.604] (-1225.530) * [-1221.680] (-1226.469) (-1221.054) (-1221.233) -- 0:00:33
602000 -- (-1223.348) (-1223.344) (-1221.138) [-1221.728] * (-1223.895) (-1227.188) (-1222.773) [-1222.291] -- 0:00:34
602500 -- (-1225.748) (-1223.219) [-1222.752] (-1223.816) * (-1222.114) (-1224.259) (-1225.321) [-1223.653] -- 0:00:34
603000 -- (-1223.838) (-1221.989) (-1220.854) [-1220.935] * (-1221.149) (-1222.384) [-1227.939] (-1223.087) -- 0:00:34
603500 -- (-1221.603) (-1224.916) (-1220.638) [-1221.249] * (-1220.913) (-1221.103) (-1221.338) [-1223.321] -- 0:00:34
604000 -- (-1222.191) (-1222.859) [-1221.169] (-1222.872) * (-1225.797) [-1221.131] (-1224.215) (-1220.660) -- 0:00:34
604500 -- [-1221.134] (-1226.067) (-1222.611) (-1221.738) * (-1222.179) (-1221.973) (-1226.151) [-1222.765] -- 0:00:34
605000 -- (-1220.661) [-1225.763] (-1223.564) (-1224.658) * (-1222.751) (-1223.414) (-1225.545) [-1221.663] -- 0:00:33
Average standard deviation of split frequencies: 0.006418
605500 -- (-1220.932) (-1224.461) (-1225.972) [-1221.819] * (-1224.815) [-1221.897] (-1222.572) (-1221.428) -- 0:00:33
606000 -- (-1223.363) [-1227.200] (-1222.213) (-1223.205) * (-1224.953) (-1221.324) (-1221.157) [-1221.829] -- 0:00:33
606500 -- [-1225.248] (-1223.716) (-1222.508) (-1221.224) * (-1226.146) (-1221.764) (-1221.050) [-1224.231] -- 0:00:33
607000 -- (-1224.299) (-1224.096) (-1222.030) [-1220.684] * (-1223.006) (-1222.816) [-1223.300] (-1222.559) -- 0:00:33
607500 -- (-1222.461) (-1222.054) [-1221.334] (-1221.109) * (-1222.911) (-1223.039) [-1221.478] (-1226.067) -- 0:00:33
608000 -- (-1223.439) (-1221.670) (-1223.093) [-1223.715] * (-1224.702) (-1223.426) [-1222.450] (-1224.026) -- 0:00:33
608500 -- (-1223.260) [-1225.371] (-1226.277) (-1222.655) * [-1221.976] (-1227.361) (-1228.783) (-1222.364) -- 0:00:33
609000 -- (-1221.041) (-1222.826) (-1224.369) [-1221.404] * [-1224.684] (-1221.187) (-1225.892) (-1222.710) -- 0:00:33
609500 -- (-1222.858) [-1222.014] (-1223.326) (-1225.273) * (-1221.465) (-1223.756) (-1224.674) [-1223.443] -- 0:00:33
610000 -- [-1224.243] (-1222.202) (-1222.576) (-1223.093) * [-1224.202] (-1224.034) (-1221.425) (-1226.039) -- 0:00:33
Average standard deviation of split frequencies: 0.007492
610500 -- (-1220.854) (-1224.928) (-1222.240) [-1222.485] * [-1221.790] (-1223.108) (-1224.358) (-1223.457) -- 0:00:33
611000 -- (-1224.707) (-1224.015) (-1224.093) [-1221.569] * (-1221.991) [-1223.135] (-1223.645) (-1224.263) -- 0:00:33
611500 -- (-1220.645) [-1221.183] (-1223.812) (-1220.886) * (-1224.268) (-1222.924) (-1224.219) [-1221.772] -- 0:00:33
612000 -- [-1221.088] (-1223.073) (-1223.356) (-1221.112) * (-1221.302) [-1220.837] (-1222.950) (-1221.767) -- 0:00:32
612500 -- [-1222.692] (-1225.016) (-1221.381) (-1220.698) * (-1225.849) (-1221.229) (-1222.724) [-1222.320] -- 0:00:32
613000 -- (-1222.875) (-1222.887) (-1221.057) [-1220.937] * (-1226.286) (-1222.667) [-1225.831] (-1223.914) -- 0:00:32
613500 -- (-1223.765) [-1224.633] (-1222.276) (-1220.902) * (-1221.010) (-1221.498) (-1224.936) [-1223.173] -- 0:00:32
614000 -- (-1225.053) [-1222.840] (-1226.100) (-1220.907) * (-1222.986) (-1225.026) [-1222.494] (-1223.060) -- 0:00:33
614500 -- (-1224.739) (-1222.069) (-1224.665) [-1221.000] * (-1222.754) (-1231.401) (-1221.840) [-1223.534] -- 0:00:33
615000 -- [-1222.572] (-1222.167) (-1222.005) (-1221.791) * (-1220.822) [-1222.168] (-1226.152) (-1223.039) -- 0:00:33
Average standard deviation of split frequencies: 0.006581
615500 -- (-1225.502) (-1223.514) (-1221.078) [-1221.946] * (-1221.951) (-1222.171) [-1224.537] (-1226.128) -- 0:00:33
616000 -- (-1222.335) [-1223.696] (-1223.145) (-1223.956) * (-1224.966) [-1223.028] (-1224.947) (-1222.868) -- 0:00:33
616500 -- (-1221.815) (-1225.044) (-1222.427) [-1222.974] * (-1225.008) (-1223.763) (-1223.342) [-1227.931] -- 0:00:32
617000 -- [-1224.077] (-1224.353) (-1221.724) (-1226.873) * (-1222.084) (-1223.170) [-1223.144] (-1223.900) -- 0:00:32
617500 -- (-1222.272) (-1224.041) (-1221.815) [-1223.350] * [-1222.451] (-1223.168) (-1222.044) (-1223.576) -- 0:00:32
618000 -- (-1225.994) (-1223.677) [-1224.823] (-1221.784) * (-1228.051) (-1222.563) (-1223.583) [-1221.733] -- 0:00:32
618500 -- [-1227.795] (-1226.036) (-1225.813) (-1221.956) * (-1224.714) (-1224.515) [-1225.412] (-1225.383) -- 0:00:32
619000 -- (-1228.721) (-1224.558) (-1224.445) [-1223.628] * (-1221.602) (-1225.085) [-1226.264] (-1226.317) -- 0:00:32
619500 -- (-1221.356) (-1225.707) [-1221.810] (-1220.680) * (-1221.127) (-1222.495) [-1222.642] (-1226.289) -- 0:00:32
620000 -- (-1223.340) (-1224.146) (-1222.016) [-1223.507] * (-1223.384) (-1221.341) [-1220.855] (-1221.320) -- 0:00:32
Average standard deviation of split frequencies: 0.006329
620500 -- (-1221.377) [-1224.150] (-1223.027) (-1221.852) * [-1224.934] (-1223.058) (-1220.964) (-1222.139) -- 0:00:32
621000 -- (-1221.914) (-1224.446) [-1222.635] (-1221.131) * (-1226.837) (-1223.330) [-1223.650] (-1221.702) -- 0:00:32
621500 -- (-1221.511) [-1222.465] (-1226.118) (-1223.459) * [-1224.176] (-1221.732) (-1225.446) (-1223.882) -- 0:00:32
622000 -- (-1221.492) (-1222.221) [-1222.914] (-1224.045) * (-1222.442) (-1225.629) [-1221.736] (-1224.574) -- 0:00:32
622500 -- [-1223.578] (-1223.432) (-1221.461) (-1221.150) * (-1221.666) (-1223.212) (-1223.014) [-1222.196] -- 0:00:32
623000 -- (-1224.926) [-1223.529] (-1222.370) (-1223.308) * (-1222.927) (-1226.816) (-1225.602) [-1221.425] -- 0:00:32
623500 -- (-1225.917) (-1225.671) [-1221.824] (-1223.857) * (-1222.657) [-1224.093] (-1222.791) (-1222.509) -- 0:00:32
624000 -- (-1222.508) (-1223.558) (-1224.390) [-1220.984] * [-1226.259] (-1221.703) (-1225.982) (-1222.772) -- 0:00:31
624500 -- (-1221.201) (-1223.100) [-1223.656] (-1223.822) * (-1225.461) (-1222.137) (-1223.154) [-1221.545] -- 0:00:31
625000 -- (-1226.009) [-1221.387] (-1222.872) (-1227.224) * (-1222.584) (-1222.684) (-1224.291) [-1220.676] -- 0:00:31
Average standard deviation of split frequencies: 0.006966
625500 -- [-1221.372] (-1220.755) (-1224.028) (-1224.010) * (-1221.507) (-1223.014) [-1221.925] (-1222.331) -- 0:00:32
626000 -- [-1223.470] (-1220.821) (-1225.071) (-1224.358) * (-1220.505) [-1222.212] (-1221.875) (-1226.295) -- 0:00:32
626500 -- [-1223.543] (-1224.417) (-1222.381) (-1223.890) * (-1223.712) (-1222.339) (-1223.173) [-1222.414] -- 0:00:32
627000 -- [-1225.017] (-1220.646) (-1221.130) (-1222.998) * (-1223.287) (-1221.998) (-1223.339) [-1222.967] -- 0:00:32
627500 -- (-1222.882) (-1221.185) [-1220.787] (-1222.879) * [-1221.827] (-1223.045) (-1221.325) (-1222.309) -- 0:00:32
628000 -- [-1221.065] (-1222.890) (-1221.306) (-1222.773) * [-1222.626] (-1221.921) (-1223.655) (-1220.611) -- 0:00:31
628500 -- (-1221.425) (-1222.639) (-1222.606) [-1226.750] * (-1226.296) [-1221.523] (-1223.335) (-1221.388) -- 0:00:31
629000 -- (-1222.991) (-1221.945) [-1223.612] (-1228.386) * (-1227.492) [-1220.734] (-1223.492) (-1223.423) -- 0:00:31
629500 -- (-1223.149) (-1224.665) [-1228.996] (-1222.152) * [-1222.495] (-1223.613) (-1222.335) (-1223.603) -- 0:00:31
630000 -- [-1222.535] (-1223.919) (-1222.546) (-1221.627) * [-1225.551] (-1222.824) (-1221.421) (-1223.598) -- 0:00:31
Average standard deviation of split frequencies: 0.006578
630500 -- (-1220.507) [-1224.212] (-1222.423) (-1222.194) * (-1224.458) [-1221.364] (-1225.714) (-1222.400) -- 0:00:31
631000 -- (-1222.653) [-1223.483] (-1221.143) (-1221.262) * (-1224.724) (-1222.727) [-1221.425] (-1223.587) -- 0:00:31
631500 -- (-1222.705) [-1221.962] (-1223.248) (-1222.000) * (-1221.573) (-1224.315) (-1221.604) [-1221.291] -- 0:00:31
632000 -- (-1222.164) (-1228.239) [-1220.760] (-1224.022) * (-1228.797) [-1224.057] (-1221.043) (-1221.646) -- 0:00:31
632500 -- (-1223.804) [-1225.444] (-1220.823) (-1222.881) * (-1229.713) (-1226.030) [-1223.528] (-1222.812) -- 0:00:31
633000 -- (-1222.499) (-1223.866) (-1221.202) [-1222.599] * (-1226.198) (-1224.456) [-1222.697] (-1222.869) -- 0:00:31
633500 -- [-1222.342] (-1222.803) (-1221.309) (-1222.957) * (-1222.111) (-1224.121) [-1229.750] (-1222.856) -- 0:00:31
634000 -- (-1222.240) (-1223.710) (-1222.285) [-1221.364] * (-1222.797) (-1222.592) [-1225.483] (-1222.076) -- 0:00:31
634500 -- (-1224.288) [-1223.639] (-1222.860) (-1225.011) * (-1221.548) (-1220.671) (-1224.309) [-1220.789] -- 0:00:31
635000 -- [-1225.265] (-1222.824) (-1222.989) (-1221.188) * (-1225.306) [-1221.359] (-1224.019) (-1221.150) -- 0:00:31
Average standard deviation of split frequencies: 0.006763
635500 -- (-1227.897) (-1223.280) (-1223.321) [-1223.718] * (-1226.063) (-1221.494) [-1221.307] (-1220.933) -- 0:00:30
636000 -- [-1220.730] (-1231.544) (-1221.881) (-1226.150) * (-1222.930) (-1224.473) (-1221.425) [-1222.023] -- 0:00:30
636500 -- [-1222.693] (-1223.160) (-1222.377) (-1227.634) * [-1223.512] (-1223.951) (-1222.924) (-1221.019) -- 0:00:30
637000 -- (-1223.066) (-1220.991) [-1220.621] (-1222.174) * (-1221.271) (-1222.798) (-1223.336) [-1221.068] -- 0:00:31
637500 -- (-1222.813) (-1224.043) [-1220.974] (-1221.014) * [-1223.128] (-1223.747) (-1221.708) (-1224.944) -- 0:00:31
638000 -- (-1223.911) (-1222.020) [-1221.486] (-1224.013) * (-1222.177) (-1223.525) (-1222.648) [-1224.259] -- 0:00:31
638500 -- (-1224.471) (-1225.724) [-1221.297] (-1224.524) * (-1221.883) [-1224.283] (-1226.806) (-1225.355) -- 0:00:31
639000 -- (-1223.791) (-1223.006) [-1221.634] (-1222.526) * (-1224.019) (-1221.654) (-1224.682) [-1223.928] -- 0:00:31
639500 -- (-1222.606) (-1224.273) [-1222.252] (-1221.896) * (-1225.472) [-1223.847] (-1223.058) (-1222.070) -- 0:00:31
640000 -- (-1225.741) (-1226.981) [-1222.401] (-1222.915) * (-1228.370) (-1225.507) (-1225.799) [-1221.576] -- 0:00:30
Average standard deviation of split frequencies: 0.006944
640500 -- (-1223.931) (-1225.661) [-1222.739] (-1223.101) * (-1223.101) (-1223.705) [-1224.794] (-1226.214) -- 0:00:30
641000 -- (-1223.249) [-1223.302] (-1224.027) (-1222.622) * (-1225.231) (-1222.084) [-1225.088] (-1227.580) -- 0:00:30
641500 -- (-1224.862) (-1222.353) [-1222.048] (-1223.715) * [-1228.871] (-1221.371) (-1220.564) (-1223.115) -- 0:00:30
642000 -- [-1225.005] (-1223.247) (-1226.381) (-1221.919) * [-1228.589] (-1221.385) (-1222.827) (-1222.945) -- 0:00:30
642500 -- [-1221.025] (-1223.851) (-1222.609) (-1221.419) * (-1225.077) (-1221.851) [-1224.622] (-1224.613) -- 0:00:30
643000 -- (-1223.286) [-1223.850] (-1223.513) (-1222.022) * (-1227.320) [-1222.088] (-1223.168) (-1225.586) -- 0:00:30
643500 -- (-1222.667) (-1222.684) (-1224.392) [-1222.022] * (-1224.808) (-1223.168) [-1223.798] (-1222.417) -- 0:00:30
644000 -- [-1222.726] (-1225.801) (-1222.746) (-1224.226) * (-1221.177) (-1222.982) [-1220.984] (-1221.438) -- 0:00:30
644500 -- (-1222.703) (-1222.701) (-1222.099) [-1224.458] * [-1221.002] (-1226.013) (-1222.286) (-1221.631) -- 0:00:30
645000 -- (-1225.351) [-1223.297] (-1221.305) (-1221.549) * [-1221.478] (-1223.900) (-1225.082) (-1222.765) -- 0:00:30
Average standard deviation of split frequencies: 0.006431
645500 -- (-1225.265) (-1223.775) (-1222.990) [-1221.762] * [-1222.507] (-1223.444) (-1221.821) (-1222.177) -- 0:00:30
646000 -- (-1225.099) (-1222.297) (-1224.488) [-1220.893] * (-1222.916) [-1221.397] (-1221.167) (-1224.143) -- 0:00:30
646500 -- (-1220.794) (-1222.164) (-1222.632) [-1223.580] * (-1223.129) [-1222.204] (-1222.466) (-1223.930) -- 0:00:30
647000 -- (-1221.921) (-1226.539) [-1221.622] (-1224.107) * [-1222.287] (-1228.782) (-1225.223) (-1220.811) -- 0:00:30
647500 -- [-1223.392] (-1225.049) (-1223.403) (-1223.207) * (-1222.825) (-1223.281) (-1224.745) [-1221.087] -- 0:00:29
648000 -- [-1222.673] (-1225.612) (-1222.129) (-1224.985) * (-1222.453) (-1223.244) [-1222.928] (-1221.244) -- 0:00:29
648500 -- [-1224.887] (-1227.123) (-1223.547) (-1230.154) * [-1223.408] (-1222.109) (-1221.891) (-1225.704) -- 0:00:29
649000 -- (-1225.003) (-1221.246) (-1223.317) [-1222.420] * [-1223.009] (-1222.363) (-1220.878) (-1225.748) -- 0:00:30
649500 -- (-1224.042) (-1226.258) [-1222.671] (-1224.717) * (-1221.721) [-1221.922] (-1222.305) (-1222.536) -- 0:00:30
650000 -- (-1223.632) (-1224.477) [-1225.332] (-1221.961) * (-1221.016) (-1221.878) [-1224.295] (-1224.356) -- 0:00:30
Average standard deviation of split frequencies: 0.006068
650500 -- [-1223.663] (-1223.340) (-1221.030) (-1220.828) * (-1222.116) (-1224.080) [-1223.112] (-1224.832) -- 0:00:30
651000 -- (-1223.648) (-1223.984) [-1223.093] (-1221.312) * (-1225.168) (-1224.360) (-1222.124) [-1229.607] -- 0:00:30
651500 -- (-1227.793) (-1225.922) (-1226.119) [-1222.594] * [-1222.823] (-1224.658) (-1223.036) (-1223.334) -- 0:00:29
652000 -- [-1226.774] (-1224.353) (-1221.199) (-1229.075) * (-1223.191) (-1222.938) (-1221.302) [-1222.486] -- 0:00:29
652500 -- (-1221.234) (-1224.579) [-1221.754] (-1223.031) * (-1222.331) [-1223.163] (-1224.780) (-1223.856) -- 0:00:29
653000 -- (-1222.209) (-1223.182) [-1223.459] (-1222.893) * (-1222.023) (-1221.232) [-1226.869] (-1222.041) -- 0:00:29
653500 -- (-1222.297) [-1224.782] (-1223.475) (-1223.215) * (-1222.309) (-1221.484) (-1222.486) [-1224.184] -- 0:00:29
654000 -- [-1222.768] (-1222.322) (-1225.148) (-1223.087) * (-1221.163) (-1224.206) [-1222.799] (-1224.717) -- 0:00:29
654500 -- (-1223.664) [-1221.205] (-1222.601) (-1221.396) * (-1222.343) (-1221.466) [-1223.097] (-1224.670) -- 0:00:29
655000 -- (-1225.212) (-1221.488) [-1222.773] (-1224.004) * (-1222.717) (-1223.350) [-1222.230] (-1223.574) -- 0:00:29
Average standard deviation of split frequencies: 0.006378
655500 -- [-1221.186] (-1222.455) (-1223.060) (-1223.150) * (-1225.465) [-1221.497] (-1222.344) (-1230.795) -- 0:00:29
656000 -- [-1222.176] (-1222.265) (-1221.335) (-1226.338) * (-1223.476) [-1222.219] (-1223.008) (-1223.408) -- 0:00:29
656500 -- (-1223.018) (-1222.436) [-1223.066] (-1222.030) * [-1222.817] (-1221.987) (-1230.025) (-1223.677) -- 0:00:29
657000 -- [-1223.163] (-1223.628) (-1222.272) (-1223.300) * (-1224.032) (-1220.853) [-1226.062] (-1223.308) -- 0:00:29
657500 -- (-1223.330) [-1222.948] (-1221.647) (-1223.498) * (-1222.610) (-1222.247) [-1223.992] (-1222.956) -- 0:00:29
658000 -- (-1221.759) [-1224.094] (-1222.766) (-1225.500) * (-1223.686) (-1223.126) (-1222.507) [-1224.854] -- 0:00:29
658500 -- (-1220.753) (-1226.964) [-1223.119] (-1223.939) * (-1222.607) (-1222.358) (-1223.321) [-1223.823] -- 0:00:29
659000 -- [-1221.180] (-1223.693) (-1224.965) (-1221.113) * [-1222.854] (-1223.663) (-1222.158) (-1222.104) -- 0:00:28
659500 -- (-1221.129) [-1221.145] (-1221.775) (-1222.128) * (-1224.521) (-1223.773) [-1224.104] (-1222.773) -- 0:00:28
660000 -- (-1230.096) (-1220.900) [-1223.569] (-1223.024) * [-1221.918] (-1222.163) (-1221.906) (-1225.125) -- 0:00:28
