--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:51:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/murE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2135.57         -2138.51
2      -2135.53         -2139.34
--------------------------------------
TOTAL    -2135.55         -2139.01
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899213    0.093036    0.339060    1.486467    0.864233   1129.91   1277.41    1.001
r(A<->C){all}   0.167610    0.020365    0.000059    0.463294    0.129994    238.90    303.65    1.000
r(A<->G){all}   0.148719    0.016737    0.000033    0.408757    0.112671    152.90    227.98    1.000
r(A<->T){all}   0.183826    0.023570    0.000166    0.487946    0.148233    176.02    215.43    1.000
r(C<->G){all}   0.177365    0.021055    0.000075    0.481735    0.140250    213.99    254.06    1.000
r(C<->T){all}   0.179475    0.021889    0.000069    0.480688    0.141234    268.88    298.29    1.003
r(G<->T){all}   0.143006    0.015313    0.000066    0.391294    0.110226    264.86    266.23    1.002
pi(A){all}      0.149088    0.000083    0.130505    0.166171    0.149079   1286.59   1393.79    1.001
pi(C){all}      0.295303    0.000128    0.272989    0.317053    0.295384   1156.32   1212.98    1.000
pi(G){all}      0.356660    0.000145    0.331954    0.378322    0.356999   1226.23   1322.51    1.000
pi(T){all}      0.198949    0.000101    0.180247    0.219032    0.198823   1316.77   1395.77    1.000
alpha{1,2}      0.426820    0.223281    0.000270    1.417179    0.265668   1282.70   1292.60    1.000
alpha{3}        0.422906    0.223274    0.000324    1.362547    0.265181   1170.86   1193.14    1.000
pinvar{all}     0.998164    0.000003    0.994932    0.999977    0.998621   1127.52   1201.94    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2061.992849
Model 2: PositiveSelection	-2056.052169
Model 0: one-ratio	-2061.342031
Model 7: beta	-2061.992849
Model 8: beta&w>1	-2059.23429


Model 0 vs 1	1.3016360000001441

Model 2 vs 1	11.881360000000313

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908016_1_947_MLBR_RS04475)

            Pr(w>1)     post mean +- SE for w

   317 V      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908016_1_947_MLBR_RS04475)

            Pr(w>1)     post mean +- SE for w

   317 V      0.906         6.392 +- 3.009


Model 8 vs 7	5.517118000000664
>C1
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C2
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C3
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C4
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C5
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C6
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=530 

C1              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C2              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C3              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C4              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C5              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C6              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
                **************************************************

C1              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C2              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C3              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C4              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C5              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C6              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
                **************************************************

C1              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C2              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C3              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C4              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C5              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C6              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
                **************************************************

C1              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C2              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C3              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C4              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C5              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C6              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
                **************************************************

C1              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C2              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C3              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C4              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C5              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C6              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
                **************************************************

C1              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C2              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C3              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C4              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C5              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C6              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
                **************************************************

C1              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C2              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C3              SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C4              SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C5              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C6              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
                ****************:*********************************

C1              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C2              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C3              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C4              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C5              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C6              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
                **************************************************

C1              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C2              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C3              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C4              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C5              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C6              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
                **************************************************

C1              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C2              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C3              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C4              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C5              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C6              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
                **************************************************

C1              TCPFDDRVELARALQVRDARLLPAPGRACQ
C2              TCPFDDRVELARALQVRDARLLPAPGRACQ
C3              TCPFDDRVELARALQVRDARLLPAPGRACQ
C4              TCPFDDRVELARALQVRDARLLPAPGRACQ
C5              TCPFDDRVELARALQVRDARLLPAPGRACQ
C6              TCPFDDRVELARALQVRDARLLPAPGRACQ
                ******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  530 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  530 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15900]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [15900]--->[15900]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.563 Mb, Max= 31.130 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C2              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C3              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C4              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C5              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
C6              VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
                **************************************************

C1              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C2              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C3              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C4              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C5              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
C6              TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
                **************************************************

C1              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C2              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C3              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C4              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C5              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
C6              QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
                **************************************************

C1              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C2              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C3              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C4              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C5              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
C6              EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
                **************************************************

C1              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C2              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C3              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C4              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C5              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
C6              ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
                **************************************************

C1              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C2              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C3              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C4              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C5              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
C6              LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
                **************************************************

C1              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C2              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C3              SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C4              SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C5              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
C6              SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
                ****************:*********************************

C1              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C2              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C3              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C4              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C5              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
C6              ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
                **************************************************

C1              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C2              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C3              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C4              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C5              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
C6              AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
                **************************************************

C1              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C2              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C3              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C4              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C5              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
C6              GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
                **************************************************

C1              TCPFDDRVELARALQVRDARLLPAPGRACQ
C2              TCPFDDRVELARALQVRDARLLPAPGRACQ
C3              TCPFDDRVELARALQVRDARLLPAPGRACQ
C4              TCPFDDRVELARALQVRDARLLPAPGRACQ
C5              TCPFDDRVELARALQVRDARLLPAPGRACQ
C6              TCPFDDRVELARALQVRDARLLPAPGRACQ
                ******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 99.81 C1	 C3	 99.81
TOP	    2    0	 99.81 C3	 C1	 99.81
BOT	    0    3	 99.81 C1	 C4	 99.81
TOP	    3    0	 99.81 C4	 C1	 99.81
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.81 C2	 C3	 99.81
TOP	    2    1	 99.81 C3	 C2	 99.81
BOT	    1    3	 99.81 C2	 C4	 99.81
TOP	    3    1	 99.81 C4	 C2	 99.81
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.81 C3	 C5	 99.81
TOP	    4    2	 99.81 C5	 C3	 99.81
BOT	    2    5	 99.81 C3	 C6	 99.81
TOP	    5    2	 99.81 C6	 C3	 99.81
BOT	    3    4	 99.81 C4	 C5	 99.81
TOP	    4    3	 99.81 C5	 C4	 99.81
BOT	    3    5	 99.81 C4	 C6	 99.81
TOP	    5    3	 99.81 C6	 C4	 99.81
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.92
AVG	 1	 C2	  *	 99.92
AVG	 2	 C3	  *	 99.85
AVG	 3	 C4	  *	 99.85
AVG	 4	 C5	  *	 99.92
AVG	 5	 C6	  *	 99.92
TOT	 TOT	  *	 99.90
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
C2              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
C3              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
C4              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
C5              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
C6              GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
                **************************************************

C1              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
C2              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
C3              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
C4              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
C5              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
C6              GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
                **************************************************

C1              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
C2              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
C3              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
C4              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
C5              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
C6              ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
                **************************************************

C1              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
C2              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
C3              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
C4              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
C5              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
C6              ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
                **************************************************

C1              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
C2              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
C3              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
C4              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
C5              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
C6              TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
                **************************************************

C1              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
C2              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
C3              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
C4              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
C5              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
C6              GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
                **************************************************

C1              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
C2              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
C3              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
C4              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
C5              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
C6              CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
                **************************************************

C1              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
C2              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
C3              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
C4              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
C5              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
C6              CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
                **************************************************

C1              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
C2              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
C3              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
C4              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
C5              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
C6              TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
                **************************************************

C1              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
C2              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
C3              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
C4              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
C5              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
C6              GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
                **************************************************

C1              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
C2              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
C3              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
C4              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
C5              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
C6              CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
                **************************************************

C1              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
C2              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
C3              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
C4              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
C5              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
C6              AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
                **************************************************

C1              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
C2              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
C3              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
C4              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
C5              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
C6              GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
                **************************************************

C1              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
C2              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
C3              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
C4              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
C5              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
C6              GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
                **************************************************

C1              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
C2              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
C3              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
C4              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
C5              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
C6              ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
                **************************************************

C1              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
C2              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
C3              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
C4              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
C5              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
C6              CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
                **************************************************

C1              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
C2              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
C3              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
C4              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
C5              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
C6              CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
                **************************************************

C1              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
C2              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
C3              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
C4              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
C5              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
C6              CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
                **************************************************

C1              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
C2              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
C3              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTCT
C4              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTCT
C5              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
C6              TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
                ************************************************ *

C1              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
C2              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
C3              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
C4              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
C5              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
C6              CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
                **************************************************

C1              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
C2              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
C3              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
C4              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
C5              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
C6              GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
                **************************************************

C1              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
C2              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
C3              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
C4              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
C5              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
C6              GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
                **************************************************

C1              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
C2              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
C3              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
C4              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
C5              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
C6              CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
                **************************************************

C1              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
C2              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
C3              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
C4              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
C5              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
C6              GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
                **************************************************

C1              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
C2              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
C3              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
C4              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
C5              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
C6              GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
                **************************************************

C1              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
C2              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
C3              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
C4              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
C5              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
C6              GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
                **************************************************

C1              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
C2              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
C3              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
C4              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
C5              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
C6              ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
                **************************************************

C1              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
C2              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
C3              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
C4              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
C5              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
C6              GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
                **************************************************

C1              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
C2              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
C3              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
C4              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
C5              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
C6              GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
                **************************************************

C1              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
C2              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
C3              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
C4              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
C5              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
C6              TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
                **************************************************

C1              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
C2              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
C3              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
C4              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
C5              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
C6              ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
                **************************************************

C1              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
C2              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
C3              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
C4              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
C5              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
C6              TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
                ****************************************



>C1
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C2
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C3
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTCT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C4
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTCT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C5
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C6
GTGACTGAGGTGGTGGCGGTGCCGGTTAGGTTGCGCCCCAGCGCCACTGC
GGGGGTGCGGCTCCCTGAGCTTGTGGCTCAGGTTGGTGCTGTGCTGGCCG
ACGGCCCCGGGCAGGCGGCGACTGTCCCAGACATTCCGGTGACCGGTGTG
ACGCTGCGGGCCCAGGAGGTGCTGTCCGGTGATCTGTTCGCTGCATTGGC
TGGTGCATCCACACACGGCGCTCGGTATGCCGGCGTTGCGCTCGAACGAG
GTGCTGTCGCGGTGCTTACCGACGTTGCAGGGGTCGCCGAGCTGACAGCC
CAGGCCAGCAGCGTGCCGATACTCATACATCCGGAACCCCGCAGCGTGCT
CGGCGGTCTTGCCGCCGCGGCATATGGACATCCCTCCAACCGGATGACGG
TTGTTGGGATTACTGGAACATCGGGTAAGACGACTACCACCTATATGGTT
GAGGCTGGTTTACGGGCTGGTGGGCGAGTGGTCGGGCTAGTCGGCACCAT
CGGCATTCGGATCGACGGTGCCGACATCCCTAGCTTTCTGACCACGCCGG
AGGCTCCTGCGCTGCAGGCGATGCTCGCGGCGATGGTCGAGCGCGGTGTG
GAAACCGTGGTTATGGAGGTGTCTAGTCACGCGTTGAGTCTGGGTCGGGT
GGAAGGCACCCAGTTCGCAGTGGCCGGTTTCACCAATTTGTCTCGCGACC
ACCTCGATTTTCACCCCGACATGGAGGAGTATTTCGAAGCCAAGGCGGTG
CTGTTCGATCCGCACTCGTTGCTGCGGGCTCGCACCGTCGTGGTATGCAT
CGACGATGACGCTGGGCGCGCGACGGCCGCCCGGGCCGGTGACGCCATCA
CAGTCAGCGCCCTAGGTCAACCCGCATCGTGGCGCGCGACGGACATTAGG
TCACCGGGTGTCGGAGCCCAGGAGTTCACCGCCGTAGACCCCGCCGGTGT
CCAGCACCGGGTCGGCATTCGGTTACCCGGCCGCTACAACGTCGCTAATT
GTCTTGTCGCCCTGGCGATTCTAGACGTTGTTGGGGTGTCTCCGGAGCAG
GCTTCCTTGGGGTTCCGGGACATCCGAATCCCCGGACGACTGGAACGGAT
CGACTGCGGCCAAGATTTTCTTGCACTGGTCGACTATGCGCACAAGCCAG
GAGCGTTACACTCAGTGTTGACCGCCCTACTGCAGCCGGACCATCGGCTG
GCAGTGGTGTTCGGTGCGGGGGGCGAGCGTGACCCGGGCAAGCGGGCTCC
GATGGGCGAGATTGCCGCTGAGCTAGCCGATTTGGTCGTCGTGACCGATG
ACAACCCGCGTGGCGAGGATCCGGCGGCAATTCGTCGTGACATTCTGACC
GGCACTGTCGCGGCTGGCGGTGCGGCGCAGGTCGTCGAGATTGGTGACCG
GCGGGCTGCTATCCAATACGCGGTTGCTTGGGCGGGTCCTGATGACGTGG
TGTTGGTGGCGGGCAAAGGTCATGAAACCGGGCAGCGGGGCGCTGCCGAG
ACCTGCCCCTTCGACGACCGGGTGGAGCTGGCTCGGGCGCTGCAGGTCCG
TGACGCCCGACTGCTTCCTGCGCCTGGGCGAGCGTGCCAA
>C1
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C2
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C3
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C4
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGLQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C5
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ
>C6
VTEVVAVPVRLRPSATAGVRLPELVAQVGAVLADGPGQAATVPDIPVTGV
TLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVLTDVAGVAELTA
QASSVPILIHPEPRSVLGGLAAAAYGHPSNRMTVVGITGTSGKTTTTYMV
EAGLRAGGRVVGLVGTIGIRIDGADIPSFLTTPEAPALQAMLAAMVERGV
ETVVMEVSSHALSLGRVEGTQFAVAGFTNLSRDHLDFHPDMEEYFEAKAV
LFDPHSLLRARTVVVCIDDDAGRATAARAGDAITVSALGQPASWRATDIR
SPGVGAQEFTAVDPAGVQHRVGIRLPGRYNVANCLVALAILDVVGVSPEQ
ASLGFRDIRIPGRLERIDCGQDFLALVDYAHKPGALHSVLTALLQPDHRL
AVVFGAGGERDPGKRAPMGEIAAELADLVVVTDDNPRGEDPAAIRRDILT
GTVAAGGAAQVVEIGDRRAAIQYAVAWAGPDDVVLVAGKGHETGQRGAAE
TCPFDDRVELARALQVRDARLLPAPGRACQ


