--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 12:53:28 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/murG/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1627.27 -1630.42 2 -1627.29 -1633.38 -------------------------------------- TOTAL -1627.28 -1632.73 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.893126 0.087607 0.370649 1.499087 0.860942 1501.00 1501.00 1.001 r(A<->C){all} 0.167294 0.019679 0.000104 0.452153 0.131100 123.18 239.81 1.001 r(A<->G){all} 0.167965 0.020403 0.000004 0.465618 0.128456 145.58 260.84 1.003 r(A<->T){all} 0.173752 0.020271 0.000041 0.462083 0.137113 241.67 285.21 1.001 r(C<->G){all} 0.166699 0.020157 0.000061 0.452514 0.127253 211.25 211.90 1.003 r(C<->T){all} 0.168499 0.020591 0.000077 0.466083 0.129649 225.95 246.54 1.009 r(G<->T){all} 0.155791 0.018256 0.000249 0.429183 0.118658 161.68 201.92 1.001 pi(A){all} 0.151980 0.000108 0.132728 0.173125 0.151706 1371.83 1399.02 1.000 pi(C){all} 0.305383 0.000179 0.278176 0.330190 0.304879 1280.58 1366.38 1.000 pi(G){all} 0.352461 0.000184 0.324651 0.376596 0.352755 1127.76 1238.47 1.000 pi(T){all} 0.190176 0.000126 0.169685 0.213175 0.190041 1254.51 1361.28 1.000 alpha{1,2} 0.413657 0.219692 0.000143 1.341252 0.249170 1045.62 1213.14 1.002 alpha{3} 0.458281 0.250688 0.000165 1.468929 0.290772 1372.39 1390.68 1.000 pinvar{all} 0.998734 0.000002 0.995965 0.999999 0.999209 1103.41 1158.84 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1575.673685 Model 2: PositiveSelection -1575.673685 Model 0: one-ratio -1575.673625 Model 7: beta -1575.673831 Model 8: beta&w>1 -1575.673625 Model 0 vs 1 1.2000000015177648E-4 Model 2 vs 1 0.0 Model 8 vs 7 4.1200000032404205E-4
>C1 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C2 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C3 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C4 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C5 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C6 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=407 C1 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C2 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C3 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C4 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C5 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C6 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ************************************************** C1 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C2 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C3 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C4 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C5 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C6 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR ************************************************** C1 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C2 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C3 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C4 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C5 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C6 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP ************************************************** C1 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C2 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C3 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C4 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C5 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C6 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL ************************************************** C1 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C2 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C3 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C4 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C5 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C6 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV ************************************************** C1 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C2 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C3 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C4 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C5 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C6 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM ************************************************** C1 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C2 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C3 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C4 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C5 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C6 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ************************************************** C1 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C2 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C3 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C4 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C5 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C6 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG ************************************************** C1 RSAGGKP C2 RSAGGKP C3 RSAGGKP C4 RSAGGKP C5 RSAGGKP C6 RSAGGKP ******* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] Relaxation Summary: [12210]--->[12210] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.535 Mb, Max= 30.989 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C2 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C3 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C4 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C5 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD C6 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ************************************************** C1 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C2 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C3 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C4 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C5 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR C6 ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR ************************************************** C1 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C2 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C3 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C4 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C5 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP C6 LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP ************************************************** C1 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C2 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C3 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C4 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C5 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL C6 VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL ************************************************** C1 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C2 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C3 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C4 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C5 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV C6 NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV ************************************************** C1 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C2 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C3 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C4 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C5 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM C6 AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM ************************************************** C1 