Average standard deviation of split frequencies: 0.007001
660500 -- (-1221.469) (-1222.280) [-1221.005] (-1222.618) * (-1222.018) (-1222.060) [-1225.433] (-1225.259) -- 0:00:29
661000 -- (-1225.835) (-1225.959) [-1220.755] (-1222.378) * (-1221.670) (-1222.339) (-1224.684) [-1224.635] -- 0:00:29
661500 -- (-1223.244) [-1223.271] (-1221.781) (-1226.323) * (-1222.491) [-1223.971] (-1227.795) (-1223.212) -- 0:00:29
662000 -- [-1225.947] (-1221.464) (-1224.676) (-1224.276) * (-1223.818) [-1220.704] (-1221.322) (-1222.922) -- 0:00:29
662500 -- [-1226.482] (-1221.043) (-1222.794) (-1221.532) * (-1227.803) [-1221.789] (-1226.362) (-1224.826) -- 0:00:29
663000 -- (-1227.028) (-1226.806) [-1223.842] (-1222.821) * [-1220.758] (-1221.810) (-1229.363) (-1225.503) -- 0:00:28
663500 -- (-1227.201) (-1222.739) (-1222.666) [-1222.281] * (-1220.743) [-1223.822] (-1221.622) (-1224.802) -- 0:00:28
664000 -- (-1222.406) (-1221.962) [-1220.954] (-1222.361) * [-1220.793] (-1226.111) (-1228.495) (-1223.037) -- 0:00:28
664500 -- [-1221.389] (-1227.148) (-1223.762) (-1227.964) * (-1221.854) [-1221.339] (-1224.121) (-1222.538) -- 0:00:28
665000 -- (-1221.825) (-1224.884) [-1227.586] (-1227.897) * (-1220.956) [-1222.314] (-1223.284) (-1222.930) -- 0:00:28
Average standard deviation of split frequencies: 0.006724
665500 -- (-1227.026) (-1220.881) [-1222.440] (-1228.112) * (-1222.396) (-1223.511) [-1222.115] (-1226.890) -- 0:00:28
666000 -- (-1226.635) (-1220.902) [-1222.340] (-1227.740) * (-1226.306) [-1223.061] (-1223.345) (-1226.239) -- 0:00:28
666500 -- [-1222.010] (-1220.719) (-1223.923) (-1223.094) * (-1221.776) (-1221.965) [-1223.442] (-1222.747) -- 0:00:28
667000 -- (-1223.816) (-1221.562) (-1223.648) [-1221.492] * (-1223.189) (-1221.702) (-1222.774) [-1222.441] -- 0:00:28
667500 -- (-1228.146) (-1221.527) [-1221.615] (-1227.940) * (-1223.282) (-1224.422) (-1223.027) [-1221.554] -- 0:00:28
668000 -- (-1223.877) (-1221.877) [-1221.677] (-1222.984) * (-1222.747) (-1224.314) [-1225.370] (-1221.675) -- 0:00:28
668500 -- (-1223.219) [-1222.007] (-1221.754) (-1223.803) * (-1221.988) (-1223.621) (-1223.450) [-1222.318] -- 0:00:28
669000 -- (-1221.991) (-1221.920) (-1223.637) [-1223.799] * (-1222.426) (-1222.126) (-1222.433) [-1222.500] -- 0:00:28
669500 -- (-1222.495) (-1223.657) [-1223.026] (-1223.683) * (-1222.656) (-1224.732) (-1223.050) [-1222.202] -- 0:00:28
670000 -- (-1224.956) [-1221.341] (-1225.641) (-1222.945) * [-1224.852] (-1222.434) (-1222.013) (-1221.371) -- 0:00:28
Average standard deviation of split frequencies: 0.006897
670500 -- (-1227.116) (-1221.733) [-1222.518] (-1223.197) * (-1222.034) (-1224.917) [-1223.608] (-1222.956) -- 0:00:28
671000 -- [-1223.922] (-1224.271) (-1223.458) (-1222.721) * (-1221.094) (-1221.103) [-1221.627] (-1224.148) -- 0:00:27
671500 -- (-1221.114) (-1223.026) [-1221.377] (-1226.730) * (-1228.644) (-1221.681) (-1224.773) [-1222.791] -- 0:00:27
672000 -- (-1225.010) (-1221.547) [-1224.034] (-1226.227) * (-1221.819) [-1220.645] (-1222.876) (-1221.663) -- 0:00:27
672500 -- (-1223.245) [-1222.671] (-1224.400) (-1222.099) * (-1221.344) [-1221.274] (-1227.620) (-1222.029) -- 0:00:28
673000 -- [-1223.555] (-1222.636) (-1225.522) (-1221.641) * (-1222.551) (-1221.251) [-1222.717] (-1221.869) -- 0:00:28
673500 -- (-1223.984) [-1222.592] (-1222.870) (-1226.467) * (-1221.202) [-1221.615] (-1222.393) (-1221.381) -- 0:00:28
674000 -- [-1225.824] (-1225.109) (-1222.151) (-1225.444) * (-1222.999) (-1220.963) [-1222.126] (-1223.312) -- 0:00:28
674500 -- (-1223.584) (-1225.127) [-1222.070] (-1221.994) * [-1224.622] (-1221.192) (-1222.914) (-1224.454) -- 0:00:27
675000 -- (-1223.113) [-1223.144] (-1220.883) (-1222.325) * (-1225.636) [-1221.248] (-1228.903) (-1226.872) -- 0:00:27
Average standard deviation of split frequencies: 0.006538
675500 -- (-1222.149) (-1227.747) (-1225.767) [-1221.581] * (-1223.690) [-1221.254] (-1226.552) (-1221.707) -- 0:00:27
676000 -- (-1226.130) (-1221.281) (-1222.881) [-1221.656] * [-1220.826] (-1220.866) (-1222.421) (-1222.342) -- 0:00:27
676500 -- (-1223.835) [-1226.393] (-1222.134) (-1227.507) * [-1223.321] (-1221.931) (-1221.144) (-1223.408) -- 0:00:27
677000 -- (-1221.908) (-1229.733) (-1223.717) [-1222.421] * [-1221.483] (-1222.473) (-1224.098) (-1223.407) -- 0:00:27
677500 -- (-1223.291) (-1220.885) (-1221.674) [-1221.638] * (-1225.020) [-1223.418] (-1224.500) (-1223.131) -- 0:00:27
678000 -- (-1225.161) (-1223.129) [-1222.542] (-1225.712) * (-1224.222) (-1226.215) [-1224.611] (-1222.378) -- 0:00:27
678500 -- (-1230.016) [-1222.021] (-1221.992) (-1222.124) * (-1223.963) (-1221.572) (-1225.420) [-1222.250] -- 0:00:27
679000 -- (-1223.896) [-1221.420] (-1220.968) (-1222.671) * (-1223.621) (-1221.261) (-1223.635) [-1222.393] -- 0:00:27
679500 -- (-1223.837) (-1221.474) [-1223.112] (-1221.065) * (-1223.709) [-1223.282] (-1222.551) (-1222.409) -- 0:00:27
680000 -- [-1222.266] (-1221.774) (-1225.337) (-1220.855) * (-1225.808) (-1222.527) (-1220.736) [-1221.757] -- 0:00:27
Average standard deviation of split frequencies: 0.006579
680500 -- [-1223.610] (-1225.341) (-1225.173) (-1225.589) * [-1227.657] (-1221.854) (-1221.796) (-1222.218) -- 0:00:27
681000 -- (-1228.773) (-1223.949) (-1221.679) [-1222.407] * (-1223.423) (-1224.321) [-1221.607] (-1221.230) -- 0:00:27
681500 -- [-1226.637] (-1231.993) (-1224.120) (-1227.921) * (-1226.613) (-1220.941) (-1221.155) [-1221.407] -- 0:00:27
682000 -- (-1223.462) (-1224.136) [-1223.733] (-1224.491) * (-1227.728) (-1224.955) [-1223.825] (-1224.540) -- 0:00:27
682500 -- (-1224.693) (-1222.373) [-1221.383] (-1225.695) * (-1222.946) [-1221.497] (-1222.484) (-1227.919) -- 0:00:26
683000 -- [-1223.435] (-1225.360) (-1221.569) (-1226.570) * (-1224.630) [-1222.878] (-1223.231) (-1227.512) -- 0:00:26
683500 -- (-1221.209) [-1224.393] (-1223.934) (-1226.391) * (-1222.577) (-1225.954) [-1222.916] (-1220.938) -- 0:00:26
684000 -- (-1224.012) [-1223.230] (-1223.469) (-1222.856) * (-1221.244) (-1221.079) (-1221.650) [-1223.362] -- 0:00:26
684500 -- (-1223.963) (-1221.161) (-1222.298) [-1224.073] * [-1221.593] (-1221.951) (-1221.419) (-1227.590) -- 0:00:27
685000 -- (-1221.975) (-1222.321) (-1221.408) [-1222.543] * [-1222.123] (-1220.891) (-1222.636) (-1223.425) -- 0:00:27
Average standard deviation of split frequencies: 0.006442
685500 -- (-1222.927) (-1224.731) [-1221.047] (-1221.778) * (-1222.106) (-1221.548) (-1221.851) [-1224.470] -- 0:00:27
686000 -- (-1223.248) (-1224.198) (-1221.210) [-1222.444] * (-1222.280) (-1225.487) [-1221.261] (-1224.727) -- 0:00:27
686500 -- (-1222.659) [-1222.230] (-1223.684) (-1227.424) * (-1222.992) (-1224.338) [-1223.023] (-1224.354) -- 0:00:26
687000 -- (-1224.059) (-1221.019) (-1223.968) [-1220.989] * (-1225.129) [-1222.449] (-1222.811) (-1224.868) -- 0:00:26
687500 -- [-1223.809] (-1222.905) (-1223.968) (-1222.036) * (-1223.828) [-1221.871] (-1221.834) (-1222.049) -- 0:00:26
688000 -- (-1222.513) [-1222.561] (-1220.887) (-1222.002) * (-1224.351) (-1222.657) [-1222.928] (-1223.208) -- 0:00:26
688500 -- (-1224.838) (-1222.754) (-1222.237) [-1221.488] * [-1220.922] (-1223.248) (-1223.711) (-1223.958) -- 0:00:26
689000 -- [-1222.465] (-1221.321) (-1225.731) (-1222.106) * (-1222.122) (-1223.852) [-1221.405] (-1221.934) -- 0:00:26
689500 -- [-1222.373] (-1222.854) (-1228.700) (-1223.501) * (-1220.895) (-1223.602) (-1221.422) [-1221.736] -- 0:00:26
690000 -- (-1220.715) (-1222.393) (-1222.136) [-1222.595] * (-1223.213) (-1223.601) (-1226.502) [-1224.941] -- 0:00:26
Average standard deviation of split frequencies: 0.006185
690500 -- (-1220.935) (-1222.688) (-1222.627) [-1222.176] * [-1222.846] (-1224.123) (-1225.360) (-1223.140) -- 0:00:26
691000 -- [-1220.878] (-1224.419) (-1222.998) (-1225.296) * (-1222.169) (-1227.916) (-1227.051) [-1222.661] -- 0:00:26
691500 -- (-1220.908) (-1223.747) [-1223.046] (-1220.561) * (-1221.075) (-1225.143) [-1225.106] (-1222.116) -- 0:00:26
692000 -- (-1221.522) [-1222.694] (-1222.999) (-1222.338) * (-1222.090) [-1224.644] (-1221.995) (-1224.077) -- 0:00:26
692500 -- (-1222.804) (-1225.208) [-1221.116] (-1221.045) * (-1222.190) (-1221.753) (-1224.828) [-1222.168] -- 0:00:26
693000 -- (-1221.860) [-1221.603] (-1225.468) (-1225.214) * [-1222.503] (-1222.262) (-1223.618) (-1223.912) -- 0:00:26
693500 -- (-1223.824) (-1226.748) (-1227.351) [-1222.613] * (-1222.035) (-1224.985) [-1222.410] (-1228.458) -- 0:00:26
694000 -- (-1223.221) (-1223.442) (-1221.989) [-1221.547] * [-1221.636] (-1223.805) (-1222.675) (-1226.370) -- 0:00:26
694500 -- (-1222.843) (-1221.093) [-1222.313] (-1223.148) * [-1222.646] (-1227.961) (-1226.644) (-1223.504) -- 0:00:25
695000 -- (-1225.360) [-1221.096] (-1225.692) (-1222.813) * (-1223.289) [-1228.647] (-1223.281) (-1223.953) -- 0:00:25
Average standard deviation of split frequencies: 0.005376
695500 -- (-1224.125) (-1223.835) [-1221.702] (-1221.986) * [-1222.311] (-1225.318) (-1223.551) (-1225.406) -- 0:00:25
696000 -- (-1225.503) (-1223.512) [-1222.276] (-1220.868) * (-1226.217) (-1225.363) (-1222.589) [-1225.952] -- 0:00:26
696500 -- [-1222.465] (-1223.734) (-1221.660) (-1221.370) * (-1221.990) (-1224.915) [-1222.666] (-1221.136) -- 0:00:26
697000 -- [-1222.584] (-1223.299) (-1222.704) (-1220.737) * (-1222.223) (-1221.453) (-1223.263) [-1227.929] -- 0:00:26
697500 -- [-1224.833] (-1221.159) (-1220.578) (-1220.920) * [-1222.126] (-1221.663) (-1228.614) (-1221.591) -- 0:00:26
698000 -- (-1221.518) [-1222.306] (-1223.248) (-1220.916) * (-1227.067) [-1222.150] (-1228.813) (-1222.681) -- 0:00:25
698500 -- [-1221.158] (-1228.003) (-1224.590) (-1225.218) * (-1227.338) [-1223.395] (-1227.679) (-1225.165) -- 0:00:25
699000 -- (-1223.500) (-1227.144) (-1221.191) [-1222.746] * (-1222.226) (-1225.495) (-1223.034) [-1221.966] -- 0:00:25
699500 -- (-1226.149) [-1221.107] (-1222.206) (-1225.562) * [-1222.261] (-1226.964) (-1224.857) (-1223.812) -- 0:00:25
700000 -- (-1222.208) [-1224.213] (-1221.639) (-1222.244) * (-1223.569) (-1221.253) [-1222.748] (-1221.430) -- 0:00:25
Average standard deviation of split frequencies: 0.005761
700500 -- [-1224.332] (-1222.967) (-1222.762) (-1221.719) * [-1221.433] (-1222.919) (-1221.714) (-1223.568) -- 0:00:25
701000 -- (-1222.826) (-1225.020) [-1223.777] (-1220.953) * (-1221.244) (-1223.136) (-1220.950) [-1223.355] -- 0:00:25
701500 -- (-1223.509) (-1222.158) (-1224.727) [-1221.004] * [-1224.350] (-1221.023) (-1221.733) (-1224.475) -- 0:00:25
702000 -- [-1222.025] (-1222.054) (-1224.535) (-1231.842) * (-1222.598) [-1225.258] (-1222.109) (-1222.775) -- 0:00:25
702500 -- [-1220.785] (-1225.118) (-1221.946) (-1227.543) * [-1223.878] (-1228.347) (-1224.967) (-1221.745) -- 0:00:25
703000 -- [-1222.699] (-1224.986) (-1225.788) (-1228.969) * (-1222.163) [-1224.439] (-1225.193) (-1220.825) -- 0:00:25
703500 -- (-1221.322) (-1223.849) [-1222.502] (-1225.275) * (-1222.537) (-1222.408) (-1225.292) [-1220.825] -- 0:00:25
704000 -- (-1222.812) (-1227.648) (-1221.554) [-1222.512] * (-1223.162) (-1223.949) (-1228.241) [-1220.998] -- 0:00:25
704500 -- (-1223.704) (-1222.174) [-1225.907] (-1225.790) * (-1224.266) [-1223.660] (-1221.272) (-1221.032) -- 0:00:25
705000 -- (-1220.506) (-1224.180) [-1223.819] (-1222.635) * (-1223.351) (-1221.296) (-1225.981) [-1221.915] -- 0:00:25
Average standard deviation of split frequencies: 0.005884
705500 -- (-1223.974) [-1222.659] (-1226.629) (-1226.919) * [-1221.373] (-1220.665) (-1224.334) (-1222.355) -- 0:00:25
706000 -- (-1223.043) [-1222.823] (-1225.140) (-1225.246) * [-1223.202] (-1222.446) (-1222.707) (-1222.902) -- 0:00:24
706500 -- (-1224.355) (-1223.437) (-1223.977) [-1222.220] * (-1224.684) (-1223.204) [-1223.038] (-1225.408) -- 0:00:24
707000 -- (-1222.717) (-1225.330) (-1224.074) [-1221.859] * (-1222.016) (-1222.263) (-1222.450) [-1220.974] -- 0:00:24
707500 -- (-1221.442) (-1227.594) [-1222.922] (-1222.861) * (-1222.001) (-1225.880) [-1225.861] (-1223.547) -- 0:00:25
708000 -- (-1224.463) (-1225.758) (-1223.774) [-1223.190] * (-1225.018) (-1222.708) (-1225.491) [-1221.734] -- 0:00:25
708500 -- (-1221.058) [-1226.979] (-1221.545) (-1230.358) * (-1221.225) (-1221.621) (-1225.066) [-1223.822] -- 0:00:25
709000 -- (-1226.216) (-1223.831) [-1221.157] (-1227.019) * [-1222.960] (-1221.586) (-1228.016) (-1222.438) -- 0:00:25
709500 -- (-1222.470) (-1221.787) [-1222.039] (-1227.496) * (-1221.562) (-1220.890) [-1224.909] (-1223.448) -- 0:00:24
710000 -- [-1222.209] (-1224.730) (-1221.997) (-1221.432) * (-1223.266) (-1221.262) (-1222.693) [-1220.942] -- 0:00:24
Average standard deviation of split frequencies: 0.005307
710500 -- (-1222.121) (-1229.022) (-1225.832) [-1223.140] * [-1221.536] (-1221.355) (-1224.133) (-1220.622) -- 0:00:24
711000 -- (-1224.551) (-1221.446) [-1225.105] (-1222.361) * [-1223.422] (-1222.140) (-1226.729) (-1222.854) -- 0:00:24
711500 -- (-1222.873) [-1221.986] (-1224.516) (-1223.156) * (-1223.280) [-1222.394] (-1224.122) (-1221.418) -- 0:00:24
712000 -- (-1221.492) [-1223.184] (-1220.872) (-1222.362) * (-1223.446) [-1221.601] (-1224.855) (-1221.198) -- 0:00:24
712500 -- (-1221.696) [-1220.922] (-1222.152) (-1221.340) * (-1223.781) [-1221.638] (-1221.735) (-1223.426) -- 0:00:24
713000 -- [-1220.867] (-1222.869) (-1222.425) (-1221.702) * (-1223.877) (-1222.975) [-1221.443] (-1221.687) -- 0:00:24
713500 -- (-1223.995) (-1224.095) (-1221.041) [-1221.811] * (-1223.873) (-1227.653) (-1221.216) [-1221.834] -- 0:00:24
714000 -- (-1222.157) [-1223.280] (-1223.476) (-1222.575) * (-1224.319) [-1223.161] (-1222.873) (-1221.690) -- 0:00:24
714500 -- (-1222.044) [-1221.855] (-1225.214) (-1223.868) * (-1221.295) (-1225.482) [-1222.015] (-1224.745) -- 0:00:24
715000 -- (-1222.510) [-1221.682] (-1223.075) (-1225.001) * [-1221.399] (-1228.114) (-1226.342) (-1222.177) -- 0:00:24
Average standard deviation of split frequencies: 0.005223
715500 -- (-1224.789) (-1221.559) [-1223.545] (-1223.137) * (-1223.082) [-1229.979] (-1223.186) (-1222.718) -- 0:00:24
716000 -- (-1223.124) (-1221.197) (-1223.417) [-1221.567] * [-1222.123] (-1228.409) (-1224.488) (-1221.696) -- 0:00:24
716500 -- (-1225.705) [-1221.850] (-1221.389) (-1227.536) * (-1225.383) (-1228.910) [-1226.160] (-1221.149) -- 0:00:24
717000 -- (-1223.952) (-1221.047) [-1222.205] (-1223.871) * [-1222.089] (-1225.885) (-1222.917) (-1221.032) -- 0:00:24
717500 -- (-1224.819) (-1222.680) [-1221.743] (-1223.114) * (-1221.634) (-1228.809) [-1221.345] (-1224.610) -- 0:00:24
718000 -- (-1221.672) (-1222.265) (-1223.562) [-1221.151] * [-1224.377] (-1221.359) (-1222.290) (-1224.966) -- 0:00:23
718500 -- (-1224.045) (-1226.833) (-1224.460) [-1225.221] * (-1225.758) (-1222.441) [-1222.417] (-1226.236) -- 0:00:23