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1590 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579783810
      Setting output file names to "/data/10res/murE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1297432200
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9178160813
      Seed = 473492576
      Swapseed = 1579783810
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3564.529866 -- -24.965149
         Chain 2 -- -3565.203077 -- -24.965149
         Chain 3 -- -3564.529866 -- -24.965149
         Chain 4 -- -3565.167771 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3565.203283 -- -24.965149
         Chain 2 -- -3565.167771 -- -24.965149
         Chain 3 -- -3565.166711 -- -24.965149
         Chain 4 -- -3565.203077 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3564.530] (-3565.203) (-3564.530) (-3565.168) * [-3565.203] (-3565.168) (-3565.167) (-3565.203) 
        500 -- (-2182.760) (-2142.517) (-2140.690) [-2143.794] * (-2187.910) [-2139.067] (-2213.213) (-2168.795) -- 0:00:00
       1000 -- (-2143.524) (-2150.213) (-2145.683) [-2135.703] * (-2193.811) (-2141.817) (-2155.741) [-2135.604] -- 0:00:00
       1500 -- (-2141.752) (-2155.771) (-2138.732) [-2136.893] * (-2161.411) [-2141.457] (-2144.587) (-2137.623) -- 0:00:00
       2000 -- (-2139.494) (-2142.857) (-2143.659) [-2137.268] * (-2143.806) [-2136.698] (-2144.528) (-2142.476) -- 0:00:00
       2500 -- (-2142.666) (-2142.759) [-2143.026] (-2140.328) * (-2138.891) (-2136.714) [-2136.802] (-2143.992) -- 0:00:00
       3000 -- (-2148.233) (-2142.101) [-2142.429] (-2135.792) * (-2148.682) (-2148.420) [-2140.321] (-2140.913) -- 0:00:00
       3500 -- (-2143.903) (-2136.488) (-2144.738) [-2138.982] * [-2137.832] (-2141.220) (-2140.309) (-2146.962) -- 0:00:00
       4000 -- (-2144.181) (-2136.369) [-2138.993] (-2137.642) * [-2141.861] (-2146.571) (-2139.190) (-2143.072) -- 0:00:00
       4500 -- (-2141.461) (-2147.207) [-2145.713] (-2142.740) * [-2138.587] (-2148.249) (-2135.518) (-2141.313) -- 0:00:00
       5000 -- [-2141.161] (-2138.813) (-2142.607) (-2148.537) * (-2144.072) [-2136.156] (-2143.661) (-2138.614) -- 0:00:00

      Average standard deviation of split frequencies: 0.085710

       5500 -- [-2140.530] (-2138.992) (-2140.794) (-2136.065) * (-2137.742) [-2142.832] (-2141.372) (-2143.121) -- 0:00:00
       6000 -- (-2142.266) (-2134.708) (-2140.304) [-2138.829] * (-2140.927) [-2142.546] (-2139.714) (-2138.213) -- 0:00:00
       6500 -- (-2147.345) (-2144.019) (-2135.350) [-2139.732] * [-2139.226] (-2136.397) (-2133.891) (-2136.971) -- 0:00:00
       7000 -- (-2141.927) (-2138.219) [-2140.526] (-2146.353) * [-2140.507] (-2139.927) (-2139.244) (-2136.671) -- 0:00:00
       7500 -- [-2142.797] (-2146.811) (-2141.551) (-2144.590) * (-2149.843) (-2140.327) [-2142.894] (-2142.230) -- 0:00:00
       8000 -- (-2142.689) (-2142.391) (-2140.827) [-2136.427] * (-2142.763) [-2134.752] (-2143.511) (-2135.724) -- 0:02:04
       8500 -- (-2141.105) (-2141.068) (-2144.789) [-2143.822] * (-2136.796) (-2137.859) (-2137.812) [-2144.160] -- 0:01:56
       9000 -- (-2139.673) (-2150.497) [-2137.778] (-2142.776) * (-2136.142) (-2136.228) [-2137.530] (-2140.586) -- 0:01:50
       9500 -- (-2146.484) (-2140.277) (-2141.688) [-2139.531] * (-2140.861) (-2140.105) [-2139.777] (-2138.998) -- 0:01:44
      10000 -- [-2143.454] (-2142.036) (-2140.237) (-2145.165) * (-2141.517) (-2140.354) [-2137.230] (-2138.127) -- 0:01:39

      Average standard deviation of split frequencies: 0.040177

      10500 -- [-2140.894] (-2141.710) (-2147.368) (-2137.707) * (-2138.119) (-2136.622) (-2146.185) [-2136.781] -- 0:01:34
      11000 -- [-2145.578] (-2144.811) (-2141.598) (-2148.565) * (-2145.018) [-2141.735] (-2142.389) (-2138.293) -- 0:01:29
      11500 -- (-2137.153) [-2139.871] (-2146.352) (-2151.713) * (-2151.192) (-2138.635) (-2145.616) [-2134.884] -- 0:01:25
      12000 -- (-2139.170) (-2138.501) [-2139.335] (-2137.521) * [-2135.655] (-2140.134) (-2141.261) (-2137.463) -- 0:01:22
      12500 -- [-2139.952] (-2138.989) (-2136.753) (-2134.963) * (-2149.259) (-2143.184) [-2137.836] (-2137.057) -- 0:01:19
      13000 -- [-2142.682] (-2143.530) (-2137.185) (-2134.963) * (-2151.888) (-2139.230) (-2141.985) [-2137.144] -- 0:01:15
      13500 -- (-2144.897) [-2135.104] (-2141.111) (-2134.803) * (-2139.551) [-2138.682] (-2141.341) (-2150.756) -- 0:01:13
      14000 -- (-2144.973) [-2140.055] (-2140.444) (-2137.116) * [-2141.011] (-2138.140) (-2136.166) (-2137.490) -- 0:01:10
      14500 -- (-2144.519) (-2137.035) (-2139.481) [-2136.925] * (-2136.848) [-2142.799] (-2137.418) (-2140.819) -- 0:01:07
      15000 -- [-2146.731] (-2133.175) (-2140.800) (-2137.301) * (-2141.127) (-2153.697) (-2148.680) [-2137.331] -- 0:01:05

      Average standard deviation of split frequencies: 0.037498

      15500 -- (-2140.269) (-2151.106) (-2147.630) [-2137.282] * (-2144.217) [-2141.224] (-2146.235) (-2138.210) -- 0:01:03
      16000 -- (-2144.372) (-2142.984) [-2138.183] (-2135.383) * [-2135.146] (-2146.265) (-2134.754) (-2142.664) -- 0:01:01
      16500 -- [-2137.000] (-2154.129) (-2136.003) (-2135.995) * (-2135.061) (-2139.943) (-2136.720) [-2139.893] -- 0:00:59
      17000 -- (-2142.819) (-2151.850) (-2141.643) [-2134.702] * [-2135.716] (-2144.671) (-2136.349) (-2134.577) -- 0:00:57
      17500 -- (-2148.053) [-2142.004] (-2144.711) (-2135.360) * (-2141.852) (-2143.683) [-2137.345] (-2136.678) -- 0:00:56
      18000 -- (-2144.970) (-2141.802) [-2138.253] (-2135.364) * (-2145.863) (-2141.970) (-2136.500) [-2139.271] -- 0:00:54
      18500 -- (-2142.747) [-2141.705] (-2139.681) (-2135.250) * (-2147.005) (-2141.170) [-2139.142] (-2141.646) -- 0:00:53
      19000 -- [-2136.004] (-2137.204) (-2146.434) (-2138.814) * (-2141.557) [-2141.957] (-2136.611) (-2134.907) -- 0:00:51
      19500 -- [-2138.352] (-2146.265) (-2144.960) (-2135.108) * [-2142.592] (-2143.851) (-2137.295) (-2139.935) -- 0:00:50
      20000 -- [-2138.475] (-2140.373) (-2143.844) (-2135.110) * [-2146.233] (-2144.321) (-2140.077) (-2148.683) -- 0:00:49

      Average standard deviation of split frequencies: 0.031104

      20500 -- (-2140.802) [-2144.442] (-2134.599) (-2136.822) * (-2141.645) (-2138.957) (-2139.935) [-2136.444] -- 0:00:47
      21000 -- [-2139.170] (-2133.048) (-2135.951) (-2137.326) * [-2143.587] (-2142.784) (-2142.091) (-2135.915) -- 0:00:46
      21500 -- (-2151.623) [-2143.809] (-2135.588) (-2136.759) * (-2143.492) (-2140.733) (-2135.824) [-2141.612] -- 0:01:31
      22000 -- (-2143.330) [-2139.152] (-2136.579) (-2135.928) * (-2140.340) [-2140.004] (-2137.138) (-2141.854) -- 0:01:28
      22500 -- (-2151.747) [-2143.605] (-2135.244) (-2134.782) * (-2139.937) (-2144.722) (-2140.543) [-2144.220] -- 0:01:26
      23000 -- (-2140.300) [-2146.581] (-2135.840) (-2134.453) * (-2139.672) [-2140.842] (-2137.304) (-2141.534) -- 0:01:24
      23500 -- [-2140.888] (-2137.910) (-2135.128) (-2136.280) * (-2142.312) (-2146.494) [-2137.238] (-2140.506) -- 0:01:23
      24000 -- [-2142.588] (-2172.191) (-2135.665) (-2135.725) * [-2134.390] (-2150.777) (-2137.666) (-2146.000) -- 0:01:21
      24500 -- (-2154.669) (-2133.692) [-2135.399] (-2135.840) * (-2145.696) (-2136.834) [-2136.181] (-2141.788) -- 0:01:19
      25000 -- [-2134.873] (-2135.878) (-2136.198) (-2135.712) * (-2149.419) [-2137.583] (-2138.169) (-2139.676) -- 0:01:18