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C2 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C3 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C4 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C5 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV C6 TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ************************************************** C1 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C2 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C3 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C4 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C5 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG C6 ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG ************************************************** C1 RSAGGKP C2 RSAGGKP C3 RSAGGKP C4 RSAGGKP C5 RSAGGKP C6 RSAGGKP ******* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC C2 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC C3 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC C4 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC C5 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC C6 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC ************************************************** C1 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG C2 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG C3 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG C4 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG C5 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG C6 GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG ************************************************** C1 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT C2 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT C3 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT C4 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT C5 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT C6 CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT ************************************************** C1 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC C2 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC C3 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC C4 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC C5 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC C6 GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC ************************************************** C1 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT C2 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT C3 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT C4 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT C5 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT C6 GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT ************************************************** C1 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG C2 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG C3 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG C4 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG C5 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG C6 TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG ************************************************** C1 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA C2 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA C3 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA C4 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA C5 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA C6 CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA ************************************************** C1 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC C2 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC C3 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC C4 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC C5 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC C6 AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC ************************************************** C1 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG C2 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG C3 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG C4 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG C5 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG C6 CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG ************************************************** C1 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG C2 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG C3 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG C4 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG C5 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG C6 GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG ************************************************** C1 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC C2 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC C3 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC C4 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC C5 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC C6 TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC ************************************************** C1 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG C2 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG C3 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG C4 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG C5 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG C6 GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG ************************************************** C1 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA C2 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA C3 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA C4 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA C5 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA C6 AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA ************************************************** C1 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC C2 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC C3 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC C4 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC C5 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC C6 CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC ************************************************** C1 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG C2 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG C3 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG C4 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG C5 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG C6 TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG ************************************************** C1 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC C2 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC C3 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC C4 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC C5 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC C6 GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC ************************************************** C1 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG C2 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG C3 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG C4 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG C5 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG C6 CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ************************************************** C1 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG C2 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG C3 