719000 -- (-1223.754) [-1224.637] (-1225.209) (-1222.806) * (-1224.007) [-1221.369] (-1223.595) (-1223.530) -- 0:00:24
719500 -- (-1221.861) (-1224.490) (-1223.399) [-1220.675] * [-1225.095] (-1222.985) (-1229.377) (-1221.508) -- 0:00:24
720000 -- (-1222.681) (-1222.754) (-1222.857) [-1220.792] * (-1224.488) (-1223.344) (-1223.830) [-1221.465] -- 0:00:24
Average standard deviation of split frequencies: 0.005189
720500 -- (-1222.866) (-1221.237) [-1223.106] (-1222.010) * (-1224.311) (-1222.989) [-1225.882] (-1224.567) -- 0:00:24
721000 -- (-1221.334) (-1221.112) (-1221.557) [-1225.341] * [-1222.266] (-1221.136) (-1223.907) (-1226.612) -- 0:00:23
721500 -- [-1225.951] (-1222.511) (-1220.858) (-1223.978) * [-1222.988] (-1220.814) (-1223.700) (-1225.588) -- 0:00:23
722000 -- [-1221.622] (-1221.547) (-1226.301) (-1222.592) * (-1224.637) (-1221.801) [-1223.814] (-1220.973) -- 0:00:23
722500 -- (-1222.520) (-1222.420) [-1221.781] (-1222.383) * (-1224.436) (-1225.245) (-1223.022) [-1221.034] -- 0:00:23
723000 -- (-1223.676) (-1221.083) [-1222.338] (-1221.962) * (-1225.438) (-1224.959) [-1222.100] (-1221.951) -- 0:00:23
723500 -- [-1223.668] (-1220.692) (-1221.036) (-1221.715) * (-1221.782) (-1221.298) (-1222.780) [-1227.908] -- 0:00:23
724000 -- (-1224.805) (-1224.044) [-1221.036] (-1221.794) * (-1221.594) [-1222.495] (-1224.599) (-1222.222) -- 0:00:23
724500 -- (-1220.859) (-1222.026) (-1222.910) [-1221.396] * (-1225.652) [-1222.620] (-1223.674) (-1223.148) -- 0:00:23
725000 -- [-1222.443] (-1221.441) (-1221.269) (-1223.151) * (-1224.033) [-1224.692] (-1222.205) (-1221.117) -- 0:00:23
Average standard deviation of split frequencies: 0.005368
725500 -- (-1223.334) (-1221.387) [-1222.915] (-1224.942) * (-1221.822) (-1224.446) [-1221.638] (-1221.095) -- 0:00:23
726000 -- (-1222.793) [-1224.478] (-1224.070) (-1222.269) * (-1222.543) [-1221.947] (-1221.575) (-1224.549) -- 0:00:23
726500 -- (-1222.116) (-1221.916) [-1221.652] (-1222.714) * (-1221.662) [-1224.212] (-1222.908) (-1229.594) -- 0:00:23
727000 -- [-1222.492] (-1222.030) (-1230.664) (-1224.518) * [-1222.555] (-1223.251) (-1221.431) (-1226.391) -- 0:00:23
727500 -- [-1226.774] (-1222.444) (-1229.545) (-1223.031) * [-1225.539] (-1223.062) (-1222.908) (-1223.376) -- 0:00:23
728000 -- (-1223.973) (-1228.045) [-1223.336] (-1221.145) * (-1222.752) (-1224.799) (-1222.598) [-1226.738] -- 0:00:23
728500 -- (-1222.541) (-1223.774) (-1223.844) [-1226.319] * (-1221.796) (-1222.147) [-1223.393] (-1223.666) -- 0:00:23
729000 -- (-1222.285) (-1225.054) [-1223.813] (-1222.547) * (-1226.541) [-1221.349] (-1222.793) (-1223.627) -- 0:00:23
729500 -- (-1226.075) (-1221.736) (-1222.283) [-1224.169] * (-1222.131) [-1220.749] (-1221.833) (-1222.657) -- 0:00:22
730000 -- [-1221.310] (-1224.359) (-1222.614) (-1223.065) * (-1224.333) (-1220.474) (-1222.287) [-1222.864] -- 0:00:22
Average standard deviation of split frequencies: 0.005290
730500 -- [-1222.297] (-1225.383) (-1223.113) (-1222.632) * (-1221.677) [-1220.664] (-1221.568) (-1222.423) -- 0:00:23
731000 -- (-1227.375) [-1221.993] (-1225.487) (-1222.172) * [-1221.172] (-1220.968) (-1222.039) (-1226.995) -- 0:00:23
731500 -- (-1225.322) [-1221.507] (-1224.027) (-1224.997) * (-1221.273) (-1221.565) (-1222.562) [-1222.169] -- 0:00:23
732000 -- [-1224.361] (-1223.161) (-1223.827) (-1223.251) * [-1221.717] (-1220.786) (-1224.888) (-1225.461) -- 0:00:23
732500 -- (-1226.030) (-1222.804) (-1221.230) [-1223.435] * (-1224.938) (-1226.178) (-1223.046) [-1221.485] -- 0:00:23
733000 -- [-1223.867] (-1225.604) (-1224.228) (-1222.633) * (-1227.904) [-1225.120] (-1223.987) (-1223.028) -- 0:00:22
733500 -- (-1227.116) [-1222.078] (-1223.037) (-1222.710) * (-1226.302) (-1223.597) (-1223.987) [-1222.351] -- 0:00:22
734000 -- (-1221.451) (-1223.077) [-1223.428] (-1221.324) * (-1223.521) [-1224.163] (-1221.165) (-1227.982) -- 0:00:22
734500 -- [-1225.667] (-1221.912) (-1224.492) (-1221.874) * (-1228.313) (-1222.871) [-1220.918] (-1222.815) -- 0:00:22
735000 -- (-1222.575) (-1222.520) [-1224.221] (-1223.099) * (-1222.911) [-1221.412] (-1222.220) (-1222.184) -- 0:00:22
Average standard deviation of split frequencies: 0.005039
735500 -- (-1220.964) [-1222.727] (-1222.188) (-1224.749) * [-1224.580] (-1223.891) (-1223.193) (-1223.825) -- 0:00:22
736000 -- (-1224.416) [-1222.759] (-1224.456) (-1224.692) * [-1224.658] (-1220.986) (-1225.226) (-1224.797) -- 0:00:22
736500 -- (-1224.236) [-1221.873] (-1223.553) (-1226.288) * [-1228.669] (-1221.939) (-1223.506) (-1225.297) -- 0:00:22
737000 -- (-1223.525) [-1221.241] (-1224.012) (-1223.820) * [-1221.163] (-1221.935) (-1223.543) (-1223.028) -- 0:00:22
737500 -- (-1222.153) [-1221.514] (-1224.020) (-1223.820) * (-1222.854) (-1222.041) (-1224.651) [-1225.437] -- 0:00:22
738000 -- (-1221.038) (-1222.500) (-1222.242) [-1221.595] * [-1223.174] (-1225.958) (-1224.583) (-1223.001) -- 0:00:22
738500 -- (-1221.016) (-1224.457) (-1224.339) [-1221.420] * [-1224.658] (-1224.775) (-1223.882) (-1226.696) -- 0:00:22
739000 -- (-1221.037) [-1225.091] (-1225.745) (-1225.804) * (-1222.288) [-1226.947] (-1226.500) (-1221.063) -- 0:00:22
739500 -- (-1222.078) (-1225.628) (-1223.352) [-1226.381] * (-1222.519) (-1222.234) [-1221.108] (-1221.495) -- 0:00:22
740000 -- [-1223.005] (-1221.556) (-1223.314) (-1223.552) * (-1223.023) (-1224.340) (-1221.048) [-1222.093] -- 0:00:22
Average standard deviation of split frequencies: 0.005261
740500 -- (-1226.549) [-1223.404] (-1223.225) (-1225.188) * [-1223.372] (-1225.519) (-1221.431) (-1226.416) -- 0:00:22
741000 -- (-1228.101) [-1223.470] (-1221.861) (-1224.402) * (-1224.654) [-1226.055] (-1226.904) (-1226.585) -- 0:00:22
741500 -- (-1222.532) (-1221.701) (-1226.379) [-1223.066] * [-1221.440] (-1222.030) (-1227.472) (-1221.788) -- 0:00:21
742000 -- [-1222.651] (-1222.269) (-1223.655) (-1223.204) * (-1226.741) (-1223.212) (-1221.788) [-1224.188] -- 0:00:21
742500 -- (-1224.331) [-1221.845] (-1221.415) (-1222.222) * (-1223.695) [-1223.351] (-1222.074) (-1223.210) -- 0:00:22
743000 -- (-1222.521) (-1227.002) (-1222.113) [-1221.432] * [-1222.130] (-1222.676) (-1223.613) (-1222.553) -- 0:00:22
743500 -- (-1222.147) [-1223.944] (-1221.974) (-1222.233) * (-1224.873) [-1222.374] (-1221.683) (-1227.561) -- 0:00:22
744000 -- (-1221.060) (-1221.390) (-1226.951) [-1221.894] * (-1224.731) (-1224.301) [-1221.768] (-1227.005) -- 0:00:22
744500 -- (-1222.587) [-1222.628] (-1224.144) (-1221.776) * [-1226.596] (-1230.042) (-1226.321) (-1221.060) -- 0:00:21
745000 -- (-1222.250) (-1225.711) [-1220.999] (-1225.358) * (-1224.003) [-1222.912] (-1223.499) (-1221.370) -- 0:00:21
Average standard deviation of split frequencies: 0.005434
745500 -- (-1223.202) [-1223.084] (-1223.912) (-1225.008) * [-1221.465] (-1223.667) (-1222.502) (-1221.434) -- 0:00:21
746000 -- (-1224.252) (-1223.030) (-1222.197) [-1223.320] * [-1222.463] (-1222.318) (-1222.208) (-1220.593) -- 0:00:21
746500 -- [-1224.678] (-1221.179) (-1220.845) (-1221.831) * (-1222.956) [-1222.309] (-1225.072) (-1223.117) -- 0:00:21
747000 -- (-1227.150) (-1220.984) (-1222.231) [-1221.296] * (-1221.456) (-1223.504) [-1221.241] (-1223.133) -- 0:00:21
747500 -- [-1226.238] (-1222.413) (-1222.238) (-1224.995) * [-1222.687] (-1222.749) (-1222.114) (-1222.369) -- 0:00:21
748000 -- [-1223.845] (-1224.448) (-1221.697) (-1221.652) * (-1221.993) (-1224.364) (-1222.643) [-1221.070] -- 0:00:21
748500 -- (-1226.190) (-1224.955) [-1222.905] (-1223.297) * (-1223.586) [-1222.605] (-1222.645) (-1223.134) -- 0:00:21
749000 -- (-1225.639) (-1221.393) (-1224.896) [-1221.165] * [-1223.316] (-1221.231) (-1224.741) (-1225.657) -- 0:00:21
749500 -- (-1223.008) [-1221.956] (-1224.488) (-1221.468) * (-1225.826) (-1220.941) [-1224.246] (-1226.746) -- 0:00:21
750000 -- (-1223.132) (-1225.498) [-1225.475] (-1222.039) * (-1223.095) (-1221.523) (-1223.909) [-1223.031] -- 0:00:21
Average standard deviation of split frequencies: 0.005233
750500 -- (-1224.696) [-1221.986] (-1222.722) (-1227.332) * (-1222.555) (-1226.881) [-1225.045] (-1223.158) -- 0:00:21
751000 -- [-1224.248] (-1224.881) (-1222.952) (-1227.114) * [-1221.905] (-1226.639) (-1223.047) (-1222.642) -- 0:00:21
751500 -- (-1222.776) [-1221.566] (-1220.456) (-1223.251) * (-1225.112) (-1226.702) [-1224.392] (-1221.431) -- 0:00:21
752000 -- (-1223.322) (-1225.329) [-1221.268] (-1222.191) * (-1224.615) (-1232.395) (-1224.067) [-1220.501] -- 0:00:21
752500 -- (-1222.825) (-1223.553) (-1226.164) [-1221.635] * (-1221.308) (-1225.719) (-1222.843) [-1220.781] -- 0:00:21
753000 -- (-1221.787) (-1222.437) [-1221.720] (-1222.518) * (-1221.851) (-1223.371) (-1229.440) [-1221.742] -- 0:00:20
753500 -- (-1226.615) (-1224.570) (-1222.669) [-1223.041] * (-1221.619) (-1221.694) (-1229.513) [-1221.692] -- 0:00:20
754000 -- (-1222.731) (-1222.883) (-1227.924) [-1221.242] * (-1221.114) (-1221.163) [-1223.021] (-1226.265) -- 0:00:21
754500 -- (-1226.492) [-1222.740] (-1224.577) (-1224.193) * [-1221.130] (-1226.576) (-1222.351) (-1223.219) -- 0:00:21
755000 -- (-1221.039) (-1222.709) (-1226.711) [-1226.804] * (-1222.069) [-1225.281] (-1222.791) (-1222.123) -- 0:00:21
Average standard deviation of split frequencies: 0.005113
755500 -- (-1227.029) (-1226.364) [-1221.636] (-1221.616) * (-1221.083) (-1221.848) [-1223.978] (-1222.636) -- 0:00:21
756000 -- [-1223.286] (-1222.083) (-1224.372) (-1221.412) * [-1221.271] (-1224.595) (-1226.563) (-1222.470) -- 0:00:20
756500 -- [-1223.566] (-1222.632) (-1222.437) (-1224.436) * [-1223.699] (-1221.845) (-1224.288) (-1222.709) -- 0:00:20
757000 -- (-1221.834) (-1227.726) (-1224.499) [-1222.830] * (-1224.273) (-1224.837) [-1223.509] (-1226.628) -- 0:00:20
757500 -- (-1221.871) [-1222.026] (-1224.647) (-1221.599) * (-1226.683) [-1221.915] (-1222.852) (-1222.940) -- 0:00:20
758000 -- (-1222.223) (-1221.020) [-1223.136] (-1224.268) * (-1227.372) [-1222.627] (-1222.936) (-1223.257) -- 0:00:20
758500 -- (-1220.681) (-1221.613) (-1227.408) [-1221.856] * (-1229.195) (-1221.188) (-1227.398) [-1223.775] -- 0:00:20
759000 -- (-1222.804) (-1222.006) (-1222.462) [-1223.819] * (-1227.188) (-1221.674) [-1222.586] (-1224.081) -- 0:00:20
759500 -- (-1222.441) [-1222.533] (-1226.478) (-1221.480) * (-1221.662) (-1222.171) (-1227.752) [-1222.531] -- 0:00:20
760000 -- (-1220.733) (-1223.095) [-1221.511] (-1224.280) * [-1225.725] (-1223.187) (-1224.935) (-1224.037) -- 0:00:20
Average standard deviation of split frequencies: 0.005371
760500 -- [-1220.959] (-1223.568) (-1222.065) (-1223.542) * (-1224.426) (-1223.627) [-1221.926] (-1223.332) -- 0:00:20
761000 -- [-1221.582] (-1224.073) (-1227.148) (-1221.958) * (-1226.203) [-1224.976] (-1222.220) (-1223.442) -- 0:00:20
761500 -- (-1224.101) (-1224.936) [-1221.691] (-1223.249) * (-1223.910) (-1223.620) [-1221.414] (-1221.343) -- 0:00:20
762000 -- (-1222.462) (-1222.792) (-1225.401) [-1221.680] * (-1222.781) (-1221.404) (-1222.642) [-1223.051] -- 0:00:20
762500 -- (-1222.464) (-1221.163) [-1224.645] (-1223.505) * (-1224.882) (-1222.357) [-1223.467] (-1221.842) -- 0:00:20
763000 -- (-1226.182) [-1223.106] (-1223.600) (-1222.129) * (-1221.372) (-1222.239) [-1224.606] (-1221.740) -- 0:00:20
763500 -- (-1225.327) (-1221.695) (-1221.666) [-1221.769] * (-1223.685) [-1221.121] (-1223.700) (-1224.878) -- 0:00:20
764000 -- [-1226.077] (-1221.894) (-1224.755) (-1220.881) * [-1222.881] (-1225.675) (-1222.896) (-1222.505) -- 0:00:20
764500 -- (-1221.651) [-1222.537] (-1221.203) (-1227.825) * [-1222.047] (-1222.188) (-1222.412) (-1225.651) -- 0:00:20
765000 -- (-1222.629) (-1224.073) [-1222.607] (-1220.970) * [-1223.917] (-1224.572) (-1224.228) (-1221.363) -- 0:00:19
Average standard deviation of split frequencies: 0.005128
765500 -- (-1223.451) (-1225.819) [-1224.961] (-1221.035) * [-1223.056] (-1226.822) (-1220.852) (-1224.954) -- 0:00:19
766000 -- (-1222.338) (-1223.787) (-1222.765) [-1220.914] * (-1223.950) (-1225.102) [-1225.798] (-1224.128) -- 0:00:20
766500 -- (-1222.851) [-1221.810] (-1225.092) (-1222.313) * (-1224.494) (-1225.325) (-1223.230) [-1223.735] -- 0:00:20
767000 -- [-1223.008] (-1227.351) (-1223.265) (-1223.697) * (-1226.877) (-1222.431) (-1225.935) [-1222.052] -- 0:00:20
767500 -- [-1225.067] (-1223.084) (-1220.682) (-1225.578) * [-1221.757] (-1221.682) (-1224.094) (-1223.450) -- 0:00:19
768000 -- [-1223.211] (-1222.878) (-1221.604) (-1227.810) * (-1221.952) [-1221.718] (-1225.989) (-1220.899) -- 0:00:19
768500 -- [-1221.388] (-1221.513) (-1221.566) (-1224.648) * (-1221.838) (-1223.505) [-1221.605] (-1221.092) -- 0:00:19
769000 -- (-1223.392) (-1223.572) [-1221.376] (-1226.116) * [-1221.343] (-1224.055) (-1223.841) (-1222.494) -- 0:00:19
769500 -- (-1221.598) (-1226.727) (-1223.541) [-1224.303] * (-1225.567) [-1222.852] (-1222.768) (-1222.853) -- 0:00:19
770000 -- [-1222.687] (-1223.151) (-1221.752) (-1222.851) * (-1224.911) (-1221.596) (-1223.584) [-1222.099] -- 0:00:19
Average standard deviation of split frequencies: 0.005179
770500 -- (-1220.719) [-1221.650] (-1221.784) (-1224.204) * (-1223.942) (-1221.921) [-1223.370] (-1223.082) -- 0:00:19
771000 -- (-1221.790) (-1223.210) [-1223.592] (-1224.388) * (-1223.177) (-1221.974) [-1223.620] (-1221.028) -- 0:00:19
771500 -- (-1223.176) [-1222.453] (-1222.820) (-1222.651) * (-1222.108) [-1224.414] (-1224.153) (-1221.707) -- 0:00:19
772000 -- (-1223.514) [-1224.896] (-1227.707) (-1222.393) * (-1221.451) (-1225.064) (-1220.964) [-1223.482] -- 0:00:19
772500 -- (-1225.949) (-1224.552) [-1226.320] (-1223.610) * (-1221.544) (-1224.227) (-1221.572) [-1222.031] -- 0:00:19
773000 -- (-1223.121) (-1225.022) (-1224.570) [-1222.120] * (-1223.669) [-1223.111] (-1221.095) (-1225.501) -- 0:00:19
773500 -- (-1222.740) (-1231.945) (-1221.246) [-1224.802] * (-1223.542) [-1224.853] (-1220.946) (-1226.698) -- 0:00:19
774000 -- (-1221.396) [-1225.447] (-1226.879) (-1221.816) * (-1221.522) (-1221.923) (-1223.189) [-1221.686] -- 0:00:19
774500 -- (-1222.227) (-1222.644) (-1223.043) [-1221.636] * (-1223.412) (-1224.873) [-1225.318] (-1228.123) -- 0:00:19
775000 -- [-1222.958] (-1223.862) (-1222.665) (-1221.454) * (-1222.674) (-1220.585) [-1222.172] (-1230.105) -- 0:00:19
Average standard deviation of split frequencies: 0.005022
775500 -- (-1222.103) (-1223.923) (-1225.718) [-1221.411] * (-1222.185) (-1220.669) [-1220.501] (-1226.509) -- 0:00:19
776000 -- (-1220.730) [-1222.080] (-1221.576) (-1220.572) * (-1222.306) (-1221.832) (-1221.055) [-1222.782] -- 0:00:19
776500 -- (-1221.598) [-1224.073] (-1227.938) (-1223.693) * (-1225.845) [-1224.715] (-1221.422) (-1221.277) -- 0:00:18