      Average standard deviation of split frequencies: 0.026372

      25500 -- (-2136.419) (-2134.057) (-2135.273) [-2135.794] * (-2143.911) (-2141.451) (-2137.156) [-2138.157] -- 0:01:16
      26000 -- (-2138.876) (-2135.059) (-2138.095) [-2135.612] * [-2139.529] (-2147.429) (-2138.739) (-2141.391) -- 0:01:14
      26500 -- (-2140.161) [-2135.137] (-2135.285) (-2136.518) * (-2135.061) (-2139.831) (-2136.136) [-2138.240] -- 0:01:13
      27000 -- (-2136.561) (-2134.774) [-2134.259] (-2138.415) * (-2138.938) (-2135.449) [-2136.098] (-2152.909) -- 0:01:12
      27500 -- (-2137.829) (-2135.584) (-2137.081) [-2138.689] * (-2141.137) (-2168.734) (-2136.567) [-2138.372] -- 0:01:10
      28000 -- (-2136.457) (-2136.091) (-2138.972) [-2138.171] * (-2148.707) (-2141.363) (-2139.922) [-2137.292] -- 0:01:09
      28500 -- (-2135.329) [-2136.819] (-2136.953) (-2135.985) * (-2138.295) (-2135.442) (-2137.970) [-2135.271] -- 0:01:08
      29000 -- [-2135.204] (-2137.365) (-2136.009) (-2136.476) * (-2135.852) (-2142.782) (-2136.611) [-2136.512] -- 0:01:06
      29500 -- [-2135.744] (-2135.884) (-2137.162) (-2135.341) * (-2138.905) (-2136.536) (-2137.794) [-2141.413] -- 0:01:05
      30000 -- (-2136.971) (-2137.423) (-2135.484) [-2135.223] * (-2138.719) [-2136.621] (-2134.581) (-2138.055) -- 0:01:04

      Average standard deviation of split frequencies: 0.043554

      30500 -- (-2136.167) (-2139.350) [-2139.056] (-2135.143) * [-2139.534] (-2138.151) (-2136.444) (-2139.451) -- 0:01:03
      31000 -- (-2136.471) (-2137.972) [-2135.575] (-2136.256) * (-2138.065) (-2138.290) (-2134.612) [-2141.435] -- 0:01:02
      31500 -- [-2137.509] (-2140.244) (-2138.322) (-2137.250) * (-2142.188) [-2137.005] (-2134.538) (-2142.288) -- 0:01:01
      32000 -- [-2136.925] (-2139.391) (-2138.192) (-2138.365) * [-2138.937] (-2136.160) (-2134.538) (-2144.614) -- 0:01:00
      32500 -- (-2135.512) (-2141.415) (-2140.500) [-2137.560] * (-2146.547) (-2138.371) (-2137.226) [-2142.032] -- 0:00:59
      33000 -- (-2135.014) (-2137.513) (-2134.866) [-2136.400] * [-2143.782] (-2136.133) (-2138.404) (-2141.840) -- 0:00:58
      33500 -- [-2136.965] (-2135.491) (-2134.378) (-2138.756) * (-2144.538) (-2136.453) (-2137.127) [-2148.354] -- 0:00:57
      34000 -- [-2136.334] (-2137.586) (-2140.440) (-2136.928) * [-2138.857] (-2137.632) (-2137.460) (-2137.790) -- 0:00:56
      34500 -- [-2137.782] (-2135.212) (-2136.434) (-2135.461) * (-2140.383) (-2137.560) (-2138.010) [-2142.426] -- 0:00:55
      35000 -- (-2135.322) (-2136.635) [-2136.153] (-2135.597) * [-2138.529] (-2137.421) (-2138.055) (-2138.238) -- 0:00:55

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-2135.384) (-2135.094) [-2135.782] (-2135.250) * [-2138.379] (-2138.562) (-2144.336) (-2136.610) -- 0:01:21
      36000 -- (-2136.097) [-2135.096] (-2136.845) (-2135.079) * (-2153.518) (-2139.032) (-2140.260) [-2140.423] -- 0:01:20
      36500 -- [-2138.458] (-2135.436) (-2137.092) (-2135.430) * (-2140.431) (-2138.069) (-2139.858) [-2138.865] -- 0:01:19
      37000 -- (-2138.916) [-2135.346] (-2139.131) (-2137.625) * (-2143.698) (-2138.503) [-2139.852] (-2142.996) -- 0:01:18
      37500 -- (-2135.774) [-2135.182] (-2134.941) (-2137.629) * (-2143.335) [-2137.015] (-2135.175) (-2138.602) -- 0:01:17
      38000 -- (-2135.684) [-2134.951] (-2138.373) (-2137.610) * [-2141.206] (-2139.769) (-2139.987) (-2141.963) -- 0:01:15
      38500 -- (-2134.451) (-2136.560) [-2135.811] (-2138.622) * [-2136.445] (-2138.910) (-2137.486) (-2138.881) -- 0:01:14
      39000 -- [-2134.373] (-2135.787) (-2135.399) (-2136.637) * [-2146.374] (-2138.860) (-2138.841) (-2137.671) -- 0:01:13
      39500 -- [-2134.274] (-2135.976) (-2135.636) (-2138.681) * (-2137.847) (-2139.162) (-2137.890) [-2134.995] -- 0:01:12
      40000 -- (-2134.674) [-2137.722] (-2136.260) (-2137.235) * (-2138.320) (-2136.141) (-2139.797) [-2137.234] -- 0:01:12

      Average standard deviation of split frequencies: 0.058851

      40500 -- [-2136.091] (-2137.575) (-2138.670) (-2138.065) * (-2138.547) (-2134.749) (-2140.186) [-2135.692] -- 0:01:11
      41000 -- (-2136.136) (-2135.727) [-2139.357] (-2137.407) * (-2135.393) (-2134.152) (-2137.778) [-2135.465] -- 0:01:10
      41500 -- (-2135.317) [-2135.546] (-2142.241) (-2137.049) * (-2140.203) [-2136.200] (-2137.462) (-2135.720) -- 0:01:09
      42000 -- (-2137.123) [-2136.071] (-2143.073) (-2137.359) * [-2141.574] (-2137.662) (-2136.188) (-2134.714) -- 0:01:08
      42500 -- (-2139.911) (-2136.136) [-2137.712] (-2136.053) * [-2137.296] (-2135.601) (-2134.690) (-2135.016) -- 0:01:07
      43000 -- (-2137.001) [-2135.765] (-2139.358) (-2133.987) * (-2142.899) (-2137.248) (-2135.535) [-2135.225] -- 0:01:06
      43500 -- [-2136.147] (-2134.500) (-2136.349) (-2145.490) * (-2139.770) (-2136.418) [-2135.645] (-2135.850) -- 0:01:05
      44000 -- (-2138.500) [-2135.127] (-2138.291) (-2144.887) * (-2140.889) [-2135.683] (-2137.326) (-2135.983) -- 0:01:05
      44500 -- (-2138.690) (-2138.061) [-2136.618] (-2138.315) * [-2140.859] (-2137.048) (-2137.243) (-2135.715) -- 0:01:04
      45000 -- [-2136.509] (-2136.654) (-2134.852) (-2134.124) * [-2143.003] (-2137.756) (-2138.269) (-2135.593) -- 0:01:03

      Average standard deviation of split frequencies: 0.061488

      45500 -- (-2136.440) (-2136.241) (-2135.084) [-2135.756] * [-2138.247] (-2137.195) (-2139.247) (-2134.742) -- 0:01:02
      46000 -- (-2138.309) (-2135.848) [-2135.521] (-2135.095) * [-2141.858] (-2135.588) (-2137.765) (-2137.723) -- 0:01:02
      46500 -- (-2135.197) [-2135.249] (-2136.780) (-2134.888) * [-2139.474] (-2136.265) (-2138.270) (-2136.660) -- 0:01:01
      47000 -- (-2134.918) [-2136.167] (-2136.152) (-2134.625) * (-2141.163) [-2136.484] (-2139.393) (-2136.354) -- 0:01:00
      47500 -- (-2134.856) (-2135.600) [-2135.034] (-2136.356) * [-2137.464] (-2136.690) (-2142.025) (-2136.324) -- 0:01:00
      48000 -- (-2136.124) [-2138.905] (-2135.665) (-2134.843) * (-2137.452) (-2136.652) (-2138.488) [-2133.919] -- 0:00:59
      48500 -- (-2137.677) [-2135.727] (-2134.367) (-2135.720) * (-2137.132) [-2136.073] (-2137.920) (-2134.639) -- 0:00:58
      49000 -- (-2136.085) (-2135.295) (-2136.779) [-2135.562] * (-2135.520) [-2134.505] (-2137.896) (-2135.030) -- 0:00:58
      49500 -- (-2134.722) (-2135.554) [-2136.042] (-2136.032) * (-2135.321) (-2135.082) [-2136.699] (-2136.319) -- 0:00:57
      50000 -- (-2137.585) (-2135.738) [-2137.466] (-2134.737) * (-2134.746) (-2136.584) [-2135.983] (-2135.736) -- 0:01:16

      Average standard deviation of split frequencies: 0.063384

      50500 -- (-2135.987) [-2135.221] (-2136.845) (-2134.465) * (-2134.928) (-2135.632) (-2135.750) [-2135.275] -- 0:01:15
      51000 -- (-2135.300) (-2134.938) (-2136.069) [-2134.455] * (-2136.768) (-2135.117) [-2137.650] (-2135.308) -- 0:01:14
      51500 -- (-2136.176) (-2135.440) [-2135.818] (-2135.333) * [-2134.349] (-2134.598) (-2138.015) (-2136.098) -- 0:01:13
      52000 -- [-2136.148] (-2134.965) (-2136.892) (-2134.980) * (-2136.208) (-2135.312) [-2138.059] (-2134.350) -- 0:01:12
      52500 -- (-2143.565) (-2134.965) (-2137.648) [-2135.660] * [-2135.618] (-2136.567) (-2135.941) (-2134.149) -- 0:01:12
      53000 -- (-2143.053) [-2138.611] (-2137.997) (-2134.465) * (-2135.087) [-2133.551] (-2137.155) (-2134.269) -- 0:01:11
      53500 -- (-2141.967) (-2136.321) (-2135.746) [-2137.534] * (-2135.952) (-2134.617) (-2137.714) [-2135.351] -- 0:01:10
      54000 -- (-2137.968) (-2139.795) [-2138.033] (-2135.010) * [-2136.580] (-2134.925) (-2138.097) (-2134.970) -- 0:01:10
      54500 -- (-2136.247) (-2136.400) [-2138.030] (-2136.154) * [-2135.412] (-2135.937) (-2138.000) (-2139.904) -- 0:01:09
      55000 -- (-2136.141) (-2136.564) [-2137.888] (-2137.117) * (-2137.167) (-2135.153) (-2135.300) [-2135.494] -- 0:01:08

      Average standard deviation of split frequencies: 0.055769

      55500 -- [-2135.725] (-2135.926) (-2139.365) (-2136.707) * (-2135.882) [-2136.312] (-2135.760) (-2134.867) -- 0:01:08
      56000 -- (-2136.602) (-2136.453) (-2134.447) [-2135.504] * (-2136.341) (-2139.843) (-2136.285) [-2134.969] -- 0:01:07
      56500 -- (-2139.932) (-2135.455) (-2137.661) [-2134.649] * (-2138.377) (-2139.724) [-2135.102] (-2134.957) -- 0:01:06
      57000 -- (-2139.348) (-2135.910) [-2137.457] (-2139.168) * (-2135.850) (-2137.400) (-2137.464) [-2135.403] -- 0:01:06
      57500 -- (-2135.481) (-2135.439) [-2135.785] (-2139.435) * (-2134.806) [-2138.358] (-2138.336) (-2136.376) -- 0:01:05
      58000 -- (-2136.111) (-2135.115) (-2135.185) [-2135.393] * (-2135.954) (-2138.938) (-2136.402) [-2136.430] -- 0:01:04
      58500 -- (-2137.626) (-2135.071) [-2135.180] (-2134.689) * (-2136.845) [-2135.786] (-2138.119) (-2136.854) -- 0:01:04
      59000 -- (-2137.524) (-2137.508) (-2134.367) [-2134.781] * (-2137.175) [-2134.047] (-2138.007) (-2135.242) -- 0:01:03
      59500 -- [-2136.955] (-2135.957) (-2134.971) (-2135.883) * (-2137.935) (-2136.273) (-2140.933) [-2134.735] -- 0:01:03
      60000 -- (-2136.425) [-2137.591] (-2135.427) (-2136.030) * (-2140.613) [-2135.456] (-2138.942) (-2132.842) -- 0:01:02

      Average standard deviation of split frequencies: 0.052936

      60500 -- (-2135.563) [-2134.545] (-2135.848) (-2135.851) * (-2138.914) (-2134.969) (-2136.125) [-2134.808] -- 0:01:02
      61000 -- [-2136.625] (-2137.331) (-2137.355) (-2137.081) * (-2136.530) [-2137.668] (-2138.810) (-2135.070) -- 0:01:01
      61500 -- (-2137.165) [-2136.433] (-2136.506) (-2138.714) * (-2136.212) (-2137.898) (-2135.802) [-2135.050] -- 0:01:01
      62000 -- (-2135.673) [-2137.270] (-2135.891) (-2136.357) * (-2136.669) (-2141.776) (-2134.554) [-2135.767] -- 0:01:00
      62500 -- (-2135.373) (-2137.859) (-2139.157) [-2136.014] * (-2136.189) (-2142.127) [-2135.110] (-2145.435) -- 0:01:00
      63000 -- (-2135.772) (-2138.889) (-2141.252) [-2136.060] * [-2136.403] (-2140.838) (-2132.509) (-2133.835) -- 0:00:59
      63500 -- [-2135.440] (-2136.488) (-2142.753) (-2134.863) * (-2135.761) [-2135.956] (-2139.800) (-2134.845) -- 0:00:58
      64000 -- (-2134.795) [-2138.381] (-2138.108) (-2135.644) * [-2138.113] (-2136.842) (-2139.436) (-2135.025) -- 0:01:13
      64500 -- [-2134.384] (-2135.815) (-2139.136) (-2135.764) * (-2136.783) (-2138.567) [-2136.224] (-2134.969) -- 0:01:12
      65000 -- [-2136.947] (-2137.173) (-2136.592) (-2137.247) * (-2135.824) (-2137.985) (-2137.134) [-2134.711] -- 0:01:11

      Average standard deviation of split frequencies: 0.053966

      65500 -- (-2134.841) (-2135.376) [-2135.479] (-2135.923) * (-2139.048) [-2136.029] (-2136.123) (-2133.058) -- 0:01:11
      66000 -- (-2136.057) [-2136.190] (-2135.055) (-2136.116) * (-2137.548) [-2136.147] (-2137.176) (-2135.919) -- 0:01:10
      66500 -- (-2136.189) [-2138.056] (-2137.178) (-2134.838) * [-2136.368] (-2137.001) (-2136.632) (-2137.532) -- 0:01:10
      67000 -- (-2133.964) (-2137.103) (-2138.447) [-2135.207] * (-2136.545) [-2138.486] (-2134.408) (-2135.973) -- 0:01:09
      67500 -- [-2135.697] (-2138.928) (-2134.538) (-2137.051) * (-2134.795) (-2138.486) (-2139.801) [-2141.879] -- 0:01:09
      68000 -- [-2135.686] (-2139.278) (-2134.599) (-2137.175) * (-2135.464) (-2137.790) (-2140.793) [-2135.865] -- 0:01:08
      68500 -- (-2136.177) (-2134.301) (-2134.817) [-2136.823] * [-2138.931] (-2138.096) (-2136.868) (-2135.934) -- 0:01:07
      69000 -- [-2136.151] (-2134.669) (-2134.208) (-2136.937) * (-2135.976) (-2142.021) (-2136.156) [-2139.339] -- 0:01:07
      69500 -- (-2135.861) (-2140.087) (-2135.578) [-2135.604] * (-2136.179) (-2138.962) [-2136.088] (-2137.112) -- 0:01:06
      70000 -- (-2135.889) (-2140.282) (-2136.080) [-2135.276] * (-2138.006) [-2138.028] (-2136.442) (-2137.809) -- 0:01:06

      Average standard deviation of split frequencies: 0.050620

      70500 -- (-2135.275) (-2139.145) [-2138.194] (-2136.006) * (-2135.748) (-2136.696) (-2136.809) [-2136.329] -- 0:01:05
      71000 -- (-2134.904) (-2140.454) (-2137.067) [-2135.601] * [-2135.071] (-2134.471) (-2136.752) (-2136.974) -- 0:01:05
      71500 -- [-2135.225] (-2136.035) (-2139.874) (-2135.653) * [-2136.521] (-2137.736) (-2136.045) (-2134.992) -- 0:01:04
      72000 -- (-2138.088) (-2134.342) (-2136.304) [-2137.906] * [-2134.822] (-2136.679) (-2137.332) (-2135.518) -- 0:01:04
      72500 -- (-2137.901) (-2138.797) [-2134.311] (-2136.094) * (-2135.929) (-2137.153) (-2136.751) [-2135.138] -- 0:01:03
      73000 -- (-2135.311) (-2136.856) (-2134.860) [-2137.363] * (-2140.757) (-2135.190) (-2141.869) [-2136.132] -- 0:01:03
      73500 -- (-2136.418) [-2136.519] (-2137.698) (-2137.078) * (-2139.590) [-2136.259] (-2135.509) (-2134.766) -- 0:01:03
      74000 -- (-2135.330) [-2135.077] (-2135.938) (-2139.134) * [-2136.990] (-2135.638) (-2137.115) (-2134.945) -- 0:01:02
      74500 -- [-2134.641] (-2136.930) (-2136.828) (-2139.024) * (-2140.201) (-2136.896) (-2136.497) [-2135.152] -- 0:01:02
      75000 -- (-2135.827) (-2135.483) [-2135.123] (-2138.911) * (-2139.385) (-2137.505) [-2134.887] (-2140.722) -- 0:01:01

      Average standard deviation of split frequencies: 0.049966

      75500 -- (-2136.940) (-2135.372) [-2135.028] (-2135.658) * (-2137.172) [-2140.727] (-2137.606) (-2146.343) -- 0:01:01
      76000 -- (-2140.539) (-2136.534) [-2135.955] (-2137.737) * (-2136.219) (-2137.532) (-2137.574) [-2137.636] -- 0:01:00
      76500 -- [-2138.723] (-2136.768) (-2138.624) (-2137.296) * (-2136.553) [-2135.391] (-2134.795) (-2138.533) -- 0:01:00
      77000 -- (-2136.637) (-2138.863) (-2139.966) [-2139.075] * (-2135.114) (-2138.257) [-2134.892] (-2139.961) -- 0:00:59
      77500 -- (-2135.217) (-2136.601) (-2136.368) [-2134.786] * (-2134.638) (-2135.663) [-2134.913] (-2137.173) -- 0:00:59
      78000 -- (-2135.138) (-2135.677) [-2135.506] (-2140.169) * (-2136.703) [-2138.121] (-2135.013) (-2139.625) -- 0:01:10
      78500 -- (-2136.286) (-2135.893) (-2138.552) [-2136.010] * [-2137.496] (-2138.065) (-2134.318) (-2140.011) -- 0:01:10
      79000 -- (-2135.166) [-2135.214] (-2135.970) (-2136.350) * (-2135.943) [-2134.735] (-2136.627) (-2137.401) -- 0:01:09
      79500 -- (-2138.328) (-2140.463) [-2137.797] (-2138.175) * (-2136.594) (-2135.369) [-2135.767] (-2136.665) -- 0:01:09
      80000 -- (-2136.004) [-2137.169] (-2136.608) (-2135.086) * (-2135.396) [-2138.581] (-2136.124) (-2139.727) -- 0:01:09

      Average standard deviation of split frequencies: 0.047725

      80500 -- [-2136.309] (-2137.039) (-2135.784) (-2135.512) * (-2134.946) (-2136.603) [-2135.271] (-2139.045) -- 0:01:08
      81000 -- (-2136.904) [-2135.200] (-2135.870) (-2136.477) * (-2134.402) (-2136.384) [-2135.669] (-2135.483) -- 0:01:08
      81500 -- (-2136.956) (-2134.781) [-2136.332] (-2134.833) * (-2135.820) (-2135.357) (-2135.540) [-2136.107] -- 0:01:07
      82000 -- (-2135.451) (-2135.088) (-2136.166) [-2134.054] * (-2134.598) [-2135.572] (-2135.727) (-2136.415) -- 0:01:07
      82500 -- (-2135.490) (-2135.663) [-2137.937] (-2135.837) * (-2134.147) (-2135.128) [-2138.766] (-2138.133) -- 0:01:06
      83000 -- (-2136.090) [-2135.049] (-2138.623) (-2136.667) * [-2134.567] (-2134.083) (-2136.508) (-2141.044) -- 0:01:06
      83500 -- [-2135.312] (-2137.128) (-2137.082) (-2137.863) * [-2137.006] (-2135.316) (-2136.451) (-2137.370) -- 0:01:05
      84000 -- [-2133.921] (-2135.437) (-2135.627) (-2136.831) * (-2136.723) (-2137.977) [-2135.925] (-2135.612) -- 0:01:05
      84500 -- (-2136.091) (-2135.678) (-2136.960) [-2136.026] * (-2135.944) [-2135.966] (-2135.787) (-2137.050) -- 0:01:05
      85000 -- (-2137.660) (-2134.966) (-2136.905) [-2136.763] * (-2139.049) (-2136.686) [-2135.785] (-2135.504) -- 0:01:04

      Average standard deviation of split frequencies: 0.045294

      85500 -- (-2138.525) (-2136.928) (-2137.020) [-2137.533] * (-2134.969) (-2138.076) (-2135.786) [-2141.497] -- 0:01:04
      86000 -- [-2134.757] (-2140.348) (-2135.111) (-2137.624) * (-2136.014) (-2136.889) [-2134.566] (-2140.636) -- 0:01:03
      86500 -- [-2136.734] (-2137.915) (-2134.908) (-2136.392) * (-2136.389) [-2136.590] (-2135.298) (-2138.636) -- 0:01:03
      87000 -- [-2137.168] (-2134.922) (-2135.520) (-2137.414) * (-2136.489) [-2136.857] (-2136.090) (-2134.907) -- 0:01:02
      87500 -- (-2136.582) [-2137.072] (-2135.348) (-2137.767) * (-2136.109) (-2137.281) (-2135.866) [-2134.948] -- 0:01:02
      88000 -- (-2135.504) (-2136.420) [-2135.350] (-2139.869) * (-2136.856) (-2133.785) [-2136.932] (-2135.651) -- 0:01:02
      88500 -- (-2138.131) (-2136.729) [-2137.456] (-2138.786) * (-2134.801) (-2135.164) (-2135.499) [-2134.362] -- 0:01:01
      89000 -- (-2136.614) (-2137.677) (-2137.413) [-2135.978] * (-2137.641) (-2136.265) [-2135.214] (-2135.340) -- 0:01:01
      89500 -- [-2135.531] (-2135.461) (-2139.640) (-2135.050) * (-2137.554) (-2137.498) [-2135.180] (-2140.298) -- 0:01:01
      90000 -- (-2135.201) [-2134.441] (-2135.946) (-2136.154) * [-2136.641] (-2137.211) (-2135.376) (-2134.529) -- 0:01:00