777000 -- (-1222.632) (-1224.495) [-1223.977] (-1225.694) * [-1221.416] (-1224.345) (-1221.426) (-1222.862) -- 0:00:18
777500 -- (-1223.623) (-1224.591) (-1231.186) [-1227.672] * (-1223.743) [-1225.520] (-1221.036) (-1223.716) -- 0:00:19
778000 -- (-1226.823) [-1221.613] (-1224.148) (-1230.848) * (-1221.027) [-1222.458] (-1224.302) (-1221.740) -- 0:00:19
778500 -- (-1232.204) (-1221.442) (-1222.406) [-1221.245] * (-1222.095) (-1224.840) (-1224.289) [-1222.409] -- 0:00:19
779000 -- [-1222.209] (-1221.100) (-1222.623) (-1221.412) * (-1222.282) (-1223.672) [-1222.521] (-1222.721) -- 0:00:19
779500 -- [-1221.053] (-1225.984) (-1222.419) (-1222.308) * (-1221.866) (-1223.444) [-1223.124] (-1223.671) -- 0:00:18
780000 -- (-1221.886) [-1222.459] (-1220.634) (-1222.308) * (-1221.562) [-1221.803] (-1221.007) (-1226.563) -- 0:00:18
Average standard deviation of split frequencies: 0.004791
780500 -- (-1222.275) [-1223.322] (-1222.461) (-1223.164) * (-1220.782) (-1222.605) [-1221.127] (-1224.533) -- 0:00:18
781000 -- (-1221.950) [-1222.645] (-1222.249) (-1221.489) * (-1221.092) (-1226.188) [-1222.114] (-1233.759) -- 0:00:18
781500 -- [-1223.989] (-1222.599) (-1221.889) (-1224.469) * [-1226.023] (-1225.258) (-1220.680) (-1225.545) -- 0:00:18
782000 -- (-1226.432) [-1221.046] (-1224.899) (-1225.030) * (-1225.261) (-1225.069) (-1225.212) [-1223.189] -- 0:00:18
782500 -- (-1221.268) [-1222.928] (-1221.820) (-1224.211) * (-1225.193) (-1223.097) [-1221.151] (-1224.148) -- 0:00:18
783000 -- (-1223.469) (-1221.551) (-1222.303) [-1221.217] * (-1222.064) [-1221.192] (-1221.806) (-1224.034) -- 0:00:18
783500 -- (-1221.639) (-1221.653) (-1225.028) [-1221.310] * (-1221.916) [-1224.872] (-1223.254) (-1222.075) -- 0:00:18
784000 -- (-1222.065) [-1223.271] (-1223.531) (-1221.369) * (-1222.064) (-1224.534) [-1224.490] (-1222.551) -- 0:00:18
784500 -- [-1222.935] (-1227.901) (-1226.612) (-1221.922) * (-1221.940) (-1225.278) (-1224.983) [-1223.778] -- 0:00:18
785000 -- (-1223.320) [-1227.170] (-1223.174) (-1223.568) * (-1221.610) [-1222.645] (-1223.661) (-1222.221) -- 0:00:18
Average standard deviation of split frequencies: 0.005118
785500 -- (-1222.351) [-1222.919] (-1224.317) (-1227.126) * (-1221.958) (-1221.947) (-1222.455) [-1221.000] -- 0:00:18
786000 -- (-1225.856) (-1221.421) (-1228.627) [-1223.411] * (-1223.322) (-1224.949) (-1225.528) [-1222.335] -- 0:00:18
786500 -- (-1223.987) (-1222.149) (-1222.290) [-1223.234] * [-1222.805] (-1221.635) (-1221.987) (-1222.261) -- 0:00:18
787000 -- (-1225.627) (-1224.606) (-1222.292) [-1221.231] * [-1221.452] (-1222.824) (-1221.586) (-1221.370) -- 0:00:18
787500 -- (-1224.484) [-1225.220] (-1221.581) (-1221.231) * (-1223.845) [-1221.296] (-1221.592) (-1221.049) -- 0:00:18
788000 -- (-1225.190) (-1225.290) [-1220.870] (-1221.582) * (-1221.398) (-1221.755) [-1222.815] (-1223.879) -- 0:00:18
788500 -- (-1223.944) (-1225.931) [-1221.214] (-1222.014) * (-1222.949) [-1221.609] (-1221.568) (-1225.845) -- 0:00:17
789000 -- [-1222.864] (-1221.873) (-1221.181) (-1221.501) * (-1221.911) (-1221.845) (-1221.280) [-1222.565] -- 0:00:17
789500 -- (-1222.177) [-1221.983] (-1223.584) (-1223.820) * (-1223.385) (-1227.146) (-1223.453) [-1223.999] -- 0:00:18
790000 -- [-1222.744] (-1223.257) (-1224.423) (-1225.777) * (-1221.480) (-1226.144) (-1221.557) [-1222.559] -- 0:00:18
Average standard deviation of split frequencies: 0.004730
790500 -- (-1224.506) [-1223.444] (-1222.408) (-1222.390) * [-1226.608] (-1222.040) (-1221.891) (-1222.143) -- 0:00:18
791000 -- [-1221.721] (-1222.178) (-1222.511) (-1221.643) * [-1222.344] (-1222.079) (-1222.399) (-1223.396) -- 0:00:17
791500 -- (-1223.519) [-1223.513] (-1221.706) (-1225.131) * (-1221.370) (-1221.716) (-1225.173) [-1224.296] -- 0:00:17
792000 -- (-1223.119) (-1225.167) (-1221.552) [-1222.117] * (-1227.715) (-1224.344) [-1222.725] (-1224.330) -- 0:00:17
792500 -- (-1222.593) (-1222.625) (-1221.561) [-1223.244] * (-1226.013) (-1221.699) [-1226.269] (-1225.967) -- 0:00:17
793000 -- [-1222.344] (-1226.154) (-1223.454) (-1222.993) * (-1223.869) (-1225.142) (-1225.935) [-1223.215] -- 0:00:17
793500 -- (-1223.757) (-1224.390) [-1221.428] (-1221.741) * (-1226.170) (-1224.599) [-1221.782] (-1221.805) -- 0:00:17
794000 -- (-1222.550) [-1221.381] (-1222.163) (-1229.965) * (-1222.066) [-1223.370] (-1222.348) (-1222.504) -- 0:00:17
794500 -- (-1226.183) [-1222.712] (-1222.191) (-1222.827) * (-1224.181) (-1224.073) (-1223.061) [-1224.897] -- 0:00:17
795000 -- (-1222.987) [-1223.392] (-1224.568) (-1220.917) * (-1223.851) [-1220.657] (-1224.877) (-1222.312) -- 0:00:17
Average standard deviation of split frequencies: 0.004896
795500 -- (-1222.372) (-1222.581) (-1224.142) [-1222.614] * (-1223.016) (-1222.208) (-1226.946) [-1221.791] -- 0:00:17
796000 -- (-1221.345) [-1224.974] (-1225.446) (-1222.501) * [-1221.941] (-1221.437) (-1221.653) (-1223.557) -- 0:00:17
796500 -- [-1221.432] (-1224.360) (-1222.035) (-1221.217) * (-1222.924) (-1222.416) (-1224.772) [-1221.481] -- 0:00:17
797000 -- [-1222.683] (-1223.855) (-1222.533) (-1220.833) * (-1223.943) [-1225.035] (-1224.080) (-1224.502) -- 0:00:17
797500 -- [-1220.938] (-1221.160) (-1222.882) (-1222.282) * (-1221.074) [-1222.642] (-1223.410) (-1237.036) -- 0:00:17
798000 -- (-1221.028) (-1222.445) (-1223.814) [-1223.569] * (-1221.326) (-1223.561) (-1224.180) [-1220.834] -- 0:00:17
798500 -- (-1222.842) (-1223.773) [-1223.202] (-1227.995) * (-1224.006) [-1221.102] (-1223.689) (-1224.717) -- 0:00:17
799000 -- (-1228.788) [-1223.091] (-1222.449) (-1224.545) * (-1223.535) (-1223.637) [-1223.788] (-1226.381) -- 0:00:17
799500 -- [-1226.267] (-1221.344) (-1221.770) (-1228.156) * [-1222.394] (-1222.044) (-1222.256) (-1224.698) -- 0:00:17
800000 -- (-1225.079) [-1223.408] (-1222.685) (-1226.359) * (-1223.416) [-1221.408] (-1221.916) (-1225.891) -- 0:00:17
Average standard deviation of split frequencies: 0.004867
800500 -- (-1225.351) [-1225.745] (-1221.966) (-1222.806) * (-1222.392) (-1222.563) (-1222.697) [-1222.121] -- 0:00:16
801000 -- (-1231.457) (-1222.261) (-1225.297) [-1223.867] * (-1220.931) (-1225.190) (-1221.659) [-1222.196] -- 0:00:16
801500 -- (-1221.570) [-1223.107] (-1224.523) (-1221.391) * [-1220.970] (-1224.027) (-1220.881) (-1221.980) -- 0:00:17
802000 -- (-1222.643) [-1222.922] (-1221.437) (-1223.214) * (-1222.431) [-1221.270] (-1222.138) (-1225.595) -- 0:00:17
802500 -- (-1227.078) (-1221.637) [-1222.768] (-1229.130) * [-1226.902] (-1223.317) (-1222.773) (-1226.066) -- 0:00:16
803000 -- (-1222.468) [-1223.174] (-1223.925) (-1223.972) * (-1222.772) (-1220.587) (-1223.282) [-1220.902] -- 0:00:16
803500 -- (-1224.086) (-1223.595) (-1223.791) [-1224.221] * [-1221.887] (-1222.039) (-1223.571) (-1220.889) -- 0:00:16
804000 -- (-1224.321) [-1220.804] (-1221.269) (-1224.694) * (-1224.486) (-1226.155) [-1222.073] (-1221.586) -- 0:00:16
804500 -- (-1223.521) (-1221.098) [-1221.309] (-1222.764) * (-1221.987) (-1225.503) (-1224.780) [-1221.596] -- 0:00:16
805000 -- (-1221.722) [-1222.450] (-1225.312) (-1224.342) * (-1221.095) [-1222.057] (-1223.050) (-1222.988) -- 0:00:16
Average standard deviation of split frequencies: 0.004211
805500 -- [-1224.175] (-1222.490) (-1223.839) (-1224.505) * [-1221.792] (-1223.563) (-1226.186) (-1226.529) -- 0:00:16
806000 -- (-1220.984) (-1220.829) [-1222.918] (-1221.275) * (-1222.234) (-1222.425) (-1223.545) [-1222.027] -- 0:00:16
806500 -- [-1223.438] (-1221.215) (-1223.103) (-1222.981) * [-1223.348] (-1227.173) (-1222.969) (-1222.927) -- 0:00:16
807000 -- (-1221.982) [-1222.142] (-1227.921) (-1222.448) * (-1224.764) (-1227.401) (-1231.168) [-1222.381] -- 0:00:16
807500 -- (-1222.875) (-1223.350) [-1220.937] (-1222.524) * (-1227.065) (-1224.444) (-1223.051) [-1221.900] -- 0:00:16
808000 -- [-1223.424] (-1229.207) (-1225.834) (-1224.235) * [-1224.838] (-1227.258) (-1221.978) (-1222.103) -- 0:00:16
808500 -- (-1222.268) [-1223.207] (-1221.309) (-1224.538) * (-1223.297) (-1224.598) (-1224.439) [-1226.413] -- 0:00:16
809000 -- (-1224.641) (-1221.257) [-1222.083] (-1226.642) * [-1223.863] (-1222.300) (-1223.543) (-1221.022) -- 0:00:16
809500 -- (-1228.423) [-1222.242] (-1225.454) (-1226.118) * [-1222.779] (-1222.515) (-1221.312) (-1220.824) -- 0:00:16
810000 -- (-1229.342) (-1222.850) (-1227.988) [-1221.566] * (-1223.419) [-1222.360] (-1224.070) (-1221.704) -- 0:00:16
Average standard deviation of split frequencies: 0.004923
810500 -- [-1221.270] (-1226.064) (-1228.277) (-1223.387) * (-1225.318) (-1225.998) (-1223.854) [-1224.081] -- 0:00:16
811000 -- (-1221.544) (-1222.661) [-1222.425] (-1221.970) * [-1222.682] (-1227.235) (-1222.747) (-1225.268) -- 0:00:16
811500 -- (-1225.851) [-1221.621] (-1223.787) (-1223.197) * (-1225.090) [-1223.465] (-1226.473) (-1222.619) -- 0:00:16
812000 -- [-1221.463] (-1223.483) (-1221.560) (-1226.757) * (-1227.790) (-1225.103) (-1227.600) [-1222.279] -- 0:00:15
812500 -- (-1221.081) (-1220.990) [-1223.872] (-1224.168) * [-1224.339] (-1224.362) (-1222.312) (-1224.818) -- 0:00:15
813000 -- (-1221.151) (-1223.112) [-1222.100] (-1222.545) * (-1222.018) [-1224.383] (-1220.529) (-1227.042) -- 0:00:16
813500 -- (-1221.677) (-1222.625) (-1221.146) [-1220.843] * [-1222.569] (-1222.867) (-1222.607) (-1225.913) -- 0:00:16
814000 -- (-1221.046) (-1221.810) [-1224.054] (-1221.924) * (-1222.676) (-1221.728) (-1222.351) [-1224.276] -- 0:00:15
814500 -- (-1223.080) (-1221.099) (-1225.071) [-1221.396] * (-1223.292) (-1222.381) [-1222.977] (-1222.413) -- 0:00:15
815000 -- (-1224.811) (-1221.099) (-1223.274) [-1224.048] * (-1221.673) [-1221.410] (-1223.599) (-1223.985) -- 0:00:15
Average standard deviation of split frequencies: 0.004930
815500 -- [-1225.461] (-1221.148) (-1224.422) (-1222.940) * (-1221.753) (-1224.157) [-1224.015] (-1224.427) -- 0:00:15
816000 -- [-1222.269] (-1221.157) (-1221.469) (-1223.827) * [-1221.702] (-1223.809) (-1225.994) (-1226.906) -- 0:00:15
816500 -- (-1221.762) (-1223.694) (-1221.944) [-1223.642] * (-1226.844) (-1223.379) [-1220.851] (-1223.433) -- 0:00:15
817000 -- (-1223.509) (-1223.621) [-1224.497] (-1223.712) * (-1226.875) [-1224.944] (-1221.425) (-1222.680) -- 0:00:15
817500 -- [-1222.399] (-1224.955) (-1223.742) (-1220.870) * (-1222.860) (-1221.397) [-1221.182] (-1221.771) -- 0:00:15
818000 -- [-1221.163] (-1224.454) (-1223.881) (-1222.749) * (-1228.184) [-1225.223] (-1221.614) (-1222.489) -- 0:00:15
818500 -- (-1225.148) (-1222.573) (-1222.164) [-1221.513] * (-1225.743) (-1223.685) [-1222.162] (-1228.947) -- 0:00:15
819000 -- [-1221.334] (-1222.258) (-1221.733) (-1222.050) * (-1222.008) (-1223.624) [-1222.078] (-1221.730) -- 0:00:15
819500 -- [-1222.076] (-1221.656) (-1224.396) (-1223.595) * (-1224.074) (-1223.267) (-1221.288) [-1223.343] -- 0:00:15
820000 -- (-1222.112) [-1221.307] (-1226.830) (-1222.363) * (-1227.114) (-1223.120) (-1221.629) [-1224.163] -- 0:00:15
Average standard deviation of split frequencies: 0.005055
820500 -- (-1222.648) (-1223.948) (-1224.945) [-1223.175] * (-1223.274) (-1222.225) (-1223.062) [-1223.200] -- 0:00:15
821000 -- (-1223.297) (-1223.780) [-1223.242] (-1222.235) * (-1222.099) [-1225.151] (-1221.046) (-1227.285) -- 0:00:15
821500 -- (-1223.959) [-1222.056] (-1223.096) (-1222.259) * [-1221.816] (-1227.026) (-1221.420) (-1222.592) -- 0:00:15
822000 -- (-1223.281) (-1225.173) [-1223.946] (-1222.478) * (-1221.402) (-1221.258) (-1224.310) [-1224.743] -- 0:00:15
822500 -- (-1222.437) (-1221.904) [-1221.867] (-1223.292) * (-1225.021) (-1222.979) [-1224.492] (-1225.937) -- 0:00:15
823000 -- (-1225.556) [-1221.650] (-1223.680) (-1220.871) * [-1221.449] (-1221.215) (-1224.469) (-1222.859) -- 0:00:15
823500 -- (-1224.990) (-1224.605) (-1225.028) [-1221.185] * (-1223.205) (-1223.089) (-1223.095) [-1221.948] -- 0:00:15
824000 -- [-1221.563] (-1220.846) (-1220.928) (-1221.026) * (-1226.115) [-1224.830] (-1223.482) (-1224.088) -- 0:00:14
824500 -- (-1221.776) (-1220.493) (-1221.471) [-1222.636] * (-1226.200) [-1223.619] (-1227.484) (-1224.763) -- 0:00:14
825000 -- (-1220.910) (-1224.835) [-1221.722] (-1222.613) * (-1222.647) [-1222.073] (-1222.904) (-1223.942) -- 0:00:15
Average standard deviation of split frequencies: 0.004946
825500 -- (-1221.264) (-1224.124) [-1223.051] (-1224.893) * [-1225.339] (-1223.319) (-1221.688) (-1224.106) -- 0:00:15
826000 -- (-1222.013) [-1222.606] (-1221.307) (-1221.549) * (-1222.504) (-1220.580) (-1222.438) [-1220.582] -- 0:00:14
826500 -- [-1224.171] (-1222.455) (-1222.638) (-1221.504) * (-1224.449) (-1222.383) (-1222.397) [-1220.540] -- 0:00:14
827000 -- (-1222.558) (-1220.721) (-1223.403) [-1224.621] * [-1227.016] (-1225.393) (-1221.690) (-1221.771) -- 0:00:14
827500 -- [-1224.351] (-1220.790) (-1223.256) (-1222.752) * (-1227.347) [-1230.450] (-1222.429) (-1227.361) -- 0:00:14
828000 -- [-1221.140] (-1220.765) (-1224.541) (-1221.060) * (-1222.058) (-1225.155) [-1222.758] (-1230.770) -- 0:00:14
828500 -- (-1221.298) (-1221.239) (-1222.600) [-1224.776] * (-1223.451) [-1223.463] (-1221.509) (-1222.297) -- 0:00:14
829000 -- (-1221.105) (-1221.686) (-1221.836) [-1221.387] * [-1221.677] (-1223.267) (-1221.519) (-1224.837) -- 0:00:14
829500 -- (-1224.494) (-1221.338) [-1225.391] (-1221.764) * (-1224.639) (-1223.390) (-1230.698) [-1224.128] -- 0:00:14
830000 -- (-1222.957) (-1221.475) (-1221.174) [-1226.306] * (-1223.411) [-1223.550] (-1225.245) (-1224.488) -- 0:00:14
Average standard deviation of split frequencies: 0.005183
830500 -- [-1222.105] (-1224.728) (-1223.162) (-1223.238) * (-1223.234) (-1220.864) [-1221.347] (-1225.552) -- 0:00:14
831000 -- (-1222.262) [-1221.679] (-1220.856) (-1221.480) * [-1222.130] (-1222.183) (-1220.676) (-1221.875) -- 0:00:14
831500 -- (-1221.804) [-1221.295] (-1224.171) (-1221.831) * (-1221.598) (-1224.743) [-1220.905] (-1221.635) -- 0:00:14
832000 -- [-1223.271] (-1221.103) (-1222.175) (-1222.410) * (-1222.161) (-1223.581) [-1221.440] (-1223.790) -- 0:00:14
832500 -- (-1224.386) [-1221.617] (-1222.194) (-1223.670) * [-1221.321] (-1221.413) (-1222.011) (-1224.030) -- 0:00:14
833000 -- (-1224.387) (-1222.330) (-1221.163) [-1222.698] * (-1224.763) [-1224.078] (-1222.724) (-1222.468) -- 0:00:14
833500 -- (-1222.797) (-1223.839) [-1222.022] (-1220.554) * [-1223.682] (-1225.330) (-1224.692) (-1226.864) -- 0:00:14
834000 -- (-1222.098) [-1225.604] (-1222.817) (-1221.281) * (-1222.815) (-1221.874) [-1223.804] (-1229.533) -- 0:00:14
834500 -- (-1223.028) (-1225.604) [-1225.498] (-1222.015) * (-1222.773) (-1221.605) [-1224.973] (-1222.208) -- 0:00:14
835000 -- (-1227.526) (-1225.989) [-1223.514] (-1224.002) * (-1223.552) [-1221.630] (-1223.647) (-1221.863) -- 0:00:14
Average standard deviation of split frequencies: 0.004774