      Average standard deviation of split frequencies: 0.043414

      90500 -- [-2135.060] (-2138.259) (-2136.970) (-2136.799) * (-2136.735) (-2137.015) (-2135.278) [-2134.648] -- 0:01:00
      91000 -- (-2135.068) [-2138.646] (-2137.691) (-2135.560) * (-2136.312) [-2134.803] (-2136.318) (-2134.858) -- 0:00:59
      91500 -- (-2135.569) (-2139.167) [-2137.690] (-2135.393) * (-2135.721) [-2134.094] (-2136.437) (-2136.371) -- 0:00:59
      92000 -- [-2136.245] (-2134.528) (-2135.716) (-2135.861) * (-2133.604) (-2135.303) [-2133.869] (-2134.319) -- 0:01:09
      92500 -- (-2137.168) (-2136.209) (-2137.785) [-2137.142] * [-2135.600] (-2140.299) (-2135.718) (-2134.720) -- 0:01:08
      93000 -- (-2134.672) [-2136.678] (-2136.929) (-2140.994) * (-2136.567) (-2134.359) (-2135.503) [-2135.612] -- 0:01:08
      93500 -- [-2134.777] (-2136.328) (-2138.539) (-2137.817) * (-2137.230) (-2138.928) [-2135.432] (-2136.544) -- 0:01:07
      94000 -- [-2134.819] (-2136.609) (-2140.820) (-2136.718) * (-2135.505) (-2135.063) (-2135.049) [-2135.520] -- 0:01:07
      94500 -- (-2134.724) (-2136.813) (-2138.068) [-2137.369] * (-2136.157) (-2134.205) [-2135.833] (-2134.482) -- 0:01:07
      95000 -- [-2134.492] (-2135.804) (-2134.912) (-2137.383) * (-2133.471) (-2136.247) [-2133.658] (-2135.319) -- 0:01:06

      Average standard deviation of split frequencies: 0.040757

      95500 -- [-2136.963] (-2135.921) (-2136.021) (-2135.972) * (-2135.357) [-2137.379] (-2137.321) (-2136.821) -- 0:01:06
      96000 -- (-2136.647) [-2138.620] (-2134.906) (-2136.465) * (-2134.155) [-2136.201] (-2135.912) (-2135.437) -- 0:01:05
      96500 -- (-2136.990) (-2137.620) (-2137.408) [-2135.324] * (-2135.208) (-2136.192) [-2135.958] (-2139.282) -- 0:01:05
      97000 -- [-2137.829] (-2136.481) (-2137.459) (-2134.692) * (-2139.578) (-2138.125) [-2135.867] (-2135.391) -- 0:01:05
      97500 -- [-2136.515] (-2136.663) (-2134.425) (-2134.907) * (-2135.257) (-2138.991) (-2137.313) [-2136.950] -- 0:01:04
      98000 -- (-2137.000) (-2135.922) (-2133.925) [-2135.018] * (-2135.904) (-2137.221) (-2135.789) [-2134.924] -- 0:01:04
      98500 -- [-2135.772] (-2135.583) (-2134.517) (-2134.986) * (-2135.092) [-2137.434] (-2135.335) (-2135.821) -- 0:01:04
      99000 -- (-2135.529) [-2135.144] (-2136.117) (-2136.027) * [-2134.874] (-2137.892) (-2135.236) (-2135.847) -- 0:01:03
      99500 -- (-2134.586) [-2135.777] (-2135.996) (-2135.235) * [-2134.484] (-2145.313) (-2136.232) (-2135.836) -- 0:01:03
      100000 -- (-2134.627) (-2138.969) (-2135.703) [-2134.700] * [-2142.744] (-2136.213) (-2136.502) (-2135.304) -- 0:01:02

      Average standard deviation of split frequencies: 0.039336

      100500 -- (-2134.515) (-2138.860) (-2135.684) [-2138.356] * (-2135.549) (-2136.013) [-2135.331] (-2136.019) -- 0:01:02
      101000 -- (-2134.439) [-2138.108] (-2137.062) (-2136.712) * [-2135.778] (-2135.773) (-2135.738) (-2134.303) -- 0:01:02
      101500 -- (-2134.681) (-2135.826) (-2135.182) [-2136.518] * (-2137.361) [-2136.655] (-2135.267) (-2136.154) -- 0:01:01
      102000 -- (-2138.255) (-2135.545) (-2136.339) [-2135.931] * [-2136.886] (-2140.871) (-2135.453) (-2135.170) -- 0:01:01
      102500 -- (-2136.479) (-2134.407) [-2135.176] (-2138.667) * (-2134.783) (-2136.120) (-2137.178) [-2137.284] -- 0:01:01
      103000 -- (-2136.169) (-2136.015) [-2136.075] (-2140.236) * (-2135.907) [-2136.952] (-2134.936) (-2140.563) -- 0:01:00
      103500 -- [-2137.166] (-2137.520) (-2137.549) (-2138.427) * [-2135.983] (-2134.144) (-2135.572) (-2136.590) -- 0:01:00
      104000 -- (-2136.085) (-2135.740) (-2136.274) [-2134.829] * (-2136.638) (-2138.620) [-2137.186] (-2140.820) -- 0:01:00
      104500 -- (-2136.950) (-2137.420) [-2135.784] (-2135.990) * [-2136.717] (-2136.601) (-2137.067) (-2134.515) -- 0:00:59
      105000 -- (-2137.830) (-2137.502) (-2135.927) [-2140.862] * (-2138.882) [-2136.614] (-2142.126) (-2135.048) -- 0:00:59

      Average standard deviation of split frequencies: 0.034244

      105500 -- (-2136.971) [-2137.496] (-2137.616) (-2138.613) * (-2135.540) (-2138.073) [-2136.357] (-2138.941) -- 0:00:59
      106000 -- (-2134.666) [-2135.842] (-2135.280) (-2137.629) * (-2135.554) (-2139.648) [-2138.285] (-2139.217) -- 0:01:07
      106500 -- (-2136.131) [-2135.980] (-2135.367) (-2136.471) * (-2134.973) (-2139.479) [-2136.814] (-2138.909) -- 0:01:07
      107000 -- (-2136.076) (-2135.400) [-2135.024] (-2136.530) * (-2136.153) [-2136.912] (-2137.973) (-2138.982) -- 0:01:06
      107500 -- (-2141.027) [-2137.302] (-2134.950) (-2137.946) * [-2136.757] (-2141.173) (-2136.295) (-2139.307) -- 0:01:06
      108000 -- [-2138.238] (-2140.916) (-2135.065) (-2137.994) * (-2139.358) (-2140.336) (-2136.512) [-2138.847] -- 0:01:06
      108500 -- (-2137.535) (-2136.472) [-2135.718] (-2137.263) * (-2140.226) (-2136.329) [-2136.681] (-2137.509) -- 0:01:05
      109000 -- (-2136.841) (-2137.278) (-2136.399) [-2134.339] * (-2137.225) [-2135.723] (-2138.323) (-2137.521) -- 0:01:05
      109500 -- (-2135.589) [-2135.845] (-2135.264) (-2134.733) * (-2136.556) (-2134.801) [-2137.065] (-2136.144) -- 0:01:05
      110000 -- (-2138.634) (-2134.889) (-2136.882) [-2135.486] * (-2139.055) (-2135.664) [-2135.662] (-2135.552) -- 0:01:04

      Average standard deviation of split frequencies: 0.031735

      110500 -- [-2138.929] (-2134.652) (-2138.035) (-2134.974) * (-2137.400) (-2136.957) [-2138.214] (-2137.828) -- 0:01:04
      111000 -- (-2139.776) [-2137.190] (-2135.752) (-2136.910) * [-2134.730] (-2137.418) (-2137.872) (-2137.314) -- 0:01:04
      111500 -- (-2139.664) (-2134.005) [-2134.637] (-2137.153) * (-2136.268) (-2138.564) [-2137.393] (-2137.525) -- 0:01:03
      112000 -- [-2137.054] (-2135.626) (-2139.587) (-2135.792) * (-2135.887) (-2136.973) (-2137.557) [-2136.455] -- 0:01:03
      112500 -- (-2135.156) (-2138.798) (-2139.257) [-2137.391] * (-2136.813) [-2137.988] (-2137.464) (-2136.903) -- 0:01:03
      113000 -- (-2137.262) (-2143.900) (-2136.173) [-2136.070] * (-2136.033) (-2139.112) [-2136.527] (-2138.610) -- 0:01:02
      113500 -- [-2137.977] (-2135.697) (-2136.425) (-2136.452) * (-2136.983) (-2139.810) (-2136.709) [-2137.211] -- 0:01:02
      114000 -- [-2134.743] (-2136.188) (-2138.064) (-2134.804) * (-2134.912) [-2134.686] (-2132.934) (-2135.096) -- 0:01:02
      114500 -- (-2134.900) [-2136.320] (-2138.050) (-2138.272) * (-2134.699) (-2135.011) (-2135.351) [-2135.844] -- 0:01:01
      115000 -- (-2135.556) [-2136.400] (-2137.483) (-2139.913) * [-2134.520] (-2136.610) (-2135.257) (-2136.792) -- 0:01:01

      Average standard deviation of split frequencies: 0.030294

      115500 -- [-2136.330] (-2139.030) (-2135.998) (-2138.629) * (-2135.750) (-2134.636) (-2135.372) [-2135.418] -- 0:01:01
      116000 -- [-2136.133] (-2138.155) (-2137.306) (-2137.276) * (-2137.307) [-2136.645] (-2135.136) (-2133.420) -- 0:01:00
      116500 -- (-2138.387) (-2137.334) [-2136.741] (-2136.592) * (-2136.138) [-2138.845] (-2134.987) (-2135.872) -- 0:01:00
      117000 -- (-2134.843) (-2137.439) [-2139.076] (-2141.306) * (-2138.567) (-2138.660) (-2135.308) [-2134.221] -- 0:01:00
      117500 -- (-2134.522) [-2136.537] (-2139.032) (-2139.268) * [-2136.492] (-2136.459) (-2136.073) (-2138.013) -- 0:01:00
      118000 -- (-2135.033) [-2135.345] (-2137.361) (-2137.344) * (-2135.712) [-2135.993] (-2135.574) (-2135.969) -- 0:00:59
      118500 -- [-2137.835] (-2135.699) (-2137.995) (-2136.635) * (-2137.164) (-2136.405) [-2142.134] (-2135.677) -- 0:00:59
      119000 -- (-2135.988) [-2136.431] (-2135.174) (-2135.538) * [-2135.923] (-2139.826) (-2141.216) (-2137.603) -- 0:00:59
      119500 -- (-2135.716) (-2136.832) [-2136.656] (-2137.259) * (-2138.072) [-2135.903] (-2138.145) (-2138.671) -- 0:00:58
      120000 -- (-2135.754) (-2136.547) (-2136.386) [-2137.473] * (-2139.575) (-2136.389) [-2134.979] (-2135.992) -- 0:00:58

      Average standard deviation of split frequencies: 0.030898

      120500 -- [-2137.371] (-2137.183) (-2135.134) (-2135.674) * (-2136.091) (-2135.770) [-2135.365] (-2140.692) -- 0:01:05
      121000 -- (-2136.630) (-2136.792) [-2135.469] (-2137.097) * (-2139.514) (-2136.106) [-2135.972] (-2140.005) -- 0:01:05
      121500 -- (-2140.983) (-2136.583) [-2135.116] (-2137.097) * (-2136.755) (-2136.391) (-2134.949) [-2138.481] -- 0:01:05
      122000 -- (-2136.584) (-2137.996) [-2135.283] (-2136.561) * [-2135.512] (-2134.491) (-2133.745) (-2136.368) -- 0:01:04
      122500 -- (-2135.369) (-2137.908) [-2135.764] (-2135.442) * (-2136.820) [-2137.107] (-2135.538) (-2135.803) -- 0:01:04
      123000 -- [-2135.743] (-2135.544) (-2138.550) (-2135.060) * (-2134.931) [-2137.789] (-2135.996) (-2136.190) -- 0:01:04
      123500 -- (-2134.928) [-2136.544] (-2136.970) (-2134.069) * (-2134.389) [-2139.685] (-2139.435) (-2135.884) -- 0:01:03
      124000 -- (-2135.323) [-2135.280] (-2136.545) (-2135.049) * (-2134.458) (-2134.558) [-2138.249] (-2135.565) -- 0:01:03
      124500 -- (-2134.897) [-2134.946] (-2135.597) (-2134.815) * (-2135.154) [-2136.635] (-2136.302) (-2137.359) -- 0:01:03
      125000 -- (-2138.258) [-2135.734] (-2138.613) (-2136.516) * (-2135.253) (-2134.969) (-2137.051) [-2136.648] -- 0:01:03