835500 -- (-1222.124) [-1225.021] (-1225.570) (-1222.228) * (-1226.286) (-1223.161) [-1221.885] (-1226.583) -- 0:00:13
836000 -- (-1223.096) (-1225.054) [-1223.689] (-1220.724) * (-1223.694) (-1223.526) [-1221.271] (-1222.326) -- 0:00:13
836500 -- (-1222.100) (-1223.600) [-1224.568] (-1224.932) * (-1223.618) (-1221.162) (-1225.028) [-1221.989] -- 0:00:13
837000 -- (-1226.179) (-1222.184) [-1223.631] (-1224.744) * (-1223.298) [-1221.904] (-1224.845) (-1223.835) -- 0:00:14
837500 -- (-1226.648) (-1221.017) [-1223.284] (-1223.432) * [-1223.684] (-1221.887) (-1222.768) (-1223.915) -- 0:00:13
838000 -- (-1224.262) [-1227.586] (-1221.530) (-1224.218) * (-1222.313) (-1224.684) (-1223.072) [-1221.651] -- 0:00:13
838500 -- (-1222.534) [-1223.898] (-1224.649) (-1221.497) * [-1221.534] (-1225.985) (-1223.754) (-1222.425) -- 0:00:13
839000 -- [-1222.085] (-1227.761) (-1222.785) (-1223.458) * (-1221.728) (-1223.429) (-1226.183) [-1221.338] -- 0:00:13
839500 -- (-1228.574) (-1222.002) (-1223.127) [-1223.755] * (-1223.151) (-1225.676) (-1225.841) [-1221.062] -- 0:00:13
840000 -- (-1225.913) [-1226.585] (-1224.241) (-1222.336) * (-1222.851) (-1223.103) [-1222.632] (-1222.256) -- 0:00:13
Average standard deviation of split frequencies: 0.004897
840500 -- (-1223.007) (-1224.990) [-1220.858] (-1225.326) * (-1223.208) (-1225.236) (-1221.171) [-1223.378] -- 0:00:13
841000 -- (-1226.139) (-1223.085) [-1220.788] (-1222.132) * [-1223.850] (-1223.323) (-1220.529) (-1222.661) -- 0:00:13
841500 -- [-1222.030] (-1229.571) (-1220.887) (-1222.061) * [-1223.109] (-1221.803) (-1221.792) (-1222.991) -- 0:00:13
842000 -- (-1223.526) [-1227.016] (-1226.486) (-1222.262) * (-1223.616) (-1222.333) (-1221.700) [-1221.576] -- 0:00:13
842500 -- [-1224.267] (-1224.064) (-1220.728) (-1223.675) * [-1226.510] (-1222.381) (-1224.297) (-1224.861) -- 0:00:13
843000 -- (-1221.297) (-1225.255) [-1220.734] (-1224.593) * (-1222.270) (-1222.802) (-1223.627) [-1221.768] -- 0:00:13
843500 -- (-1222.835) (-1223.652) [-1223.805] (-1222.481) * (-1222.738) (-1222.832) (-1223.864) [-1221.328] -- 0:00:13
844000 -- (-1221.458) (-1225.042) [-1221.171] (-1221.676) * [-1223.274] (-1222.848) (-1221.718) (-1221.006) -- 0:00:13
844500 -- [-1222.468] (-1223.260) (-1222.219) (-1222.411) * (-1220.938) (-1226.930) (-1220.682) [-1224.815] -- 0:00:13
845000 -- (-1221.043) (-1223.987) (-1223.109) [-1221.827] * [-1222.869] (-1221.699) (-1220.796) (-1222.989) -- 0:00:13
Average standard deviation of split frequencies: 0.004829
845500 -- (-1221.088) (-1224.454) [-1223.455] (-1225.511) * (-1221.764) (-1221.428) [-1222.152] (-1222.706) -- 0:00:13
846000 -- (-1221.845) [-1224.112] (-1223.147) (-1222.316) * (-1224.391) [-1222.784] (-1221.187) (-1222.860) -- 0:00:13
846500 -- (-1222.940) (-1222.101) (-1222.521) [-1221.275] * (-1223.891) (-1223.736) [-1222.860] (-1221.219) -- 0:00:13
847000 -- (-1224.061) [-1221.448] (-1223.938) (-1225.104) * [-1221.194] (-1233.456) (-1227.457) (-1221.009) -- 0:00:13
847500 -- (-1221.773) [-1222.061] (-1223.617) (-1221.752) * [-1222.384] (-1227.654) (-1230.405) (-1223.141) -- 0:00:12
848000 -- (-1222.340) (-1224.895) [-1223.648] (-1223.241) * [-1221.107] (-1224.315) (-1222.972) (-1221.415) -- 0:00:12
848500 -- (-1223.297) (-1223.324) [-1223.254] (-1229.607) * (-1221.157) (-1224.110) (-1222.158) [-1220.998] -- 0:00:13
849000 -- (-1228.881) (-1225.970) [-1224.299] (-1221.939) * (-1223.068) (-1223.038) [-1222.834] (-1223.594) -- 0:00:12
849500 -- (-1226.791) (-1222.673) (-1226.582) [-1223.336] * (-1222.392) [-1222.703] (-1225.121) (-1222.982) -- 0:00:12
850000 -- (-1224.410) [-1224.850] (-1223.284) (-1225.582) * (-1222.451) (-1225.188) (-1221.653) [-1222.381] -- 0:00:12
Average standard deviation of split frequencies: 0.005024
850500 -- (-1222.477) [-1222.061] (-1223.873) (-1224.684) * (-1221.174) [-1223.218] (-1223.189) (-1225.691) -- 0:00:12
851000 -- (-1225.414) (-1221.286) (-1222.188) [-1222.728] * (-1222.421) (-1221.471) [-1221.863] (-1226.502) -- 0:00:12
851500 -- (-1224.386) (-1221.709) (-1221.322) [-1221.109] * (-1223.534) [-1222.211] (-1220.965) (-1221.948) -- 0:00:12
852000 -- [-1221.761] (-1222.732) (-1221.014) (-1225.471) * (-1221.303) (-1221.918) [-1221.291] (-1222.496) -- 0:00:12
852500 -- (-1224.519) (-1223.950) [-1224.235] (-1224.157) * (-1223.953) (-1226.042) (-1228.562) [-1222.072] -- 0:00:12
853000 -- (-1222.621) (-1223.992) (-1230.587) [-1222.420] * (-1223.021) (-1222.243) [-1225.563] (-1224.653) -- 0:00:12
853500 -- (-1221.847) [-1222.186] (-1228.944) (-1222.827) * [-1222.672] (-1226.156) (-1225.468) (-1221.106) -- 0:00:12
854000 -- (-1227.169) [-1220.892] (-1222.694) (-1226.997) * (-1220.951) [-1222.009] (-1224.655) (-1221.201) -- 0:00:12
854500 -- (-1224.224) [-1225.045] (-1223.126) (-1230.031) * (-1224.042) (-1223.028) [-1222.110] (-1222.111) -- 0:00:12
855000 -- (-1222.234) (-1223.345) [-1221.678] (-1222.466) * (-1221.438) [-1222.272] (-1224.953) (-1221.393) -- 0:00:12
Average standard deviation of split frequencies: 0.004956
855500 -- [-1221.890] (-1222.110) (-1223.062) (-1222.661) * (-1221.672) (-1224.025) (-1223.437) [-1222.291] -- 0:00:12
856000 -- (-1221.564) [-1221.365] (-1221.619) (-1223.737) * [-1222.084] (-1228.226) (-1223.383) (-1223.029) -- 0:00:12
856500 -- (-1223.793) (-1221.003) (-1222.358) [-1226.295] * (-1221.726) (-1225.299) (-1226.684) [-1221.777] -- 0:00:12
857000 -- (-1221.624) [-1222.061] (-1222.852) (-1220.871) * (-1222.778) (-1224.983) (-1223.263) [-1225.970] -- 0:00:12
857500 -- [-1223.570] (-1222.285) (-1224.056) (-1222.543) * (-1223.340) [-1224.038] (-1220.783) (-1223.534) -- 0:00:12
858000 -- (-1223.573) (-1224.879) (-1223.915) [-1222.544] * (-1223.017) (-1221.147) (-1227.193) [-1223.159] -- 0:00:12
858500 -- [-1221.828] (-1223.861) (-1222.128) (-1220.850) * (-1224.377) (-1224.741) [-1223.064] (-1227.396) -- 0:00:12
859000 -- (-1224.471) (-1224.496) (-1221.792) [-1222.520] * (-1221.831) [-1223.438] (-1225.645) (-1220.769) -- 0:00:11
859500 -- (-1224.736) [-1222.222] (-1225.339) (-1222.670) * (-1223.708) [-1222.533] (-1223.113) (-1222.545) -- 0:00:11
860000 -- [-1221.980] (-1223.358) (-1222.670) (-1223.650) * (-1221.668) [-1222.899] (-1222.221) (-1226.358) -- 0:00:12
Average standard deviation of split frequencies: 0.004747
860500 -- (-1224.833) (-1223.174) [-1223.056] (-1222.966) * [-1221.200] (-1223.476) (-1221.023) (-1223.011) -- 0:00:11
861000 -- (-1223.841) [-1223.876] (-1222.384) (-1224.734) * (-1222.664) (-1222.991) (-1222.294) [-1222.675] -- 0:00:11
861500 -- [-1222.764] (-1221.848) (-1221.819) (-1223.149) * [-1221.359] (-1221.798) (-1225.931) (-1222.714) -- 0:00:11
862000 -- (-1221.159) (-1224.197) (-1223.914) [-1223.891] * [-1221.286] (-1224.315) (-1223.613) (-1227.503) -- 0:00:11
862500 -- (-1222.287) (-1222.327) [-1222.473] (-1222.316) * (-1225.013) (-1222.543) [-1222.060] (-1232.115) -- 0:00:11
863000 -- [-1222.671] (-1222.176) (-1229.334) (-1222.622) * (-1223.317) [-1223.412] (-1222.852) (-1225.613) -- 0:00:11
863500 -- (-1222.235) [-1220.842] (-1221.765) (-1222.219) * (-1224.273) (-1223.376) (-1221.829) [-1221.467] -- 0:00:11
864000 -- (-1221.870) [-1223.691] (-1223.343) (-1222.005) * (-1221.895) (-1228.356) [-1221.838] (-1221.467) -- 0:00:11
864500 -- [-1223.740] (-1222.342) (-1222.094) (-1223.764) * (-1223.910) [-1225.965] (-1222.501) (-1221.240) -- 0:00:11
865000 -- (-1222.041) (-1222.476) (-1224.124) [-1222.780] * (-1221.832) (-1222.197) (-1226.868) [-1221.055] -- 0:00:11
Average standard deviation of split frequencies: 0.004391
865500 -- [-1221.193] (-1223.150) (-1224.708) (-1222.258) * (-1221.779) (-1222.762) (-1223.312) [-1220.999] -- 0:00:11
866000 -- (-1221.171) [-1220.975] (-1222.995) (-1221.063) * (-1220.902) (-1223.117) (-1222.042) [-1221.008] -- 0:00:11
866500 -- (-1222.355) (-1222.690) [-1222.171] (-1223.995) * (-1222.927) (-1223.882) [-1222.447] (-1221.492) -- 0:00:11
867000 -- (-1225.462) (-1224.283) (-1221.877) [-1222.335] * (-1222.819) (-1225.876) [-1223.197] (-1220.944) -- 0:00:11
867500 -- (-1226.996) [-1222.142] (-1224.734) (-1223.434) * (-1222.516) (-1222.264) (-1222.354) [-1221.650] -- 0:00:11
868000 -- (-1228.064) (-1223.054) (-1220.699) [-1222.833] * (-1222.373) (-1222.496) (-1222.979) [-1221.256] -- 0:00:11
868500 -- [-1224.128] (-1222.512) (-1220.596) (-1221.949) * (-1220.753) [-1222.376] (-1224.163) (-1222.048) -- 0:00:11
869000 -- (-1221.797) (-1224.336) [-1221.374] (-1222.083) * (-1223.608) [-1223.564] (-1224.968) (-1223.762) -- 0:00:11
869500 -- (-1222.942) (-1224.351) [-1220.969] (-1225.906) * (-1224.757) [-1222.860] (-1223.937) (-1224.396) -- 0:00:11
870000 -- (-1222.164) [-1222.801] (-1222.648) (-1222.292) * (-1224.160) [-1223.674] (-1221.589) (-1224.131) -- 0:00:11
Average standard deviation of split frequencies: 0.004692
870500 -- (-1221.871) (-1221.758) [-1220.991] (-1225.627) * (-1226.363) (-1220.924) (-1221.592) [-1221.012] -- 0:00:11
871000 -- (-1224.601) (-1224.883) (-1220.919) [-1222.148] * (-1228.491) (-1223.319) [-1222.863] (-1221.748) -- 0:00:11
871500 -- (-1223.460) (-1225.002) (-1221.060) [-1222.804] * (-1227.027) [-1222.860] (-1224.922) (-1222.855) -- 0:00:11
872000 -- [-1225.146] (-1225.027) (-1222.585) (-1223.192) * (-1220.957) (-1221.348) (-1225.409) [-1223.343] -- 0:00:11
872500 -- (-1222.901) (-1221.686) [-1222.967] (-1223.206) * [-1221.117] (-1221.625) (-1224.129) (-1223.611) -- 0:00:10
873000 -- (-1222.573) [-1220.800] (-1222.458) (-1226.897) * (-1221.451) [-1222.202] (-1222.592) (-1223.723) -- 0:00:10
873500 -- (-1222.378) (-1221.331) (-1221.772) [-1229.707] * (-1223.576) (-1224.939) (-1224.241) [-1221.582] -- 0:00:10
874000 -- (-1229.576) (-1222.925) [-1224.078] (-1220.869) * (-1223.792) [-1220.656] (-1221.995) (-1222.301) -- 0:00:10
874500 -- (-1225.828) (-1224.881) [-1224.967] (-1221.810) * (-1221.771) (-1222.910) (-1221.194) [-1221.072] -- 0:00:10
875000 -- (-1221.461) (-1225.727) [-1224.405] (-1224.342) * (-1223.510) [-1222.437] (-1230.086) (-1220.774) -- 0:00:10
Average standard deviation of split frequencies: 0.004520
875500 -- (-1221.710) (-1223.530) [-1226.231] (-1223.209) * (-1221.502) (-1222.545) [-1221.659] (-1222.151) -- 0:00:10
876000 -- (-1221.205) [-1223.460] (-1225.696) (-1224.920) * (-1222.588) (-1221.718) (-1222.224) [-1220.674] -- 0:00:10
876500 -- (-1223.291) (-1223.554) (-1221.652) [-1223.252] * [-1224.667] (-1221.287) (-1223.927) (-1222.294) -- 0:00:10
877000 -- [-1226.435] (-1222.211) (-1223.610) (-1229.677) * (-1224.847) (-1221.220) [-1221.684] (-1221.932) -- 0:00:10
877500 -- (-1226.953) [-1222.155] (-1221.339) (-1221.309) * (-1222.849) (-1220.827) (-1221.141) [-1225.125] -- 0:00:10
878000 -- (-1228.637) (-1225.096) [-1222.068] (-1221.448) * (-1225.401) (-1225.443) (-1223.654) [-1222.154] -- 0:00:10
878500 -- (-1227.433) (-1222.516) (-1223.021) [-1222.020] * [-1222.502] (-1223.612) (-1223.583) (-1227.324) -- 0:00:10
879000 -- (-1228.066) (-1223.121) [-1226.090] (-1224.305) * (-1222.154) (-1222.193) (-1226.732) [-1223.621] -- 0:00:10
879500 -- (-1222.156) (-1225.735) (-1222.693) [-1224.035] * (-1223.031) (-1223.624) (-1223.191) [-1221.492] -- 0:00:10
880000 -- (-1222.389) (-1223.612) [-1222.358] (-1221.726) * (-1224.961) (-1224.467) [-1223.903] (-1223.225) -- 0:00:10
Average standard deviation of split frequencies: 0.004889
880500 -- (-1227.885) (-1223.015) (-1223.748) [-1220.829] * [-1222.274] (-1224.920) (-1224.069) (-1226.435) -- 0:00:10
881000 -- (-1224.197) (-1223.512) (-1224.809) [-1221.550] * [-1224.172] (-1221.799) (-1226.525) (-1221.576) -- 0:00:10
881500 -- (-1221.837) (-1223.143) [-1222.083] (-1222.140) * (-1225.126) (-1224.111) [-1224.630] (-1222.359) -- 0:00:10
882000 -- (-1220.778) (-1223.035) (-1225.559) [-1221.303] * (-1221.929) [-1224.682] (-1222.902) (-1220.940) -- 0:00:10
882500 -- [-1220.740] (-1222.798) (-1222.608) (-1223.094) * [-1222.630] (-1226.520) (-1221.565) (-1222.116) -- 0:00:10
883000 -- (-1224.253) [-1222.913] (-1221.971) (-1223.930) * [-1221.517] (-1222.277) (-1221.526) (-1225.770) -- 0:00:10
883500 -- (-1222.611) (-1222.315) (-1221.985) [-1226.344] * (-1222.876) [-1222.002] (-1222.508) (-1226.373) -- 0:00:10
884000 -- (-1224.200) (-1223.203) (-1221.488) [-1220.852] * (-1224.044) [-1221.971] (-1221.423) (-1221.421) -- 0:00:09
884500 -- (-1221.857) [-1222.373] (-1223.890) (-1221.376) * [-1222.999] (-1221.779) (-1225.481) (-1221.298) -- 0:00:09
885000 -- [-1221.026] (-1222.385) (-1222.289) (-1223.016) * (-1221.660) (-1225.328) [-1223.183] (-1228.784) -- 0:00:09
Average standard deviation of split frequencies: 0.004955
885500 -- [-1224.028] (-1221.645) (-1226.171) (-1225.180) * (-1221.663) (-1227.103) (-1228.251) [-1222.329] -- 0:00:09
886000 -- (-1222.158) (-1223.895) (-1226.143) [-1227.572] * [-1221.359] (-1230.165) (-1221.788) (-1223.268) -- 0:00:09
886500 -- (-1225.262) [-1223.673] (-1223.673) (-1225.476) * [-1222.946] (-1229.496) (-1225.121) (-1226.010) -- 0:00:09
887000 -- (-1220.992) (-1223.390) [-1223.028] (-1227.071) * [-1221.551] (-1224.406) (-1222.086) (-1222.099) -- 0:00:09
887500 -- (-1222.012) (-1222.720) (-1221.598) [-1223.800] * (-1224.550) [-1223.922] (-1222.063) (-1223.947) -- 0:00:09
888000 -- (-1223.996) (-1222.571) (-1224.025) [-1221.736] * (-1222.827) (-1226.725) (-1222.136) [-1222.727] -- 0:00:09
888500 -- [-1225.252] (-1223.862) (-1222.817) (-1223.402) * (-1221.853) (-1222.866) [-1225.178] (-1223.187) -- 0:00:09
889000 -- (-1221.450) [-1222.370] (-1221.460) (-1227.527) * [-1224.519] (-1224.686) (-1221.527) (-1222.682) -- 0:00:09
889500 -- (-1221.085) (-1221.565) (-1223.039) [-1224.065] * (-1222.992) (-1226.825) [-1220.666] (-1226.863) -- 0:00:09
890000 -- (-1221.707) [-1222.217] (-1222.166) (-1221.119) * [-1221.532] (-1223.150) (-1222.093) (-1227.830) -- 0:00:09
Average standard deviation of split frequencies: 0.004834
890500 -- (-1222.777) (-1222.726) (-1221.206) [-1223.649] * [-1222.246] (-1223.828) (-1223.989) (-1222.041) -- 0:00:09
891000 -- (-1221.133) (-1225.454) [-1221.601] (-1223.543) * (-1221.461) (-1223.436) (-1224.733) [-1223.852] -- 0:00:09
891500 -- [-1221.233] (-1221.935) (-1223.032) (-1221.131) * [-1221.591] (-1224.086) (-1225.567) (-1221.694) -- 0:00:09
892000 -- [-1221.843] (-1221.396) (-1223.150) (-1221.822) * [-1221.396] (-1221.758) (-1221.859) (-1222.583) -- 0:00:09
892500 -- (-1222.691) [-1222.062] (-1222.498) (-1220.856) * [-1223.033] (-1223.023) (-1221.329) (-1221.545) -- 0:00:09
893000 -- (-1225.622) (-1224.131) (-1221.878) [-1223.013] * (-1221.394) (-1222.192) (-1222.225) [-1223.693] -- 0:00:09
893500 -- [-1226.248] (-1220.894) (-1222.767) (-1224.945) * [-1221.727] (-1221.517) (-1223.145) (-1222.576) -- 0:00:09
894000 -- (-1222.500) (-1226.483) [-1222.125] (-1222.601) * (-1222.365) (-1225.555) [-1224.251] (-1222.101) -- 0:00:09
894500 -- (-1221.408) [-1221.352] (-1222.128) (-1221.019) * [-1221.699] (-1224.758) (-1223.296) (-1223.157) -- 0:00:09
895000 -- (-1221.337) (-1224.153) [-1220.882] (-1221.449) * (-1223.970) (-1221.821) [-1221.278] (-1224.316) -- 0:00:09
Average standard deviation of split frequencies: 0.005191
895500 -- (-1224.683) (-1222.876) (-1223.305) [-1221.302] * (-1222.152) [-1220.758] (-1222.465) (-1222.725) -- 0:00:08
896000 -- (-1221.665) (-1226.664) [-1222.545] (-1223.431) * (-1225.276) [-1222.579] (-1220.767) (-1221.651) -- 0:00:08
896500 -- (-1224.827) (-1221.998) (-1221.508) [-1224.165] * (-1223.838) [-1222.668] (-1223.477) (-1223.705) -- 0:00:08
897000 -- (-1221.923) [-1222.054] (-1221.097) (-1223.221) * (-1223.759) [-1222.683] (-1221.905) (-1223.183) -- 0:00:08
897500 -- (-1222.322) (-1223.032) (-1223.260) [-1224.379] * (-1226.263) (-1222.736) (-1221.815) [-1222.678] -- 0:00:08
898000 -- (-1223.178) (-1224.495) [-1221.771] (-1225.580) * (-1220.990) (-1224.198) (-1225.622) [-1222.560] -- 0:00:08
898500 -- (-1223.651) (-1226.047) [-1225.081] (-1223.046) * (-1220.806) [-1223.334] (-1225.425) (-1226.522) -- 0:00:08
899000 -- (-1223.490) (-1231.458) (-1221.984) [-1225.948] * (-1221.224) (-1223.105) [-1223.510] (-1225.237) -- 0:00:08
899500 -- (-1222.689) [-1221.531] (-1221.152) (-1222.800) * (-1221.402) (-1221.400) [-1222.011] (-1225.506) -- 0:00:08
900000 -- (-1222.506) (-1221.396) [-1222.467] (-1222.764) * (-1228.786) (-1221.068) [-1222.064] (-1221.639) -- 0:00:08
Average standard deviation of split frequencies: 0.005129
900500 -- (-1222.662) (-1222.386) (-1221.455) [-1227.085] * (-1222.130) [-1223.090] (-1222.822) (-1222.175) -- 0:00:08
901000 -- (-1221.321) [-1222.391] (-1225.959) (-1226.680) * [-1221.875] (-1222.480) (-1222.532) (-1222.020) -- 0:00:08
901500 -- [-1221.309] (-1223.252) (-1226.370) (-1223.723) * (-1227.762) [-1221.935] (-1223.154) (-1222.956) -- 0:00:08
902000 -- (-1221.907) [-1223.157] (-1222.473) (-1221.666) * (-1221.842) (-1222.980) [-1223.484] (-1224.457) -- 0:00:08
902500 -- [-1221.980] (-1223.582) (-1221.166) (-1223.405) * (-1222.350) (-1222.632) [-1221.745] (-1226.165) -- 0:00:08
903000 -- (-1221.835) (-1223.405) [-1225.115] (-1225.618) * (-1223.737) (-1226.853) (-1226.445) [-1221.350] -- 0:00:08
903500 -- [-1222.989] (-1223.042) (-1222.826) (-1230.889) * (-1228.331) (-1224.169) (-1222.366) [-1221.027] -- 0:00:08
904000 -- [-1224.178] (-1222.907) (-1222.270) (-1227.406) * [-1222.726] (-1222.006) (-1227.158) (-1221.262) -- 0:00:08
904500 -- [-1223.332] (-1222.824) (-1225.869) (-1222.080) * [-1221.375] (-1221.987) (-1224.020) (-1221.332) -- 0:00:08
905000 -- (-1223.004) (-1222.573) (-1221.155) [-1224.699] * (-1224.762) (-1224.827) [-1222.598] (-1221.062) -- 0:00:08
Average standard deviation of split frequencies: 0.005411
905500 -- (-1227.000) [-1224.796] (-1222.348) (-1224.543) * (-1224.361) (-1222.560) (-1224.162) [-1221.697] -- 0:00:08
906000 -- [-1223.684] (-1222.231) (-1221.738) (-1226.543) * [-1221.541] (-1224.161) (-1221.725) (-1221.996) -- 0:00:08
906500 -- [-1224.115] (-1222.231) (-1221.859) (-1222.560) * (-1221.984) [-1224.117] (-1224.736) (-1223.659) -- 0:00:08
907000 -- [-1222.392] (-1221.573) (-1226.097) (-1227.620) * (-1223.597) (-1222.754) (-1223.350) [-1226.697] -- 0:00:07
907500 -- (-1223.388) [-1222.141] (-1229.753) (-1225.875) * (-1221.928) (-1221.807) [-1221.209] (-1222.210) -- 0:00:07
908000 -- [-1224.651] (-1225.924) (-1223.756) (-1224.997) * [-1223.631] (-1222.072) (-1222.495) (-1223.746) -- 0:00:07
908500 -- [-1223.061] (-1222.804) (-1227.012) (-1222.751) * [-1223.853] (-1222.747) (-1222.385) (-1224.492) -- 0:00:07
909000 -- (-1221.849) (-1222.240) (-1223.988) [-1221.650] * (-1223.759) [-1224.637] (-1225.096) (-1225.616) -- 0:00:07
909500 -- (-1221.849) [-1222.362] (-1221.986) (-1225.149) * (-1224.555) (-1222.405) [-1224.309] (-1223.354) -- 0:00:07
910000 -- [-1222.389] (-1221.984) (-1221.992) (-1220.894) * (-1221.819) (-1228.778) (-1222.187) [-1221.933] -- 0:00:07
Average standard deviation of split frequencies: 0.005418
910500 -- [-1224.055] (-1221.157) (-1221.727) (-1222.137) * (-1221.841) (-1228.312) [-1223.295] (-1221.807) -- 0:00:07
911000 -- (-1225.222) (-1221.460) (-1220.844) [-1223.708] * (-1221.923) (-1225.069) [-1227.443] (-1224.188) -- 0:00:07
911500 -- (-1221.080) (-1226.314) [-1223.937] (-1226.824) * (-1222.003) (-1223.471) (-1224.229) [-1221.623] -- 0:00:07
912000 -- (-1222.968) (-1223.884) [-1222.951] (-1225.036) * (-1222.354) [-1222.936] (-1221.972) (-1226.343) -- 0:00:07
912500 -- (-1220.897) (-1222.267) (-1221.743) [-1225.518] * (-1223.530) (-1226.105) (-1221.361) [-1226.197] -- 0:00:07
913000 -- [-1224.336] (-1222.266) (-1221.611) (-1222.946) * [-1223.562] (-1222.143) (-1221.657) (-1221.673) -- 0:00:07
913500 -- [-1221.266] (-1226.608) (-1222.266) (-1221.032) * (-1224.344) (-1223.177) (-1221.983) [-1224.993] -- 0:00:07
914000 -- (-1220.872) (-1223.285) (-1226.125) [-1223.484] * (-1222.293) (-1223.066) [-1220.720] (-1223.955) -- 0:00:07
914500 -- (-1220.907) (-1227.348) [-1222.032] (-1223.896) * (-1224.979) (-1222.074) [-1224.390] (-1222.782) -- 0:00:07
915000 -- (-1221.496) [-1227.509] (-1224.051) (-1222.938) * (-1221.556) (-1221.854) (-1225.157) [-1221.691] -- 0:00:07
Average standard deviation of split frequencies: 0.005421
915500 -- (-1223.845) (-1224.452) [-1223.133] (-1225.706) * [-1221.902] (-1223.334) (-1224.876) (-1221.935) -- 0:00:07
916000 -- [-1222.703] (-1221.362) (-1223.147) (-1223.841) * [-1221.488] (-1227.732) (-1223.821) (-1221.937) -- 0:00:07
916500 -- [-1225.679] (-1221.634) (-1224.560) (-1225.292) * [-1225.312] (-1221.595) (-1222.596) (-1223.328) -- 0:00:07
917000 -- (-1224.335) [-1221.269] (-1222.152) (-1222.786) * (-1223.209) [-1222.182] (-1221.885) (-1222.960) -- 0:00:07
917500 -- (-1224.018) (-1221.978) [-1222.100] (-1224.501) * (-1223.144) [-1222.034] (-1221.751) (-1224.808) -- 0:00:07
918000 -- (-1231.042) [-1223.074] (-1222.412) (-1223.525) * (-1222.142) (-1222.255) [-1223.266] (-1227.468) -- 0:00:07
918500 -- (-1221.528) (-1223.471) (-1220.933) [-1222.000] * (-1221.054) (-1222.850) [-1224.514] (-1221.331) -- 0:00:07
919000 -- (-1221.700) (-1222.514) [-1221.297] (-1221.644) * (-1220.758) (-1221.901) [-1221.165] (-1221.631) -- 0:00:06
919500 -- (-1221.520) [-1222.657] (-1221.708) (-1226.821) * (-1221.549) (-1223.553) (-1220.548) [-1223.161] -- 0:00:06
920000 -- (-1221.761) [-1222.491] (-1221.916) (-1225.274) * (-1225.223) (-1222.163) [-1222.187] (-1221.173) -- 0:00:06
Average standard deviation of split frequencies: 0.005223
920500 -- (-1222.121) [-1220.808] (-1223.481) (-1222.140) * (-1227.691) (-1222.202) (-1221.239) [-1222.179] -- 0:00:06
921000 -- [-1224.304] (-1221.324) (-1223.232) (-1225.750) * [-1224.002] (-1225.710) (-1221.725) (-1223.378) -- 0:00:06
921500 -- (-1222.559) (-1221.360) (-1221.327) [-1221.369] * [-1223.265] (-1222.921) (-1223.687) (-1225.338) -- 0:00:06
922000 -- (-1222.875) [-1221.866] (-1221.200) (-1222.137) * (-1222.727) [-1221.014] (-1225.498) (-1226.408) -- 0:00:06
922500 -- (-1223.121) (-1221.539) (-1222.411) [-1223.267] * [-1226.203] (-1221.141) (-1221.409) (-1224.179) -- 0:00:06
923000 -- (-1225.357) (-1223.229) (-1221.143) [-1222.690] * [-1222.634] (-1220.609) (-1220.763) (-1226.074) -- 0:00:06
923500 -- (-1222.616) (-1221.450) [-1222.671] (-1223.320) * (-1227.180) (-1223.841) [-1221.188] (-1223.968) -- 0:00:06
924000 -- (-1222.154) (-1224.791) [-1223.329] (-1223.817) * [-1224.933] (-1224.981) (-1222.322) (-1224.704) -- 0:00:06
924500 -- (-1221.638) (-1225.360) (-1228.728) [-1224.393] * (-1222.278) (-1225.061) [-1222.851] (-1225.081) -- 0:00:06
925000 -- (-1222.142) (-1223.583) (-1222.804) [-1221.578] * (-1223.297) [-1221.598] (-1222.886) (-1224.830) -- 0:00:06
Average standard deviation of split frequencies: 0.004921
925500 -- [-1225.744] (-1222.976) (-1225.629) (-1224.094) * (-1225.816) (-1223.170) (-1221.319) [-1221.335] -- 0:00:06
926000 -- [-1225.823] (-1221.489) (-1221.930) (-1225.291) * (-1223.184) (-1225.490) (-1224.616) [-1221.771] -- 0:00:06
926500 -- (-1223.371) (-1222.286) [-1222.769] (-1222.083) * (-1223.810) (-1222.930) [-1221.225] (-1221.845) -- 0:00:06
927000 -- (-1226.518) (-1222.664) (-1224.016) [-1221.851] * (-1223.766) [-1222.449] (-1221.402) (-1222.055) -- 0:00:06
927500 -- (-1226.477) (-1221.637) (-1221.084) [-1222.456] * (-1226.787) (-1221.275) (-1222.852) [-1222.317] -- 0:00:06
928000 -- (-1222.157) (-1220.850) (-1223.561) [-1225.360] * (-1223.516) [-1222.229] (-1221.969) (-1225.427) -- 0:00:06
928500 -- (-1223.874) (-1224.782) [-1223.934] (-1221.737) * (-1222.933) [-1221.963] (-1224.327) (-1229.561) -- 0:00:06
929000 -- (-1226.433) (-1222.239) (-1223.378) [-1220.587] * (-1221.285) [-1221.972] (-1224.019) (-1226.860) -- 0:00:06
929500 -- (-1225.717) (-1225.260) [-1222.283] (-1225.413) * (-1223.243) (-1220.672) (-1220.994) [-1223.372] -- 0:00:06
930000 -- (-1224.291) (-1221.561) [-1222.024] (-1222.470) * (-1223.226) [-1222.840] (-1222.280) (-1227.017) -- 0:00:06
Average standard deviation of split frequencies: 0.004559
930500 -- (-1223.475) [-1221.919] (-1223.178) (-1221.707) * (-1221.720) (-1223.422) [-1220.633] (-1224.299) -- 0:00:05
931000 -- (-1225.366) (-1225.411) (-1224.046) [-1221.211] * [-1220.770] (-1222.355) (-1220.683) (-1222.224) -- 0:00:05
931500 -- (-1225.031) (-1221.221) [-1222.794] (-1222.082) * (-1221.923) (-1223.887) [-1222.670] (-1223.823) -- 0:00:05
932000 -- (-1223.429) (-1221.747) [-1222.525] (-1223.835) * (-1224.371) (-1224.644) (-1229.271) [-1225.515] -- 0:00:05
932500 -- [-1222.886] (-1222.054) (-1225.639) (-1221.323) * [-1222.517] (-1225.322) (-1223.085) (-1222.189) -- 0:00:05
933000 -- (-1221.827) (-1221.770) (-1224.238) [-1221.408] * [-1227.634] (-1227.599) (-1223.145) (-1222.690) -- 0:00:05
933500 -- (-1221.345) (-1222.150) (-1224.902) [-1221.930] * [-1227.724] (-1226.134) (-1225.684) (-1224.572) -- 0:00:05
934000 -- (-1221.518) (-1225.521) [-1222.888] (-1223.115) * (-1227.478) (-1223.391) (-1227.444) [-1221.778] -- 0:00:05
934500 -- (-1221.277) (-1222.484) (-1225.356) [-1221.645] * (-1223.343) (-1224.304) (-1222.096) [-1221.454] -- 0:00:05
935000 -- [-1223.225] (-1222.464) (-1224.075) (-1222.537) * (-1221.991) (-1226.679) (-1224.046) [-1221.462] -- 0:00:05
Average standard deviation of split frequencies: 0.004868
935500 -- (-1220.744) (-1225.031) [-1224.483] (-1223.183) * (-1224.612) [-1222.569] (-1223.510) (-1223.159) -- 0:00:05
936000 -- (-1223.981) [-1222.346] (-1221.912) (-1222.970) * (-1227.202) [-1225.657] (-1222.241) (-1224.754) -- 0:00:05
936500 -- (-1223.230) [-1222.577] (-1221.825) (-1221.057) * (-1225.303) (-1220.842) (-1224.493) [-1221.225] -- 0:00:05
937000 -- (-1226.103) (-1222.148) [-1221.796] (-1223.452) * [-1224.284] (-1224.036) (-1222.228) (-1228.426) -- 0:00:05
937500 -- [-1223.977] (-1225.833) (-1222.031) (-1227.533) * (-1220.768) [-1225.628] (-1224.435) (-1225.614) -- 0:00:05
938000 -- (-1223.101) (-1223.265) (-1223.280) [-1223.868] * [-1221.877] (-1227.150) (-1225.034) (-1225.715) -- 0:00:05
938500 -- (-1227.783) (-1222.638) [-1227.873] (-1223.087) * [-1221.970] (-1222.510) (-1224.608) (-1224.203) -- 0:00:05
939000 -- [-1224.419] (-1221.605) (-1221.985) (-1224.320) * (-1221.782) (-1221.391) (-1228.031) [-1221.885] -- 0:00:05
939500 -- (-1223.973) [-1223.057] (-1222.204) (-1221.770) * (-1222.098) [-1220.680] (-1222.198) (-1222.623) -- 0:00:05
940000 -- (-1224.759) [-1223.718] (-1221.924) (-1221.431) * [-1223.122] (-1221.934) (-1220.572) (-1221.593) -- 0:00:05
Average standard deviation of split frequencies: 0.005178
940500 -- [-1221.722] (-1221.740) (-1222.288) (-1222.651) * (-1225.015) [-1222.246] (-1222.786) (-1225.320) -- 0:00:05
941000 -- [-1222.941] (-1222.621) (-1223.605) (-1223.246) * (-1226.286) [-1221.475] (-1223.949) (-1221.387) -- 0:00:05
941500 -- (-1222.119) [-1222.820] (-1221.788) (-1222.861) * (-1220.893) [-1222.585] (-1224.844) (-1220.657) -- 0:00:05
942000 -- [-1223.075] (-1222.853) (-1223.384) (-1223.053) * (-1220.808) [-1224.203] (-1222.464) (-1221.233) -- 0:00:04
942500 -- (-1222.592) (-1226.012) (-1222.864) [-1225.233] * (-1220.758) [-1221.616] (-1222.396) (-1221.979) -- 0:00:04
943000 -- (-1222.664) (-1222.860) [-1223.251] (-1221.700) * (-1220.629) (-1221.222) [-1221.273] (-1225.330) -- 0:00:04
943500 -- (-1223.143) [-1222.807] (-1223.682) (-1226.028) * (-1221.530) (-1223.091) [-1224.388] (-1222.227) -- 0:00:04
944000 -- (-1224.453) (-1224.876) (-1225.122) [-1225.878] * (-1222.505) [-1220.859] (-1224.069) (-1221.879) -- 0:00:04
944500 -- (-1223.392) (-1225.118) [-1222.905] (-1220.840) * [-1222.189] (-1220.857) (-1221.079) (-1223.415) -- 0:00:04
945000 -- (-1222.884) [-1221.595] (-1222.868) (-1222.845) * (-1221.156) (-1222.601) [-1221.710] (-1223.744) -- 0:00:04
Average standard deviation of split frequencies: 0.005216
945500 -- (-1222.764) (-1221.707) (-1225.111) [-1222.627] * (-1227.030) [-1221.371] (-1222.279) (-1221.236) -- 0:00:04
946000 -- (-1221.821) (-1228.501) [-1227.175] (-1223.222) * (-1221.773) (-1221.246) (-1221.513) [-1222.472] -- 0:00:04
946500 -- [-1223.777] (-1223.897) (-1222.674) (-1221.641) * (-1221.067) (-1224.106) (-1221.795) [-1225.891] -- 0:00:04
947000 -- (-1224.439) (-1226.559) (-1222.521) [-1222.336] * [-1221.465] (-1221.727) (-1220.848) (-1221.562) -- 0:00:04
947500 -- (-1226.017) (-1224.754) [-1222.897] (-1224.590) * [-1221.723] (-1221.721) (-1224.042) (-1223.328) -- 0:00:04
948000 -- (-1225.417) (-1220.742) [-1221.300] (-1223.254) * (-1223.340) [-1227.994] (-1225.405) (-1222.210) -- 0:00:04
948500 -- (-1222.100) (-1221.115) (-1223.087) [-1225.087] * (-1224.244) (-1225.920) (-1221.712) [-1221.742] -- 0:00:04
949000 -- (-1225.389) (-1221.100) (-1222.326) [-1222.364] * (-1223.112) (-1228.381) [-1221.300] (-1221.861) -- 0:00:04
949500 -- [-1220.963] (-1220.948) (-1224.348) (-1225.361) * (-1223.220) (-1221.585) [-1221.209] (-1223.506) -- 0:00:04
950000 -- (-1220.652) (-1223.614) [-1223.105] (-1221.590) * (-1221.517) (-1220.839) (-1223.170) [-1223.163] -- 0:00:04
Average standard deviation of split frequencies: 0.005091
950500 -- [-1222.667] (-1224.124) (-1226.023) (-1222.462) * (-1221.511) [-1223.246] (-1225.160) (-1225.323) -- 0:00:04
951000 -- (-1222.599) (-1224.762) (-1223.202) [-1222.603] * (-1223.010) (-1224.059) [-1223.676] (-1223.474) -- 0:00:04
951500 -- (-1224.862) (-1222.115) [-1222.516] (-1222.123) * [-1224.083] (-1222.338) (-1227.355) (-1222.104) -- 0:00:04
952000 -- [-1220.780] (-1221.619) (-1223.404) (-1222.718) * (-1222.234) (-1221.285) [-1225.037] (-1222.128) -- 0:00:04