      Average standard deviation of split frequencies: 0.029574

      125500 -- (-2137.543) [-2137.945] (-2139.122) (-2135.438) * (-2135.998) [-2135.399] (-2136.464) (-2135.766) -- 0:01:02
      126000 -- [-2139.694] (-2138.658) (-2135.630) (-2135.262) * (-2135.479) [-2136.222] (-2135.171) (-2139.042) -- 0:01:02
      126500 -- (-2140.449) [-2134.526] (-2136.628) (-2135.564) * (-2134.762) (-2135.462) [-2135.300] (-2141.957) -- 0:01:02
      127000 -- [-2137.132] (-2135.983) (-2136.049) (-2143.033) * (-2135.403) (-2136.580) [-2136.793] (-2137.609) -- 0:01:01
      127500 -- (-2136.442) (-2136.528) [-2134.773] (-2138.875) * (-2135.820) (-2137.803) [-2136.137] (-2137.623) -- 0:01:01
      128000 -- (-2137.445) (-2138.206) [-2137.007] (-2137.293) * (-2135.723) (-2135.658) [-2135.651] (-2135.055) -- 0:01:01
      128500 -- (-2138.163) (-2135.665) (-2141.611) [-2135.546] * (-2135.259) (-2135.571) [-2135.586] (-2136.746) -- 0:01:01
      129000 -- (-2143.702) (-2134.887) (-2139.677) [-2138.570] * (-2138.145) (-2135.087) [-2135.940] (-2137.641) -- 0:01:00
      129500 -- (-2144.625) [-2133.688] (-2136.178) (-2137.818) * [-2136.568] (-2135.105) (-2139.178) (-2137.214) -- 0:01:00
      130000 -- (-2141.821) [-2136.022] (-2134.806) (-2138.368) * (-2136.086) (-2136.811) [-2137.641] (-2137.660) -- 0:01:00

      Average standard deviation of split frequencies: 0.025823

      130500 -- (-2136.032) (-2134.491) (-2134.515) [-2135.599] * [-2134.605] (-2142.333) (-2135.797) (-2136.065) -- 0:00:59
      131000 -- (-2135.874) (-2140.504) [-2134.468] (-2138.249) * [-2134.314] (-2134.717) (-2135.268) (-2138.104) -- 0:00:59
      131500 -- (-2134.715) [-2134.137] (-2135.731) (-2135.880) * [-2134.315] (-2134.573) (-2137.860) (-2135.102) -- 0:00:59
      132000 -- (-2136.247) (-2134.416) [-2137.171] (-2136.079) * (-2134.314) (-2135.110) (-2137.834) [-2134.993] -- 0:00:59
      132500 -- (-2136.741) [-2137.714] (-2135.416) (-2136.578) * (-2141.313) (-2134.080) [-2137.066] (-2140.339) -- 0:00:58
      133000 -- (-2137.647) (-2136.748) (-2138.711) [-2135.152] * [-2137.310] (-2138.244) (-2135.453) (-2139.777) -- 0:00:58
      133500 -- [-2135.898] (-2136.153) (-2137.693) (-2135.450) * (-2136.739) (-2135.515) [-2135.200] (-2135.813) -- 0:00:58
      134000 -- (-2138.367) [-2135.698] (-2137.484) (-2136.927) * [-2135.540] (-2134.815) (-2136.500) (-2136.792) -- 0:00:58
      134500 -- (-2134.712) (-2136.189) [-2136.044] (-2136.200) * (-2139.261) (-2133.229) [-2140.072] (-2135.750) -- 0:01:04
      135000 -- (-2134.869) (-2137.805) [-2138.288] (-2135.927) * [-2135.463] (-2133.929) (-2135.116) (-2136.836) -- 0:01:04

      Average standard deviation of split frequencies: 0.024263

      135500 -- (-2136.537) (-2134.716) (-2135.509) [-2138.401] * (-2134.859) (-2136.157) [-2134.974] (-2136.726) -- 0:01:03
      136000 -- (-2137.274) (-2136.063) [-2135.548] (-2138.930) * (-2134.946) (-2135.146) (-2136.570) [-2138.426] -- 0:01:03
      136500 -- (-2139.878) (-2134.889) (-2134.620) [-2137.780] * (-2133.974) [-2135.926] (-2135.763) (-2137.237) -- 0:01:03
      137000 -- (-2139.612) [-2137.779] (-2136.562) (-2139.658) * (-2135.603) (-2134.599) (-2135.800) [-2138.991] -- 0:01:02
      137500 -- (-2138.888) [-2135.671] (-2135.279) (-2137.574) * (-2136.979) (-2135.303) [-2135.968] (-2135.110) -- 0:01:02
      138000 -- (-2135.498) (-2137.611) [-2134.900] (-2133.918) * (-2137.135) [-2135.681] (-2134.750) (-2136.419) -- 0:01:02
      138500 -- (-2135.148) (-2136.769) (-2134.780) [-2136.494] * (-2140.427) (-2136.373) [-2138.092] (-2139.180) -- 0:01:02
      139000 -- (-2135.087) (-2142.975) [-2134.239] (-2138.036) * [-2138.267] (-2136.723) (-2137.803) (-2137.343) -- 0:01:01
      139500 -- (-2136.139) (-2140.827) [-2134.779] (-2136.774) * [-2136.055] (-2139.076) (-2137.605) (-2135.831) -- 0:01:01
      140000 -- (-2137.151) (-2142.366) (-2135.107) [-2137.610] * [-2135.274] (-2136.247) (-2135.758) (-2135.637) -- 0:01:01

      Average standard deviation of split frequencies: 0.022400

      140500 -- (-2134.993) (-2138.244) (-2135.041) [-2137.353] * [-2136.444] (-2138.936) (-2135.758) (-2137.350) -- 0:01:01
      141000 -- [-2135.318] (-2137.412) (-2134.904) (-2137.337) * (-2137.022) [-2138.865] (-2135.401) (-2136.486) -- 0:01:00
      141500 -- (-2137.229) (-2135.460) [-2135.550] (-2137.975) * [-2134.454] (-2135.534) (-2134.882) (-2138.393) -- 0:01:00
      142000 -- (-2137.946) (-2140.696) [-2136.675] (-2138.117) * [-2134.375] (-2139.185) (-2135.256) (-2137.289) -- 0:01:00
      142500 -- [-2135.815] (-2137.089) (-2137.632) (-2138.170) * [-2134.173] (-2141.752) (-2135.182) (-2135.559) -- 0:01:00
      143000 -- (-2135.604) (-2134.762) (-2138.456) [-2135.578] * (-2134.759) (-2140.833) (-2134.279) [-2135.894] -- 0:00:59
      143500 -- (-2134.497) [-2134.137] (-2141.634) (-2136.320) * [-2135.368] (-2140.802) (-2135.752) (-2135.587) -- 0:00:59
      144000 -- (-2134.491) (-2136.187) (-2138.242) [-2135.001] * (-2136.975) (-2136.698) (-2135.225) [-2134.883] -- 0:00:59
      144500 -- (-2134.579) (-2135.264) [-2139.155] (-2134.658) * (-2134.850) [-2135.218] (-2136.065) (-2137.021) -- 0:00:59
      145000 -- (-2137.719) [-2136.503] (-2137.234) (-2136.050) * (-2134.966) (-2135.222) (-2135.990) [-2136.186] -- 0:00:58

      Average standard deviation of split frequencies: 0.020142

      145500 -- [-2137.769] (-2136.272) (-2137.225) (-2140.706) * [-2134.833] (-2134.683) (-2134.314) (-2136.409) -- 0:00:58
      146000 -- (-2136.580) (-2135.401) (-2137.327) [-2136.646] * [-2135.585] (-2136.470) (-2134.362) (-2137.040) -- 0:00:58
      146500 -- [-2137.004] (-2136.752) (-2137.334) (-2135.669) * (-2135.063) [-2138.066] (-2138.257) (-2137.078) -- 0:00:58
      147000 -- [-2137.602] (-2138.403) (-2136.393) (-2135.657) * (-2135.071) (-2136.035) [-2134.189] (-2135.212) -- 0:00:58
      147500 -- (-2137.720) (-2135.452) (-2143.789) [-2136.111] * [-2138.600] (-2135.955) (-2135.350) (-2135.177) -- 0:00:57
      148000 -- (-2138.197) (-2137.364) (-2137.658) [-2134.545] * (-2135.808) (-2136.139) [-2135.071] (-2139.589) -- 0:00:57
      148500 -- (-2135.946) (-2137.273) (-2135.336) [-2136.739] * [-2135.476] (-2137.253) (-2134.234) (-2138.029) -- 0:01:03
      149000 -- (-2141.524) [-2138.447] (-2136.656) (-2136.094) * (-2136.015) (-2137.475) (-2138.621) [-2137.684] -- 0:01:02
      149500 -- (-2137.098) (-2137.920) [-2135.311] (-2134.995) * [-2136.680] (-2137.006) (-2137.050) (-2137.212) -- 0:01:02
      150000 -- (-2137.283) (-2138.006) [-2134.009] (-2138.271) * (-2135.890) [-2135.541] (-2137.916) (-2136.838) -- 0:01:02

      Average standard deviation of split frequencies: 0.019925

      150500 -- (-2139.300) [-2138.436] (-2134.224) (-2138.785) * [-2136.182] (-2138.425) (-2137.918) (-2138.048) -- 0:01:02
      151000 -- (-2135.974) (-2140.372) (-2135.602) [-2141.149] * (-2137.129) (-2138.656) [-2136.167] (-2136.431) -- 0:01:01
      151500 -- [-2133.710] (-2137.704) (-2134.691) (-2140.595) * (-2133.048) [-2140.300] (-2135.067) (-2138.235) -- 0:01:01
      152000 -- (-2134.948) (-2136.745) [-2134.918] (-2139.145) * (-2136.282) [-2135.013] (-2135.602) (-2138.366) -- 0:01:01
      152500 -- (-2136.705) (-2135.415) [-2135.694] (-2134.344) * (-2136.478) (-2135.813) [-2136.586] (-2138.073) -- 0:01:01
      153000 -- (-2137.331) [-2135.303] (-2136.419) (-2134.296) * (-2136.292) (-2136.077) (-2135.316) [-2137.521] -- 0:01:00
      153500 -- (-2135.166) [-2135.112] (-2138.093) (-2134.694) * (-2134.991) (-2138.206) [-2135.846] (-2136.421) -- 0:01:00
      154000 -- (-2135.163) (-2138.342) (-2135.443) [-2136.106] * (-2135.973) [-2137.448] (-2138.583) (-2134.754) -- 0:01:00
      154500 -- (-2135.207) (-2135.699) [-2135.585] (-2136.483) * [-2137.862] (-2136.550) (-2136.870) (-2138.341) -- 0:01:00
      155000 -- (-2137.324) [-2135.821] (-2134.620) (-2134.988) * (-2138.213) [-2135.313] (-2135.070) (-2136.367) -- 0:00:59

      Average standard deviation of split frequencies: 0.020481

      155500 -- (-2140.175) (-2138.011) [-2134.292] (-2136.332) * (-2139.307) (-2140.167) (-2134.804) [-2139.153] -- 0:00:59
      156000 -- (-2140.276) (-2136.345) [-2133.703] (-2138.376) * (-2137.003) (-2138.655) [-2134.719] (-2140.431) -- 0:00:59
      156500 -- (-2141.599) [-2136.093] (-2133.081) (-2136.050) * (-2140.833) [-2137.315] (-2137.827) (-2136.317) -- 0:00:59
      157000 -- (-2135.042) (-2138.255) (-2134.111) [-2135.739] * (-2135.319) (-2137.695) (-2141.518) [-2135.057] -- 0:00:59
      157500 -- (-2136.847) [-2135.381] (-2134.715) (-2135.529) * (-2137.803) (-2139.288) (-2139.785) [-2135.938] -- 0:00:58
      158000 -- (-2140.249) [-2135.340] (-2137.788) (-2134.596) * (-2138.544) [-2138.811] (-2136.934) (-2137.474) -- 0:00:58
      158500 -- (-2135.593) (-2138.378) [-2135.803] (-2136.056) * (-2136.049) (-2136.644) (-2136.531) [-2136.617] -- 0:00:58
      159000 -- (-2135.617) (-2135.649) (-2137.299) [-2138.856] * (-2137.138) (-2136.424) (-2138.123) [-2134.496] -- 0:00:58
      159500 -- (-2137.734) (-2136.321) [-2135.868] (-2138.950) * [-2134.893] (-2138.967) (-2139.640) (-2135.712) -- 0:00:57
      160000 -- (-2135.251) [-2134.564] (-2135.107) (-2138.133) * (-2134.838) (-2135.491) (-2133.596) [-2137.131] -- 0:00:57