952500 -- [-1222.273] (-1221.067) (-1225.829) (-1222.203) * (-1221.904) [-1220.592] (-1226.240) (-1227.059) -- 0:00:04
953000 -- [-1225.109] (-1221.092) (-1222.863) (-1222.734) * [-1222.388] (-1220.540) (-1223.800) (-1222.865) -- 0:00:04
953500 -- (-1224.526) (-1221.927) (-1224.004) [-1227.715] * (-1221.245) (-1231.247) (-1222.109) [-1225.899] -- 0:00:03
954000 -- [-1224.363] (-1225.086) (-1223.018) (-1225.655) * (-1222.521) [-1223.695] (-1229.734) (-1224.070) -- 0:00:03
954500 -- (-1221.872) [-1223.169] (-1222.777) (-1224.273) * (-1224.126) [-1224.860] (-1223.775) (-1222.280) -- 0:00:03
955000 -- [-1223.306] (-1220.787) (-1222.679) (-1221.699) * (-1225.777) (-1224.278) (-1221.270) [-1223.400] -- 0:00:03
Average standard deviation of split frequencies: 0.005063
955500 -- [-1222.919] (-1224.038) (-1221.638) (-1224.206) * (-1222.233) [-1221.290] (-1223.205) (-1222.641) -- 0:00:03
956000 -- (-1222.954) (-1236.957) (-1222.925) [-1223.638] * [-1225.911] (-1222.727) (-1224.661) (-1222.757) -- 0:00:03
956500 -- [-1228.704] (-1224.108) (-1223.483) (-1223.152) * [-1222.950] (-1223.821) (-1225.755) (-1221.179) -- 0:00:03
957000 -- (-1223.669) (-1222.621) [-1222.222] (-1221.211) * (-1221.969) (-1223.995) [-1222.530] (-1223.870) -- 0:00:03
957500 -- (-1224.866) (-1223.786) (-1231.761) [-1225.439] * (-1221.314) (-1223.237) (-1222.027) [-1222.452] -- 0:00:03
958000 -- (-1222.272) (-1221.495) (-1225.492) [-1224.432] * (-1222.111) (-1221.778) [-1223.209] (-1222.692) -- 0:00:03
958500 -- [-1222.030] (-1223.148) (-1221.542) (-1222.863) * (-1222.293) (-1221.616) [-1226.884] (-1223.880) -- 0:00:03
959000 -- (-1221.808) [-1221.204] (-1220.967) (-1223.462) * (-1223.448) [-1221.659] (-1222.141) (-1222.751) -- 0:00:03
959500 -- (-1222.631) (-1226.689) [-1220.891] (-1222.985) * (-1223.608) [-1223.402] (-1223.811) (-1224.389) -- 0:00:03
960000 -- (-1224.167) [-1222.096] (-1222.852) (-1222.707) * (-1221.215) (-1221.106) (-1223.926) [-1220.696] -- 0:00:03
Average standard deviation of split frequencies: 0.005103
960500 -- (-1225.410) (-1222.144) [-1222.006] (-1223.896) * [-1221.194] (-1221.441) (-1223.120) (-1224.553) -- 0:00:03
961000 -- [-1222.133] (-1224.850) (-1223.139) (-1224.009) * (-1222.577) (-1222.136) (-1222.631) [-1221.336] -- 0:00:03
961500 -- [-1222.307] (-1224.111) (-1228.173) (-1223.743) * [-1220.652] (-1223.137) (-1223.557) (-1221.749) -- 0:00:03
962000 -- (-1221.822) (-1223.080) (-1229.245) [-1221.476] * (-1224.499) (-1221.757) (-1221.461) [-1221.061] -- 0:00:03
962500 -- (-1221.673) (-1222.635) (-1225.311) [-1220.840] * (-1222.292) (-1224.515) (-1222.787) [-1223.003] -- 0:00:03
963000 -- (-1221.493) (-1222.440) [-1222.273] (-1221.186) * (-1223.068) (-1220.712) [-1222.316] (-1223.970) -- 0:00:03
963500 -- (-1222.622) [-1223.771] (-1222.800) (-1225.024) * [-1225.339] (-1221.772) (-1220.699) (-1222.156) -- 0:00:03
964000 -- [-1221.701] (-1223.922) (-1224.600) (-1223.861) * [-1225.640] (-1228.244) (-1220.819) (-1229.624) -- 0:00:03
964500 -- (-1225.536) (-1222.051) [-1221.944] (-1222.191) * [-1222.222] (-1220.935) (-1221.501) (-1226.568) -- 0:00:03
965000 -- (-1223.322) (-1222.265) [-1222.887] (-1223.047) * [-1222.749] (-1221.906) (-1221.792) (-1224.670) -- 0:00:03
Average standard deviation of split frequencies: 0.005303
965500 -- (-1220.970) [-1222.437] (-1221.588) (-1222.932) * (-1221.148) (-1222.419) [-1225.759] (-1224.291) -- 0:00:02
966000 -- (-1221.571) (-1223.223) [-1222.106] (-1225.198) * (-1223.822) (-1221.938) (-1225.239) [-1223.122] -- 0:00:02
966500 -- [-1221.810] (-1221.354) (-1222.252) (-1222.880) * (-1222.648) (-1225.431) [-1221.258] (-1224.768) -- 0:00:02
967000 -- (-1223.404) [-1220.630] (-1222.288) (-1222.058) * (-1223.747) (-1234.083) [-1222.740] (-1225.935) -- 0:00:02
967500 -- [-1222.189] (-1221.785) (-1222.331) (-1223.099) * (-1224.801) [-1222.803] (-1224.124) (-1221.487) -- 0:00:02
968000 -- (-1221.649) [-1222.859] (-1225.641) (-1221.816) * (-1224.342) (-1222.949) [-1221.555] (-1222.952) -- 0:00:02
968500 -- [-1221.644] (-1222.105) (-1228.779) (-1222.010) * (-1226.946) (-1222.470) [-1222.905] (-1221.894) -- 0:00:02
969000 -- (-1222.131) (-1225.095) (-1225.016) [-1229.361] * (-1223.701) (-1224.151) (-1223.939) [-1222.325] -- 0:00:02
969500 -- [-1221.936] (-1225.992) (-1225.010) (-1223.269) * (-1221.669) [-1220.846] (-1223.074) (-1223.289) -- 0:00:02
970000 -- (-1221.201) (-1229.096) (-1222.550) [-1225.400] * (-1221.400) (-1222.721) (-1222.216) [-1221.205] -- 0:00:02
Average standard deviation of split frequencies: 0.005828
970500 -- (-1221.815) [-1225.128] (-1221.183) (-1226.039) * (-1221.536) [-1222.562] (-1223.465) (-1221.754) -- 0:00:02
971000 -- (-1221.717) (-1226.186) (-1222.748) [-1222.787] * [-1221.491] (-1224.696) (-1227.599) (-1222.211) -- 0:00:02
971500 -- (-1221.560) [-1224.921] (-1222.736) (-1223.367) * (-1221.787) (-1224.609) (-1223.998) [-1225.299] -- 0:00:02
972000 -- (-1221.973) [-1223.179] (-1223.832) (-1222.765) * (-1222.164) [-1222.066] (-1223.142) (-1221.489) -- 0:00:02
972500 -- [-1222.135] (-1222.850) (-1224.111) (-1227.818) * (-1226.795) (-1220.951) (-1222.150) [-1222.139] -- 0:00:02
973000 -- (-1222.905) (-1221.077) [-1224.389] (-1224.447) * (-1226.522) [-1221.311] (-1221.956) (-1222.349) -- 0:00:02
973500 -- [-1223.229] (-1222.030) (-1223.731) (-1220.964) * (-1228.882) (-1221.329) (-1222.545) [-1225.151] -- 0:00:02
974000 -- [-1226.948] (-1226.703) (-1224.284) (-1222.865) * (-1228.878) [-1221.708] (-1222.518) (-1224.578) -- 0:00:02
974500 -- (-1227.685) (-1225.859) (-1221.915) [-1222.409] * (-1222.393) (-1222.889) (-1223.031) [-1223.014] -- 0:00:02
975000 -- [-1222.777] (-1223.589) (-1221.245) (-1223.675) * (-1221.456) [-1221.925] (-1223.994) (-1221.924) -- 0:00:02
Average standard deviation of split frequencies: 0.006098
975500 -- (-1230.686) (-1223.824) [-1221.739] (-1222.688) * (-1224.388) (-1223.497) (-1225.746) [-1221.925] -- 0:00:02
976000 -- [-1223.288] (-1224.764) (-1221.964) (-1222.647) * (-1223.746) [-1221.786] (-1225.971) (-1222.370) -- 0:00:02
976500 -- [-1223.370] (-1223.288) (-1221.752) (-1224.674) * (-1222.934) (-1222.089) (-1223.001) [-1223.641] -- 0:00:02
977000 -- (-1220.711) [-1221.512] (-1221.820) (-1223.725) * (-1223.254) (-1222.336) (-1223.480) [-1223.603] -- 0:00:01
977500 -- (-1222.065) (-1221.400) [-1221.429] (-1222.196) * (-1223.264) (-1224.920) [-1227.941] (-1223.879) -- 0:00:01
978000 -- (-1223.382) [-1221.174] (-1221.277) (-1221.912) * [-1224.847] (-1221.951) (-1224.712) (-1223.694) -- 0:00:01
978500 -- (-1224.859) [-1221.903] (-1225.232) (-1224.562) * [-1221.719] (-1225.020) (-1222.801) (-1223.172) -- 0:00:01
979000 -- [-1222.504] (-1221.392) (-1222.472) (-1224.284) * (-1221.563) (-1225.315) (-1226.055) [-1221.494] -- 0:00:01
979500 -- (-1223.614) (-1227.322) (-1222.950) [-1223.089] * (-1222.966) (-1222.251) (-1223.684) [-1221.033] -- 0:00:01
980000 -- (-1224.042) [-1233.030] (-1223.032) (-1223.718) * (-1223.215) (-1220.811) (-1224.044) [-1223.689] -- 0:00:01
Average standard deviation of split frequencies: 0.006189
980500 -- (-1223.745) (-1227.095) [-1222.823] (-1220.929) * (-1223.043) (-1220.931) (-1221.891) [-1221.217] -- 0:00:01
981000 -- [-1222.061] (-1225.778) (-1222.567) (-1221.628) * (-1222.442) [-1221.882] (-1223.382) (-1224.261) -- 0:00:01
981500 -- (-1225.447) [-1226.179] (-1221.452) (-1224.533) * (-1223.387) [-1222.414] (-1220.944) (-1221.187) -- 0:00:01
982000 -- (-1223.322) (-1223.134) [-1220.714] (-1222.237) * (-1227.006) [-1221.368] (-1224.737) (-1221.650) -- 0:00:01
982500 -- (-1221.189) (-1224.059) [-1227.731] (-1222.372) * (-1222.824) [-1224.322] (-1221.611) (-1222.501) -- 0:00:01
983000 -- [-1221.213] (-1225.903) (-1225.792) (-1224.086) * (-1221.758) (-1223.282) [-1223.662] (-1221.971) -- 0:00:01
983500 -- (-1222.192) (-1221.936) [-1221.571] (-1222.667) * [-1221.688] (-1223.658) (-1223.539) (-1222.688) -- 0:00:01
984000 -- [-1222.082] (-1222.868) (-1222.554) (-1225.383) * (-1221.820) [-1221.347] (-1225.746) (-1222.920) -- 0:00:01
984500 -- [-1226.316] (-1223.107) (-1222.570) (-1226.177) * (-1222.178) (-1223.331) [-1222.121] (-1223.218) -- 0:00:01
985000 -- (-1226.949) (-1225.365) [-1221.048] (-1223.053) * (-1223.970) (-1222.630) [-1221.031] (-1221.479) -- 0:00:01
Average standard deviation of split frequencies: 0.006245
985500 -- [-1223.275] (-1227.638) (-1222.476) (-1221.868) * [-1221.523] (-1224.853) (-1221.328) (-1221.968) -- 0:00:01
986000 -- (-1222.523) (-1229.924) [-1221.682] (-1224.791) * (-1222.324) (-1224.422) (-1221.769) [-1222.053] -- 0:00:01
986500 -- (-1221.351) [-1222.804] (-1221.385) (-1222.091) * (-1222.876) (-1224.223) [-1221.895] (-1223.589) -- 0:00:01
987000 -- [-1222.504] (-1226.098) (-1221.766) (-1221.765) * (-1223.925) (-1222.094) [-1221.805] (-1222.358) -- 0:00:01
987500 -- (-1222.600) (-1225.672) (-1224.308) [-1221.358] * (-1225.203) [-1221.086] (-1224.453) (-1221.041) -- 0:00:01
988000 -- (-1224.087) (-1227.610) (-1221.195) [-1223.148] * [-1220.801] (-1222.281) (-1220.773) (-1220.917) -- 0:00:01
988500 -- (-1226.132) (-1222.149) [-1221.849] (-1220.628) * [-1221.027] (-1227.160) (-1224.277) (-1224.707) -- 0:00:00
989000 -- (-1229.334) (-1220.581) (-1223.366) [-1223.628] * [-1221.551] (-1222.390) (-1224.969) (-1222.482) -- 0:00:00
989500 -- (-1221.443) [-1225.918] (-1222.114) (-1221.417) * (-1222.991) (-1221.716) (-1220.867) [-1222.754] -- 0:00:00
990000 -- (-1222.385) (-1224.672) [-1223.035] (-1221.410) * (-1224.024) [-1224.607] (-1220.748) (-1220.674) -- 0:00:00
Average standard deviation of split frequencies: 0.006156
990500 -- (-1222.467) (-1223.430) [-1222.116] (-1222.170) * (-1223.777) (-1223.981) (-1223.747) [-1221.658] -- 0:00:00
991000 -- (-1224.240) (-1221.032) (-1226.945) [-1224.365] * (-1221.415) (-1225.439) (-1221.593) [-1223.603] -- 0:00:00
991500 -- [-1221.535] (-1222.727) (-1222.393) (-1223.726) * (-1223.727) (-1224.188) (-1221.406) [-1224.587] -- 0:00:00
992000 -- [-1221.250] (-1221.157) (-1232.050) (-1225.377) * (-1225.310) (-1222.077) (-1224.064) [-1223.452] -- 0:00:00
992500 -- [-1223.076] (-1227.333) (-1222.122) (-1224.300) * (-1226.289) (-1222.892) [-1222.280] (-1222.463) -- 0:00:00
993000 -- (-1222.747) (-1225.173) [-1221.865] (-1222.116) * (-1220.640) (-1222.984) [-1222.979] (-1222.051) -- 0:00:00
993500 -- (-1222.416) [-1221.210] (-1221.583) (-1224.617) * (-1221.965) (-1223.112) (-1221.763) [-1222.328] -- 0:00:00
994000 -- (-1221.136) (-1224.602) [-1222.212] (-1225.027) * (-1224.187) (-1224.195) (-1220.678) [-1225.881] -- 0:00:00
994500 -- (-1222.660) (-1221.469) (-1225.246) [-1224.247] * (-1224.381) (-1222.470) [-1220.914] (-1222.327) -- 0:00:00
995000 -- (-1223.476) [-1222.043] (-1222.024) (-1222.248) * (-1222.546) [-1221.536] (-1222.596) (-1223.964) -- 0:00:00
Average standard deviation of split frequencies: 0.006360
995500 -- [-1225.380] (-1222.411) (-1221.433) (-1222.854) * [-1222.640] (-1221.864) (-1222.813) (-1224.799) -- 0:00:00
996000 -- (-1221.795) (-1223.491) (-1223.563) [-1225.895] * (-1227.041) (-1220.992) (-1222.256) [-1225.257] -- 0:00:00
996500 -- (-1221.672) (-1223.285) [-1225.387] (-1223.673) * (-1225.048) (-1222.421) (-1222.568) [-1222.629] -- 0:00:00
997000 -- [-1221.535] (-1224.153) (-1221.795) (-1222.153) * (-1225.335) (-1221.306) (-1223.150) [-1222.405] -- 0:00:00
997500 -- [-1223.443] (-1221.015) (-1221.934) (-1225.122) * (-1226.959) [-1221.687] (-1222.622) (-1222.412) -- 0:00:00
998000 -- (-1221.321) (-1224.599) [-1221.374] (-1222.959) * (-1223.683) [-1221.669] (-1221.005) (-1222.228) -- 0:00:00
998500 -- (-1222.974) (-1225.533) [-1221.339] (-1221.589) * [-1222.061] (-1224.611) (-1220.579) (-1222.456) -- 0:00:00
999000 -- (-1223.786) (-1224.467) (-1221.429) [-1222.144] * [-1221.251] (-1226.093) (-1221.288) (-1224.316) -- 0:00:00
999500 -- (-1222.983) (-1224.097) [-1221.101] (-1222.389) * (-1220.882) (-1223.273) [-1221.720] (-1222.788) -- 0:00:00
1000000 -- (-1222.161) (-1224.330) (-1223.856) [-1224.069] * (-1220.690) [-1222.661] (-1223.001) (-1227.393) -- 0:00:00
Average standard deviation of split frequencies: 0.005182
Analysis completed in 1 mins 26 seconds
Analysis used 84.30 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1220.41
Likelihood of best state for "cold" chain of run 2 was -1220.41
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.0 % ( 27 %) Dirichlet(Pi{all})
28.2 % ( 20 %) Slider(Pi{all})
78.5 % ( 45 %) Multiplier(Alpha{1,2})
77.4 % ( 43 %) Multiplier(Alpha{3})
18.2 % ( 24 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 64 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
26.5 % ( 22 %) Dirichlet(Pi{all})
27.8 % ( 26 %) Slider(Pi{all})
78.6 % ( 53 %) Multiplier(Alpha{1,2})
77.2 % ( 54 %) Multiplier(Alpha{3})
19.0 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.4 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167127 0.82 0.67
3 | 166101 166952 0.84
4 | 166186 167048 166586
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166575 0.82 0.67
3 | 166284 167087 0.84
4 | 167175 166528 166351
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1221.76
| 2 |
| |
| |
| 1 1 2 |
| 1 1 1 |
| 1 2 21 2 1 2 2 22|
| 1 1 1 2 2 2 21 2 1 1 2 2 |
| 12*1 1 1* 21 1 212 1 2 * |
|2 1 * 2 2 1 1 2 12 12 1 12 2 1|
| 1 2 *2* 2 2 1 1 1 2 2 2 1 2 |
| 2 12 21 2 11 2 2 2 1 2 111 |
|12 21 1 2 1 1 2 1 |
| 2 1 1 1 |
| 1 2 1 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1223.74
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1222.15 -1226.04
2 -1222.10 -1225.30
--------------------------------------
TOTAL -1222.12 -1225.74
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889232 0.085035 0.379797 1.500345 0.864558 1501.00 1501.00 1.000
r(A<->C){all} 0.162360 0.018987 0.000050 0.447328 0.121702 145.63 253.24 1.006
r(A<->G){all} 0.165698 0.017517 0.000150 0.429617 0.134699 229.90 233.03 1.004
r(A<->T){all} 0.164795 0.018778 0.000028 0.436610 0.127262 188.64 246.80 1.000
r(C<->G){all} 0.169495 0.021651 0.000108 0.476452 0.128730 161.25 161.58 1.011
r(C<->T){all} 0.179605 0.023015 0.000084 0.486422 0.138377 163.77 214.61 1.006
r(G<->T){all} 0.158046 0.018001 0.000085 0.417997 0.123394 188.14 221.18 1.005
pi(A){all} 0.191757 0.000171 0.167131 0.217262 0.191442 1119.30 1152.48 1.000
pi(C){all} 0.288239 0.000236 0.258420 0.317282 0.287938 1235.08 1368.04 1.000
pi(G){all} 0.311994 0.000236 0.281750 0.342067 0.311667 1285.51 1315.32 1.000
pi(T){all} 0.208010 0.000187 0.180572 0.234605 0.207664 1199.69 1247.23 1.000
alpha{1,2} 0.438378 0.234764 0.000115 1.362373 0.275869 864.49 1096.17 1.000
alpha{3} 0.449836 0.226353 0.000174 1.382247 0.288656 865.08 1084.29 1.000
pinvar{all} 0.998310 0.000004 0.994343 0.999999 0.998951 1213.91 1262.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .****.
9 -- .*..*.
10 -- .**.**
11 -- .*.*..
12 -- ...*.*
13 -- ..*..*
14 -- .**...
15 -- ..**..
16 -- .*...*
17 -- ..****
18 -- ...**.
19 -- .*.***
20 -- .***.*
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 486 0.161892 0.001884 0.160560 0.163225 2
8 472 0.157229 0.000000 0.157229 0.157229 2
9 452 0.150566 0.001884 0.149234 0.151899 2
10 440 0.146569 0.007537 0.141239 0.151899 2
11 437 0.145570 0.005182 0.141905 0.149234 2
12 437 0.145570 0.011777 0.137242 0.153897 2
13 434 0.144570 0.000000 0.144570 0.144570 2
14 432 0.143904 0.009422 0.137242 0.150566 2
15 430 0.143238 0.001884 0.141905 0.144570 2
16 429 0.142905 0.002355 0.141239 0.144570 2
17 425 0.141572 0.010835 0.133911 0.149234 2
18 417 0.138907 0.005182 0.135243 0.142572 2
19 410 0.136576 0.016017 0.125250 0.147901 2
20 401 0.133578 0.003298 0.131246 0.135909 2
21 371 0.123584 0.000471 0.123251 0.123917 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rfbE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098056 0.009290 0.000008 0.285320 0.069365 1.000 2
length{all}[2] 0.098746 0.009954 0.000042 0.291306 0.067099 1.000 2
length{all}[3] 0.096913 0.009270 0.000024 0.288337 0.066227 1.002 2
length{all}[4] 0.100683 0.010721 0.000030 0.300572 0.068945 1.000 2
length{all}[5] 0.098574 0.009677 0.000019 0.292801 0.068374 1.000 2
length{all}[6] 0.098891 0.009727 0.000074 0.296023 0.068433 1.000 2
length{all}[7] 0.095494 0.009192 0.000005 0.312721 0.063677 0.998 2
length{all}[8] 0.092232 0.008422 0.000030 0.282797 0.064562 0.998 2
length{all}[9] 0.093697 0.008641 0.000140 0.293003 0.064200 0.998 2
length{all}[10] 0.094517 0.008605 0.000072 0.279970 0.069014 0.999 2
length{all}[11] 0.099398 0.011850 0.000200 0.303652 0.065949 1.003 2
length{all}[12] 0.104970 0.011973 0.000193 0.337081 0.073679 0.999 2
length{all}[13] 0.099591 0.008924 0.000493 0.278378 0.073981 1.001 2
length{all}[14] 0.096614 0.007899 0.000211 0.270560 0.073346 1.003 2
length{all}[15] 0.103176 0.013070 0.000204 0.333051 0.063658 0.999 2
length{all}[16] 0.101759 0.010716 0.000288 0.333202 0.066376 0.998 2
length{all}[17] 0.098315 0.008843 0.000118 0.273046 0.071125 1.005 2
length{all}[18] 0.099778 0.009248 0.000630 0.288313 0.073652 0.998 2
length{all}[19] 0.105598 0.008620 0.000045 0.292901 0.078699 1.001 2
length{all}[20] 0.097368 0.008583 0.000237 0.282748 0.066583 0.998 2
length{all}[21] 0.100409 0.010098 0.000164 0.320392 0.068904 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005182
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 939
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
45 ambiguity characters in seq. 1
90 ambiguity characters in seq. 2
45 ambiguity characters in seq. 3
45 ambiguity characters in seq. 4
45 ambiguity characters in seq. 5
45 ambiguity characters in seq. 6
30 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 283 / 283 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 283 / 283 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022467 0.015195 0.045773 0.094276 0.037390 0.038512 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1205.250041
Iterating by ming2
Initial: fx= 1205.250041
x= 0.02247 0.01520 0.04577 0.09428 0.03739 0.03851 0.30000 1.30000
1 h-m-p 0.0000 0.0001 679.8642 ++ 1180.031747 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0041 95.4654 ++ 1177.534713 m 0.0041 24 | 2/8
3 h-m-p 0.0006 0.0031 132.6425 ++ 1175.321095 m 0.0031 35 | 3/8
4 h-m-p 0.0001 0.0005 119.8586 ++ 1170.699072 m 0.0005 46 | 4/8
5 h-m-p 0.0001 0.0003 180.6996 ++ 1152.610034 m 0.0003 57 | 5/8
6 h-m-p 0.0001 0.0006 127.1494 ++ 1146.847199 m 0.0006 68 | 6/8
7 h-m-p 0.0030 0.0487 13.9694 ------------.. | 6/8
8 h-m-p 0.0000 0.0002 273.5509 +++ 1134.711036 m 0.0002 101 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 1134.711036 m 8.0000 112 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.711036 m 8.0000 127 | 7/8
11 h-m-p 0.0160 8.0000 0.3894 -----------Y 1134.711036 0 0.0000 150 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 ---Y 1134.711036 0 0.0000 165 | 7/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.711036 m 8.0000 180 | 7/8
14 h-m-p 0.0002 0.1161 5.3887 +++++ 1134.710673 m 0.1161 195 | 8/8
15 h-m-p 0.0160 8.0000 0.0000 N 1134.710673 0 0.0160 206 | 8/8
16 h-m-p 0.0160 8.0000 0.0000 N 1134.710673 0 0.0160 217
Out..
lnL = -1134.710673
218 lfun, 218 eigenQcodon, 1308 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087364 0.091639 0.067142 0.037199 0.027023 0.077118 0.000100 0.712787 0.314397
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.486453
np = 9
lnL0 = -1237.044918
Iterating by ming2
Initial: fx= 1237.044918
x= 0.08736 0.09164 0.06714 0.03720 0.02702 0.07712 0.00011 0.71279 0.31440
1 h-m-p 0.0000 0.0000 623.7676 ++ 1236.569344 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 607.0498 +++ 1194.279984 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 293.6928 ++ 1182.998221 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0008 220.2705 ++ 1149.572408 m 0.0008 51 | 4/9
5 h-m-p 0.0000 0.0000 7314.1518 ++ 1141.553377 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 4118.8494 ++ 1135.862328 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0000 963.2590 ++ 1134.710838 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 1134.710837 m 8.0000 99 | 7/9
9 h-m-p 0.0137 6.8631 0.1405 ----------Y 1134.710837 0 0.0000 123 | 7/9
10 h-m-p 0.0056 2.7796 0.0375 +++++ 1134.710681 m 2.7796 140 | 8/9
11 h-m-p 0.5558 8.0000 0.0516 -------------Y 1134.710681 0 0.0000 167 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
13 h-m-p 0.0056 2.7773 0.0018 +++++ 1134.710672 m 2.7773 207 | 9/9
14 h-m-p 0.0160 8.0000 0.0000 C 1134.710672 0 0.0160 220 | 9/9
15 h-m-p 0.0160 8.0000 0.0000 C 1134.710672 0 0.0160 232
Out..
lnL = -1134.710672
233 lfun, 699 eigenQcodon, 2796 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.051026 0.035494 0.039205 0.065059 0.065317 0.108902 0.000100 1.759702 0.414054 0.391125 2.178159
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.537813
np = 11
lnL0 = -1228.761482
Iterating by ming2
Initial: fx= 1228.761482
x= 0.05103 0.03549 0.03920 0.06506 0.06532 0.10890 0.00011 1.75970 0.41405 0.39112 2.17816
1 h-m-p 0.0000 0.0000 593.6744 ++ 1228.241276 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 348.4965 +++ 1172.843649 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0000 1410.6255 ++ 1168.501085 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0003 283.9542 ++ 1155.575051 m 0.0003 59 | 4/11
5 h-m-p 0.0000 0.0000 2986.9266 ++ 1145.358291 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 1710.9290 ++ 1145.225518 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 2737.9365 ++ 1142.629273 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 7.7896 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 260.7698 ++ 1134.710995 m 0.0001 140 | 8/11
10 h-m-p 0.4855 8.0000 0.0000 +++ 1134.710995 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0962 +++++ 1134.710957 m 8.0000 175 | 8/11
12 h-m-p 0.0313 8.0000 24.5913 -------------Y 1134.710957 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1134.710957 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 2.2845 -----------Y 1134.710957 0 0.0000 250 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.710957 m 8.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 0.0006 +++++ 1134.710957 m 8.0000 287 | 8/11
17 h-m-p 0.0160 8.0000 1.9848 ----------C 1134.710957 0 0.0000 314 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 ----Y 1134.710957 0 0.0000 332 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 -------Y 1134.710957 0 0.0000 356
Out..
lnL = -1134.710957
357 lfun, 1428 eigenQcodon, 6426 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1134.734365 S = -1134.707878 -0.010174
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035737 0.037374 0.074339 0.030026 0.060143 0.042292 0.000100 0.294666 1.520448
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 25.802174
np = 9
lnL0 = -1206.599116
Iterating by ming2
Initial: fx= 1206.599116
x= 0.03574 0.03737 0.07434 0.03003 0.06014 0.04229 0.00011 0.29467 1.52045
1 h-m-p 0.0000 0.0000 603.4244 ++ 1206.295687 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0055 55.1296 +++++ 1194.792471 m 0.0055 29 | 2/9
3 h-m-p 0.0001 0.0003 588.6307 ++ 1172.640770 m 0.0003 41 | 3/9
4 h-m-p 0.0010 0.0096 177.4950 +
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
+ 1141.506889 m 0.0096 53
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.606319e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95917) = 8.316004e-161 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0002 182.9400
QuantileBeta(0.15, 0.00500, 2.95297) = 8.336719e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93438) = 8.399465e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
+ 1141.450385 m 0.0002 65
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.714549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92819) = 8.420583e-161 2000 rounds
| 5/9
6 h-m-p 0.0000 0.0000 988.1298
QuantileBeta(0.15, 0.00500, 2.93564) = 8.395204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95798) = 8.319953e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
+ 1139.036748 m 0.0000 77
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.295167e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96543) = 8.584748e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96544) = 8.295161e-161 2000 rounds
| 6/9
7 h-m-p 0.0000 0.0002 725.6101
QuantileBeta(0.15, 0.00500, 2.99386) = 8.201918e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.07913) = 7.934271e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
+ 1137.289111 m 0.0002 89
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 8.122876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848869e-161 2000 rounds
| 7/9
8 h-m-p 0.0068 3.4130 28.1173
QuantileBeta(0.15, 0.00500, 3.29935) = 7.317280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15551) = 7.708902e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.11955) = 7.813410e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.11056) = 7.839978e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10831) = 7.846649e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10775) = 7.848318e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10761) = 7.848735e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10757) = 7.848840e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848866e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848872e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848874e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848874e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 8.122876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848869e-161 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0000 258.5723
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
+ 1134.710672 m 0.0000 124
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 8.122876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848869e-161 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
N 1134.710672 0 0.1000 137
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 8.122876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10770) = 7.848446e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10742) = 7.849303e-161 2000 rounds
| 8/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
Y 1134.710672 0 1.6000 150
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
Out..
lnL = -1134.710672
151 lfun, 1661 eigenQcodon, 9060 P(t)
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10756) = 7.848875e-161 2000 rounds
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.091366 0.084383 0.035718 0.096132 0.048192 0.021955 0.000100 0.900000 0.656023 1.061460 2.003029
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.929384
np = 11
lnL0 = -1229.085368
Iterating by ming2
Initial: fx= 1229.085368
x= 0.09137 0.08438 0.03572 0.09613 0.04819 0.02196 0.00011 0.90000 0.65602 1.06146 2.00303
1 h-m-p 0.0000 0.0000 562.2020 ++ 1228.766546 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 365.3768 +++ 1196.860473 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0001 467.2040 ++ 1180.250685 m 0.0001 45 | 3/11
4 h-m-p 0.0004 0.0027 95.5214 ++ 1162.358448 m 0.0027 59 | 4/11
5 h-m-p 0.0000 0.0000 11582.2684 ++ 1137.865692 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 910.6920 ++ 1135.420804 m 0.0001 87 | 6/11
7 h-m-p 0.0000 0.0000 3225.1320 ++ 1135.264130 m 0.0000 101 | 7/11
8 h-m-p 0.0009 0.0505 24.6841 -----------.. | 7/11
9 h-m-p 0.0000 0.0000 274.6147 ++ 1134.711029 m 0.0000 138 | 8/11
10 h-m-p 0.0472 8.0000 0.0000 ++++ 1134.711029 m 8.0000 154 | 8/11
11 h-m-p 0.0160 8.0000 0.0090 +++++ 1134.711028 m 8.0000 174 | 8/11
12 h-m-p 0.2836 8.0000 0.2536 ----------Y 1134.711028 0 0.0000 201 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 ----C 1134.711028 0 0.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 0.0067 +++++ 1134.711027 m 8.0000 242 | 8/11
15 h-m-p 0.1774 8.0000 0.3013 ----------Y 1134.711027 0 0.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 1134.711027 m 8.0000 289 | 8/11
17 h-m-p 0.0160 8.0000 0.3067 ---------Y 1134.711027 0 0.0000 315 | 8/11
18 h-m-p 0.0160 8.0000 0.0005 +++++ 1134.711027 m 8.0000 335 | 8/11
19 h-m-p 0.0160 8.0000 0.3004 ---------N 1134.711027 0 0.0000 361 | 8/11
20 h-m-p 0.0160 8.0000 0.0057 +++++ 1134.711027 m 8.0000 381 | 8/11
21 h-m-p 0.1310 8.0000 0.3454 ----------C 1134.711027 0 0.0000 408 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 -----C 1134.711027 0 0.0000 430 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 Y 1134.711027 0 0.0040 447
Out..
lnL = -1134.711027
448 lfun, 5376 eigenQcodon, 29568 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1134.731739 S = -1134.706900 -0.010937
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:13
did 20 / 58 patterns 0:13
did 30 / 58 patterns 0:13
did 40 / 58 patterns 0:14
did 50 / 58 patterns 0:14
did 58 / 58 patterns 0:14
Time used: 0:14
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/11res/rfbE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 283
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 2 2 2 2 2 2
TTC 11 11 11 11 11 11 | TCC 3 3 3 3 3 3 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 4 4 4 4 4 4 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 5 5 5 5 5 5 | CAC 4 4 4 4 4 4 | CGC 11 11 11 11 11 11
CTA 7 7 7 7 7 7 | CCA 3 3 3 3 3 3 | Gln CAA 4 4 4 4 4 4 | CGA 6 6 6 6 6 6
CTG 17 17 17 17 17 17 | CCG 7 7 7 7 7 7 | CAG 3 3 3 3 3 3 | CGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 9 9 9 9 9 9 | ACC 9 9 9 9 9 9 | AAC 4 4 4 4 4 4 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 7 7 7 7 7 7 | ACG 1 1 1 1 1 1 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 4 4 4 4 4 4 | Asp GAT 8 8 8 8 8 8 | Gly GGT 7 7 7 7 7 7
GTC 0 0 0 0 0 0 | GCC 3 3 3 3 3 3 | GAC 14 14 14 14 14 14 | GGC 11 11 11 11 11 11
GTA 1 1 1 1 1 1 | GCA 6 6 6 6 6 6 | Glu GAA 3 3 3 3 3 3 | GGA 6 6 6 6 6 6
GTG 7 7 7 7 7 7 | GCG 5 5 5 5 5 5 | GAG 9 9 9 9 9 9 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_081439390_1_115_MLBR_RS00555
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
#2: NC_002677_1_NP_301209_1_81_rfbE
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
#3: NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
#4: NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
#5: NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
#6: NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 12
TTC 66 | TCC 18 | TAC 30 | TGC 12
Leu L TTA 12 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 12 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 24 | Arg R CGT 18
CTC 12 | CCC 30 | CAC 24 | CGC 66
CTA 42 | CCA 18 | Gln Q CAA 24 | CGA 36
CTG 102 | CCG 42 | CAG 18 | CGG 60
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0
ATC 54 | ACC 54 | AAC 24 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 42 | ACG 6 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 24 | Asp D GAT 48 | Gly G GGT 42
GTC 0 | GCC 18 | GAC 84 | GGC 66
GTA 6 | GCA 36 | Glu E GAA 18 | GGA 36
GTG 42 | GCG 30 | GAG 54 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17668 C:0.31802 A:0.17668 G:0.32862
position 2: T:0.29682 C:0.19788 A:0.23675 G:0.26855
position 3: T:0.15548 C:0.34629 A:0.16608 G:0.33216
Average T:0.20966 C:0.28740 A:0.19317 G:0.30978
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1134.710673 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_081439390_1_115_MLBR_RS00555: 0.000004, NC_002677_1_NP_301209_1_81_rfbE: 0.000004, NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575: 0.000004, NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080: 0.000004, NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585: 0.000004, NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 657.4 191.6 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1134.710672 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_081439390_1_115_MLBR_RS00555: 0.000004, NC_002677_1_NP_301209_1_81_rfbE: 0.000004, NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575: 0.000004, NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080: 0.000004, NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585: 0.000004, NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1134.710957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.720206 0.179437 0.000001 1.529762
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_081439390_1_115_MLBR_RS00555: 0.000004, NC_002677_1_NP_301209_1_81_rfbE: 0.000004, NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575: 0.000004, NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080: 0.000004, NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585: 0.000004, NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.72021 0.17944 0.10036
w: 0.00000 1.00000 1.52976
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
7..2 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
7..3 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
7..4 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
7..5 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
7..6 0.000 657.4 191.6 0.3330 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_081439390_1_115_MLBR_RS00555)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_081439390_1_115_MLBR_RS00555)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1134.710672 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 3.107560
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_081439390_1_115_MLBR_RS00555: 0.000004, NC_002677_1_NP_301209_1_81_rfbE: 0.000004, NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575: 0.000004, NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080: 0.000004, NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585: 0.000004, NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 3.10756
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 657.4 191.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1134.711027 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.732629 0.005000 1.364678 2.162931
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_081439390_1_115_MLBR_RS00555: 0.000004, NC_002677_1_NP_301209_1_81_rfbE: 0.000004, NZ_LVXE01000022_1_WP_081439390_1_949_A3216_RS07575: 0.000004, NZ_LYPH01000026_1_WP_081439390_1_1066_A8144_RS05080: 0.000004, NZ_CP029543_1_WP_081439390_1_114_DIJ64_RS00585: 0.000004, NZ_AP014567_1_WP_081439390_1_117_JK2ML_RS00600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.73263 p = 0.00500 q = 1.36468
(p1 = 0.26737) w = 2.16293
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07326 0.07326 0.07326 0.07326 0.07326 0.07326 0.07326 0.07326 0.07326 0.07326 0.26737
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.16293
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
7..2 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
7..3 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
7..4 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
7..5 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
7..6 0.000 657.4 191.6 0.5783 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_081439390_1_115_MLBR_RS00555)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_081439390_1_115_MLBR_RS00555)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:14