      Average standard deviation of split frequencies: 0.019457

      160500 -- (-2138.671) [-2135.527] (-2134.568) (-2140.352) * (-2134.779) [-2136.675] (-2135.237) (-2138.317) -- 0:00:57
      161000 -- [-2137.282] (-2135.079) (-2137.493) (-2134.992) * (-2134.778) (-2135.498) (-2134.792) [-2138.151] -- 0:00:57
      161500 -- (-2138.665) (-2134.663) [-2137.319] (-2136.372) * (-2134.761) (-2135.309) (-2136.861) [-2140.069] -- 0:00:57
      162000 -- (-2134.587) (-2134.679) (-2137.783) [-2134.661] * [-2134.971] (-2136.052) (-2135.747) (-2134.719) -- 0:00:56
      162500 -- [-2135.852] (-2134.685) (-2136.380) (-2137.661) * (-2135.098) (-2135.154) [-2135.115] (-2135.705) -- 0:01:01
      163000 -- [-2137.027] (-2135.021) (-2136.999) (-2137.439) * (-2135.091) (-2136.056) (-2134.982) [-2135.753] -- 0:01:01
      163500 -- [-2135.643] (-2134.805) (-2144.419) (-2137.779) * [-2134.610] (-2137.783) (-2134.856) (-2135.635) -- 0:01:01
      164000 -- [-2134.300] (-2134.031) (-2142.477) (-2134.418) * (-2135.359) (-2139.137) [-2136.714] (-2140.416) -- 0:01:01
      164500 -- (-2136.412) [-2137.881] (-2140.269) (-2134.953) * [-2135.303] (-2135.308) (-2139.604) (-2135.724) -- 0:01:00
      165000 -- [-2135.998] (-2136.700) (-2138.497) (-2135.431) * (-2135.427) [-2136.828] (-2135.711) (-2134.553) -- 0:01:00

      Average standard deviation of split frequencies: 0.018459

      165500 -- (-2138.212) (-2137.670) [-2137.307] (-2133.940) * (-2135.241) (-2135.555) [-2136.720] (-2134.592) -- 0:01:00
      166000 -- [-2137.938] (-2136.136) (-2134.017) (-2135.696) * (-2134.768) (-2135.672) (-2134.414) [-2134.554] -- 0:01:00
      166500 -- (-2135.696) (-2134.510) (-2138.175) [-2138.445] * (-2136.032) (-2137.067) [-2135.875] (-2135.938) -- 0:01:00
      167000 -- (-2135.493) [-2134.492] (-2137.834) (-2135.730) * [-2135.494] (-2140.466) (-2134.291) (-2135.249) -- 0:00:59
      167500 -- (-2136.052) (-2137.003) (-2135.943) [-2134.876] * [-2136.544] (-2139.677) (-2133.998) (-2136.626) -- 0:00:59
      168000 -- [-2137.175] (-2137.716) (-2135.498) (-2137.394) * (-2138.282) (-2136.834) [-2134.807] (-2137.095) -- 0:00:59
      168500 -- (-2136.471) (-2134.207) [-2136.642] (-2135.142) * (-2136.157) [-2134.612] (-2135.042) (-2136.156) -- 0:00:59
      169000 -- (-2136.069) (-2135.410) [-2136.248] (-2135.635) * (-2136.699) (-2136.254) (-2134.898) [-2139.152] -- 0:00:59
      169500 -- (-2137.947) (-2134.803) [-2136.712] (-2135.724) * (-2134.643) (-2142.979) [-2137.762] (-2135.816) -- 0:00:58
      170000 -- (-2138.509) [-2136.895] (-2137.171) (-2140.113) * (-2134.900) [-2137.652] (-2136.574) (-2143.060) -- 0:00:58

      Average standard deviation of split frequencies: 0.016849

      170500 -- (-2134.539) [-2133.222] (-2136.515) (-2136.962) * (-2138.395) [-2134.922] (-2142.225) (-2137.176) -- 0:00:58
      171000 -- (-2135.481) [-2134.633] (-2136.317) (-2136.423) * (-2137.641) (-2135.750) [-2135.803] (-2136.377) -- 0:00:58
      171500 -- [-2135.666] (-2137.904) (-2135.944) (-2136.378) * [-2135.846] (-2136.561) (-2137.422) (-2135.514) -- 0:00:57
      172000 -- [-2134.903] (-2136.796) (-2135.015) (-2135.733) * (-2138.018) (-2135.885) [-2136.486] (-2136.454) -- 0:00:57
      172500 -- [-2134.775] (-2139.835) (-2136.937) (-2135.671) * (-2136.180) [-2135.395] (-2136.486) (-2138.234) -- 0:00:57
      173000 -- (-2135.460) (-2140.326) (-2139.557) [-2136.227] * (-2134.699) (-2134.921) (-2136.572) [-2138.460] -- 0:00:57
      173500 -- [-2135.524] (-2135.090) (-2138.963) (-2138.061) * (-2137.465) [-2134.850] (-2136.572) (-2136.503) -- 0:00:57
      174000 -- (-2134.677) (-2137.394) [-2139.035] (-2135.898) * (-2134.510) (-2135.591) [-2134.365] (-2134.980) -- 0:00:56
      174500 -- [-2135.929] (-2136.071) (-2135.313) (-2135.037) * (-2134.889) (-2137.414) (-2134.333) [-2135.475] -- 0:00:56
      175000 -- [-2135.051] (-2137.236) (-2134.279) (-2137.164) * (-2134.685) (-2137.763) (-2134.019) [-2135.589] -- 0:00:56

      Average standard deviation of split frequencies: 0.016517

      175500 -- (-2141.028) [-2135.977] (-2134.830) (-2136.303) * (-2134.868) (-2136.183) (-2138.506) [-2134.454] -- 0:00:56
      176000 -- (-2137.327) (-2136.704) (-2135.120) [-2136.194] * [-2134.656] (-2135.608) (-2137.005) (-2141.347) -- 0:00:56
      176500 -- (-2136.573) (-2136.147) [-2137.740] (-2136.187) * (-2135.249) (-2136.978) (-2134.673) [-2134.543] -- 0:01:00
      177000 -- (-2138.097) (-2137.033) [-2135.708] (-2134.744) * (-2136.049) (-2139.631) [-2135.475] (-2134.749) -- 0:01:00
      177500 -- [-2135.498] (-2136.647) (-2135.907) (-2136.401) * (-2136.174) (-2137.152) [-2137.237] (-2138.250) -- 0:01:00
      178000 -- (-2135.054) (-2139.049) (-2136.328) [-2136.626] * (-2139.185) (-2136.361) [-2137.518] (-2136.866) -- 0:01:00
      178500 -- (-2136.002) (-2139.452) (-2136.407) [-2135.908] * [-2135.854] (-2134.764) (-2138.768) (-2138.006) -- 0:00:59
      179000 -- (-2135.446) (-2135.704) (-2141.395) [-2139.170] * (-2136.118) [-2136.163] (-2137.374) (-2140.189) -- 0:00:59
      179500 -- [-2136.653] (-2142.084) (-2136.902) (-2141.862) * (-2136.156) [-2135.333] (-2135.167) (-2137.696) -- 0:00:59
      180000 -- (-2135.931) (-2135.634) [-2136.487] (-2137.257) * (-2136.073) (-2138.162) [-2137.114] (-2137.929) -- 0:00:59

      Average standard deviation of split frequencies: 0.016670

      180500 -- [-2137.945] (-2135.979) (-2136.969) (-2134.920) * (-2137.579) (-2138.300) [-2136.900] (-2134.539) -- 0:00:59
      181000 -- (-2142.674) (-2136.779) (-2135.212) [-2134.844] * (-2136.222) (-2135.461) (-2134.531) [-2135.213] -- 0:00:58
      181500 -- (-2136.419) (-2139.770) (-2137.653) [-2133.603] * (-2138.122) (-2136.564) [-2136.548] (-2136.850) -- 0:00:58
      182000 -- [-2135.283] (-2139.151) (-2135.469) (-2138.075) * (-2134.605) [-2136.131] (-2135.183) (-2137.791) -- 0:00:58
      182500 -- (-2135.624) [-2135.993] (-2137.562) (-2142.736) * [-2134.011] (-2138.782) (-2134.404) (-2135.230) -- 0:00:58
      183000 -- [-2135.913] (-2137.064) (-2134.795) (-2137.281) * (-2136.567) (-2138.254) [-2134.263] (-2135.764) -- 0:00:58
      183500 -- (-2137.036) (-2135.721) [-2134.980] (-2135.869) * (-2139.232) (-2139.893) (-2136.722) [-2138.608] -- 0:00:57
      184000 -- (-2140.131) [-2136.061] (-2134.432) (-2135.257) * (-2137.699) (-2139.027) (-2136.235) [-2135.151] -- 0:00:57
      184500 -- (-2138.814) [-2134.853] (-2138.612) (-2135.164) * (-2136.743) [-2136.425] (-2136.432) (-2135.100) -- 0:00:57
      185000 -- (-2141.865) [-2136.101] (-2137.422) (-2135.579) * (-2135.609) (-2137.118) (-2137.276) [-2135.797] -- 0:00:57

      Average standard deviation of split frequencies: 0.015770

      185500 -- (-2144.162) [-2136.560] (-2135.406) (-2135.600) * (-2141.300) [-2135.878] (-2135.002) (-2136.432) -- 0:00:57
      186000 -- (-2136.622) (-2137.695) (-2139.484) [-2137.360] * (-2138.337) [-2136.026] (-2135.094) (-2138.719) -- 0:00:56
      186500 -- (-2134.715) (-2145.681) (-2139.729) [-2135.433] * (-2136.662) (-2135.262) [-2134.704] (-2138.468) -- 0:00:56
      187000 -- (-2134.728) [-2139.660] (-2138.170) (-2140.388) * (-2137.083) [-2135.224] (-2135.055) (-2136.778) -- 0:00:56
      187500 -- (-2135.968) (-2139.183) (-2137.618) [-2136.045] * (-2137.565) (-2135.303) [-2135.695] (-2135.897) -- 0:00:56
      188000 -- [-2135.430] (-2136.227) (-2136.454) (-2135.257) * [-2137.181] (-2134.978) (-2136.110) (-2134.156) -- 0:00:56
      188500 -- (-2135.030) [-2139.875] (-2135.290) (-2135.337) * (-2135.106) (-2135.228) (-2135.248) [-2135.116] -- 0:00:55
      189000 -- (-2134.618) (-2139.568) (-2136.749) [-2135.770] * [-2134.925] (-2135.171) (-2137.041) (-2135.468) -- 0:00:55
      189500 -- (-2134.554) (-2136.817) [-2135.870] (-2136.657) * (-2138.589) (-2136.071) (-2135.392) [-2135.216] -- 0:00:55
      190000 -- (-2136.512) (-2138.457) [-2136.317] (-2137.817) * (-2138.407) (-2135.441) (-2137.608) [-2136.459] -- 0:00:55

      Average standard deviation of split frequencies: 0.016006

      190500 -- (-2135.004) [-2137.522] (-2135.319) (-2138.076) * (-2139.606) (-2135.375) [-2135.607] (-2135.988) -- 0:00:55
      191000 -- (-2137.291) (-2138.049) (-2138.980) [-2138.388] * [-2137.581] (-2135.135) (-2135.813) (-2138.083) -- 0:00:59
      191500 -- (-2136.299) [-2139.425] (-2136.833) (-2141.970) * (-2137.242) (-2135.666) [-2136.828] (-2138.183) -- 0:00:59
      192000 -- [-2136.922] (-2135.934) (-2134.754) (-2142.992) * [-2136.488] (-2136.132) (-2135.147) (-2135.829) -- 0:00:58
      192500 -- (-2135.801) [-2138.048] (-2134.733) (-2139.801) * (-2135.467) (-2135.216) (-2137.493) [-2137.688] -- 0:00:58
      193000 -- (-2138.229) (-2136.388) [-2135.117] (-2136.639) * [-2134.426] (-2134.730) (-2138.612) (-2138.550) -- 0:00:58
      193500 -- (-2137.955) [-2136.594] (-2136.896) (-2134.806) * (-2135.316) (-2134.811) (-2138.612) [-2137.671] -- 0:00:58
      194000 -- (-2134.930) (-2140.408) (-2135.300) [-2134.533] * (-2137.215) [-2134.651] (-2135.458) (-2137.039) -- 0:00:58
      194500 -- (-2135.721) (-2138.234) [-2135.254] (-2138.040) * (-2136.851) (-2136.626) [-2134.877] (-2136.588) -- 0:00:57
      195000 -- (-2134.067) (-2135.759) [-2135.088] (-2134.393) * (-2138.952) [-2136.463] (-2135.228) (-2134.109) -- 0:00:57

      Average standard deviation of split frequencies: 0.015064

      195500 -- [-2135.392] (-2133.453) (-2135.824) (-2141.036) * (-2137.419) (-2136.120) (-2137.866) [-2134.468] -- 0:00:57
      196000 -- (-2135.243) (-2135.584) (-2135.230) [-2136.800] * (-2137.533) [-2137.516] (-2135.820) (-2137.826) -- 0:00:57
      196500 -- (-2135.796) [-2135.665] (-2137.087) (-2135.285) * (-2139.097) (-2135.287) [-2135.094] (-2139.607) -- 0:00:57
      197000 -- (-2135.751) (-2135.673) [-2139.392] (-2135.569) * (-2138.343) (-2137.834) [-2135.594] (-2136.700) -- 0:00:57
      197500 -- (-2135.404) (-2135.675) [-2138.303] (-2134.930) * (-2138.437) (-2137.618) [-2137.032] (-2137.437) -- 0:00:56
      198000 -- (-2135.099) (-2135.114) [-2135.977] (-2137.827) * (-2135.016) (-2137.365) (-2135.191) [-2135.196] -- 0:00:56
      198500 -- (-2135.099) (-2135.219) [-2137.758] (-2137.177) * (-2135.387) (-2134.826) [-2134.769] (-2135.569) -- 0:00:56
      199000 -- (-2134.747) (-2136.328) (-2137.454) [-2136.747] * (-2137.097) (-2135.391) (-2140.945) [-2135.889] -- 0:00:56
      199500 -- (-2136.310) (-2137.591) [-2139.721] (-2137.102) * (-2137.591) (-2141.403) [-2138.458] (-2135.309) -- 0:00:56
      200000 -- (-2135.134) [-2136.608] (-2134.833) (-2135.705) * (-2137.787) (-2140.487) [-2135.196] (-2133.938) -- 0:00:55

      Average standard deviation of split frequencies: 0.014837

      200500 -- (-2136.244) (-2135.388) [-2137.751] (-2136.404) * (-2137.550) [-2138.290] (-2136.241) (-2136.071) -- 0:00:55
      201000 -- (-2135.392) [-2134.535] (-2137.527) (-2135.152) * (-2135.984) (-2135.908) [-2136.776] (-2136.611) -- 0:00:55
      201500 -- (-2137.185) (-2139.401) [-2138.498] (-2135.538) * (-2135.162) (-2139.735) [-2137.428] (-2135.475) -- 0:00:55
      202000 -- (-2138.354) (-2144.839) (-2136.472) [-2133.741] * (-2135.975) (-2137.309) [-2136.530] (-2135.918) -- 0:00:55
      202500 -- (-2137.319) [-2139.519] (-2135.796) (-2135.921) * (-2134.897) (-2138.396) (-2138.068) [-2136.498] -- 0:00:55
      203000 -- (-2138.616) (-2136.502) (-2135.912) [-2135.181] * (-2135.598) [-2135.896] (-2138.729) (-2137.791) -- 0:00:54
      203500 -- (-2135.599) [-2136.371] (-2135.262) (-2134.472) * (-2135.769) (-2136.626) (-2134.867) [-2138.901] -- 0:00:54
      204000 -- (-2137.219) (-2135.717) [-2136.447] (-2137.735) * (-2133.898) (-2135.246) [-2135.229] (-2137.896) -- 0:00:54
      204500 -- (-2136.495) (-2135.918) (-2135.069) [-2137.878] * [-2134.861] (-2136.302) (-2135.787) (-2140.486) -- 0:00:54
      205000 -- (-2136.277) (-2136.564) [-2135.288] (-2134.413) * (-2137.406) (-2137.201) (-2135.471) [-2140.594] -- 0:00:58

      Average standard deviation of split frequencies: 0.014302

      205500 -- [-2140.404] (-2135.136) (-2136.864) (-2134.127) * [-2137.608] (-2138.046) (-2137.099) (-2137.770) -- 0:00:57
      206000 -- (-2142.530) [-2136.359] (-2137.868) (-2135.307) * (-2135.244) (-2139.776) [-2136.286] (-2137.813) -- 0:00:57
      206500 -- (-2135.648) (-2136.296) [-2135.447] (-2135.286) * (-2136.273) [-2135.220] (-2136.299) (-2135.725) -- 0:00:57
      207000 -- (-2137.367) (-2134.692) (-2141.576) [-2136.644] * (-2134.272) [-2135.747] (-2135.616) (-2134.701) -- 0:00:57
      207500 -- (-2134.385) (-2134.098) [-2142.987] (-2139.540) * (-2139.123) [-2141.780] (-2135.694) (-2135.469) -- 0:00:57
      208000 -- (-2136.552) (-2135.578) (-2137.180) [-2139.227] * (-2141.080) (-2136.853) (-2135.484) [-2135.624] -- 0:00:57
      208500 -- (-2137.175) [-2135.139] (-2136.525) (-2137.042) * [-2137.597] (-2136.320) (-2136.236) (-2135.655) -- 0:00:56
      209000 -- (-2135.727) (-2135.108) (-2134.757) [-2137.071] * (-2137.948) (-2137.660) [-2136.138] (-2136.093) -- 0:00:56
      209500 -- (-2136.212) [-2137.829] (-2135.190) (-2137.581) * (-2138.120) (-2138.583) [-2134.631] (-2139.870) -- 0:00:56
      210000 -- (-2136.870) (-2137.043) [-2135.556] (-2137.978) * (-2137.844) (-2138.550) [-2135.167] (-2139.583) -- 0:00:56

      Average standard deviation of split frequencies: 0.016841

      210500 -- (-2135.118) [-2136.455] (-2135.600) (-2135.946) * [-2135.729] (-2140.558) (-2135.250) (-2137.077) -- 0:00:56
      211000 -- [-2135.926] (-2134.812) (-2135.994) (-2135.943) * (-2136.432) (-2136.316) (-2137.524) [-2137.382] -- 0:00:56
      211500 -- (-2135.945) (-2134.516) (-2135.777) [-2136.813] * (-2137.715) [-2135.454] (-2135.349) (-2135.490) -- 0:00:55
      212000 -- (-2136.030) [-2134.929] (-2135.710) (-2136.733) * [-2136.087] (-2136.901) (-2136.061) (-2135.528) -- 0:00:55
      212500 -- [-2136.016] (-2137.244) (-2135.982) (-2141.149) * (-2135.402) (-2137.580) (-2136.216) [-2135.265] -- 0:00:55
      213000 -- (-2136.958) [-2142.130] (-2135.057) (-2134.867) * [-2135.308] (-2136.429) (-2137.462) (-2138.795) -- 0:00:55
      213500 -- (-2136.294) (-2141.662) (-2134.323) [-2135.527] * [-2137.444] (-2136.551) (-2138.799) (-2137.796) -- 0:00:55
      214000 -- (-2134.749) (-2137.838) (-2135.183) [-2136.884] * [-2135.161] (-2135.716) (-2137.386) (-2135.140) -- 0:00:55
      214500 -- (-2134.910) (-2135.877) [-2134.960] (-2135.396) * [-2134.706] (-2143.468) (-2136.876) (-2134.876) -- 0:00:54
      215000 -- (-2141.324) [-2140.590] (-2138.184) (-2136.188) * [-2135.180] (-2136.074) (-2139.205) (-2136.201) -- 0:00:54

      Average standard deviation of split frequencies: 0.018953

      215500 -- (-2136.413) (-2140.576) (-2137.077) [-2136.113] * (-2134.890) (-2135.843) [-2134.923] (-2137.686) -- 0:00:54
      216000 -- [-2136.193] (-2138.310) (-2138.463) (-2136.012) * (-2133.513) [-2136.516] (-2137.064) (-2136.796) -- 0:00:54
      216500 -- (-2136.210) (-2133.540) (-2141.412) [-2135.568] * (-2135.922) [-2134.860] (-2135.808) (-2136.930) -- 0:00:54
      217000 -- (-2136.333) (-2136.344) [-2137.082] (-2135.141) * [-2138.826] (-2138.577) (-2136.272) (-2139.685) -- 0:00:54
      217500 -- [-2137.150] (-2135.926) (-2136.437) (-2135.520) * (-2137.103) (-2136.899) [-2135.166] (-2137.839) -- 0:00:53
      218000 -- [-2138.486] (-2133.909) (-2136.447) (-2138.165) * (-2138.387) [-2137.653] (-2134.627) (-2135.974) -- 0:00:53
      218500 -- (-2136.819) (-2133.730) [-2140.463] (-2136.366) * (-2136.577) (-2138.011) [-2133.972] (-2133.866) -- 0:00:53
      219000 -- (-2135.728) [-2134.744] (-2138.211) (-2136.124) * (-2134.700) (-2139.943) [-2138.331] (-2134.860) -- 0:00:57
      219500 -- (-2136.053) [-2135.479] (-2137.860) (-2136.003) * (-2135.841) (-2143.113) (-2136.979) [-2134.963] -- 0:00:56
      220000 -- (-2137.435) (-2137.361) (-2135.857) [-2135.564] * [-2134.705] (-2139.688) (-2137.529) (-2134.960) -- 0:00:56

      Average standard deviation of split frequencies: 0.018396

      220500 -- (-2136.289) [-2135.490] (-2135.611) (-2135.638) * (-2134.909) (-2138.602) [-2135.752] (-2135.129) -- 0:00:56
      221000 -- (-2138.977) (-2135.757) (-2135.824) [-2136.535] * (-2136.089) [-2136.740] (-2137.520) (-2135.335) -- 0:00:56
      221500 -- (-2136.513) (-2135.087) [-2137.052] (-2135.317) * (-2138.056) [-2135.882] (-2142.043) (-2140.117) -- 0:00:56
      222000 -- (-2135.972) (-2135.507) [-2136.719] (-2135.271) * (-2140.044) (-2139.168) [-2135.677] (-2139.136) -- 0:00:56
      222500 -- [-2138.964] (-2134.528) (-2136.302) (-2135.878) * (-2139.816) (-2140.374) [-2134.759] (-2137.620) -- 0:00:55
      223000 -- (-2136.660) (-2134.595) (-2135.312) [-2135.906] * (-2135.314) (-2138.170) (-2134.983) [-2132.938] -- 0:00:55
      223500 -- (-2136.009) (-2137.793) (-2139.438) [-2135.064] * [-2135.531] (-2136.149) (-2137.178) (-2135.278) -- 0:00:55
      224000 -- [-2136.289] (-2136.926) (-2138.178) (-2135.619) * (-2134.804) (-2135.097) [-2135.268] (-2134.320) -- 0:00:55
      224500 -- (-2135.497) (-2138.271) [-2135.795] (-2135.777) * [-2136.858] (-2136.216) (-2136.287) (-2139.111) -- 0:00:55
      225000 -- [-2135.346] (-2138.101) (-2136.475) (-2137.219) * (-2136.873)