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG C4 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG C5 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG C6 ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ************************************************** C1 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT C2 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT C3 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT C4 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT C5 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT C6 ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT ************************************************** C1 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG C2 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG C3 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG C4 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG C5 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG C6 CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG ************************************************** C1 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG C2 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG C3 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG C4 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG C5 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG C6 CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG ************************************************** C1 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT C2 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT C3 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT C4 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT C5 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT C6 GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT ************************************************** C1 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG C2 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG C3 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG C4 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG C5 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG C6 GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG ************************************************** C1 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA C2 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA C3 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA C4 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA C5 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA C6 CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA ************************************************** C1 CGGTCGGCCGGAGGGAAACCG C2 CGGTCGGCCGGAGGGAAACCG C3 CGGTCGGCCGGAGGGAAACCG C4 CGGTCGGCCGGAGGGAAACCG C5 CGGTCGGCCGGAGGGAAACCG C6 CGGTCGGCCGGAGGGAAACCG ********************* >C1 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C2 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C3 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C4 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C5 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C6 GTGAACAACTCGGTTAGGGAGCCGACCCGCGGGCGAAGGGGCAGCCCGCC GGTCGCCGATGCCGCATTATCGGTTAATCCCCCCTTGTCGGTTGTGCTGG CGGGCGGCGGTACCGCCGGCCATGTGGAGCCCGCAATGGCCGTTGCCGAT GCACTCAGAGCGCTGGATCCACAGGTCCGGATCACCGCGTTGGGCACTTC GCGTGGGCTGGAGACCAGGCTAGTACCCGAGCGTGGCTACCACCTCGAGT TGATCACACCGGTGCCATTGCCGCGTAAGCTTACCGGCGACCTGGCCCGG CTCCCATTACGAGTGTGGCGTGCCGTCCGAGAGACCCGCGCGGTGTTCGA AGTCGTCGAGGCCCATGTGGTGGTGGGTTTCGGTGGGTACGTGGCACTGC CAGCGTACCTCGCCGCACGTGGTATCCCCAGGGTGCGGCGTCGTATCCCG GTGGTGGTTCACGAGGCCAACGCCCGGGCCGGCATCGCCAATCGTGTCGG TGTGCGTACTGCCGAACGGGTGCTTTCGGCAGTACCCGGTTCCGGATTAC GTGGTGCCGAGGTGGTGGGAGTGCCGATCCACGCGACCATTACTACGCTG AACCGCCCGGCATTGCGAGCTGACGCCCGCAAGCATTTTGGCTTCACCGA CGACGCGCGGGTGTTGTTGGTTTTCGGTGGTTCTCAGGGTGCAGTTTCGC TGAATCGGGCGGTTGCCGGTGCTGCCGAGGACCTGGCCGCCTCGGGAGTG GCCGTGCTGCATGCCTACGGACTCAAGAACACCCTCGAGCTGCGCACACC CGAGTACGGTGAGCCGCCGTACGTCGCGGTGCCCTACCTTGACCGAATGG ACTTAGCGTACGCCGCCGCTGACCTGGTGATTTGTCGGTCCGGAGCAATG ACGGTCGCCGAAGTGTCGGCCGTCGGCTTGCCAGCCATCTATGTACCGTT CCCAATTGGCAACGGTGAGCAACGGCTCAATGCACTGCCGGTGGTTAACG CCGGCGGCGGCCTGGTGGTCGCCGACGCTGACTTGACGCCCGGTCTGGTG GCGCGGCAAGTTGTCAGGTTGTTCAGCGATCCGGCGCAGCTGGCGGCAAT GACGGCGGCCGCCGCGCGAGTGGGACATCGCGATGCGGCACATCATGTCG CCAAGGTGGCACTGGATCTGGCACGTGCAGAGCGTGACACGGCGTCAGGA CGGTCGGCCGGAGGGAAACCG >C1 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C2 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C3 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C4 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C5 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP >C6 VNNSVREPTRGRRGSPPVADAALSVNPPLSVVLAGGGTAGHVEPAMAVAD ALRALDPQVRITALGTSRGLETRLVPERGYHLELITPVPLPRKLTGDLAR LPLRVWRAVRETRAVFEVVEAHVVVGFGGYVALPAYLAARGIPRVRRRIP VVVHEANARAGIANRVGVRTAERVLSAVPGSGLRGAEVVGVPIHATITTL NRPALRADARKHFGFTDDARVLLVFGGSQGAVSLNRAVAGAAEDLAASGV AVLHAYGLKNTLELRTPEYGEPPYVAVPYLDRMDLAYAAADLVICRSGAM TVAEVSAVGLPAIYVPFPIGNGEQRLNALPVVNAGGGLVVADADLTPGLV ARQVVRLFSDPAQLAAMTAAAARVGHRDAAHHVAKVALDLARAERDTASG RSAGGKP MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1221 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579783926 Setting output file names to "/data/10res/murG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1148468536 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9340905697 Seed = 760956826 Swapseed = 1579783926 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2732.656114 -- -24.965149 Chain 2 -- -2732.656372 -- -24.965149 Chain 3 -- -2732.656530 -- -24.965149 Chain 4 -- -2732.656530 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2732.656530 -- -24.965149 Chain 2 -- -2732.656530 -- -24.965149 Chain 3 -- -2732.656530 -- -24.965149 Chain 4 -- -2732.656372 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2732.656] (-2732.656) (-2732.657) (-2732.657) * [-2732.657] (-2732.657) (-2732.657) (-2732.656) 500 -- [-1642.905] (-1688.831) (-1639.648) (-1678.488) * [-1639.512] (-1654.651) (-1641.548) (-1664.314) -- 0:00:00 1000 -- (-1640.258) (-1650.570) (-1636.957) [-1638.226] * (-1636.270) (-1643.083) [-1629.329] (-1657.145) -- 0:00:00 1500 -- (-1637.714) (-1652.536) (-1634.742) [-1636.948] * (-1634.102) (-1637.946) [-1636.208] (-1648.367) -- 0:11:05 2000 -- (-1641.102) [-1635.056] (-1638.917) (-1638.367) * (-1636.130) [-1635.345] (-1640.588) (-1644.153) -- 0:08:19 2500 -- [-1643.576] (-1637.131) (-1632.393) (-1640.812) * [-1635.065] (-1635.850) (-1636.441) (-1636.328) -- 0:06:39 3000 -- [-1637.688] (-1639.200) (-1636.066) (-1638.978) * (-1633.914) (-1636.677) [-1634.377] (-1631.368) -- 0:05:32 3500 -- (-1636.836) (-1644.978) (-1632.694) [-1636.032] * (-1636.991) [-1636.477] (-1634.210) (-1633.076) -- 0:04:44 4000 -- (-1635.816) (-1639.217) (-1636.711) [-1632.639] * (-1640.826) [-1637.521] (-1633.662) (-1637.040) -- 0:04:09 4500 -- [-1637.116] (-1635.431) (-1636.277) (-1638.045) * (-1635.058) (-1635.738) [-1635.628] (-1640.289) -- 0:03:41 5000 -- [-1638.391] (-1638.137) (-1635.590) (-1645.899) * [-1633.432] (-1632.153) (-1639.987) (-1636.972) -- 0:03:19 Average standard deviation of split frequencies: 0.125708 5500 -- [-1634.353] (-1633.898) (-1634.467) (-1646.200) * (-1642.628) (-1633.202) (-1636.319) [-1632.890] -- 0:03:00 6000 -- (-1639.997) (-1638.144) [-1636.651] (-1643.633) * [-1635.843] (-1636.693) (-1635.277) (-1646.146) -- 0:02:45 6500 -- (-1630.948) [-1633.885] (-1637.490) (-1639.627) * (-1637.088) [-1632.446] (-1636.443) (-1659.228) -- 0:02:32 7000 -- (-1634.605) [-1634.612] (-1644.534) (-1640.144) * (-1634.960) [-1634.017] (-1632.940) (-1635.535) -- 0:02:21 7500 -- (-1635.505) [-1634.966] (-1637.443) (-1636.640) * (-1636.160) (-1635.521) (-1640.664) [-1640.511] -- 0:02:12 8000 -- (-1636.674) (-1635.589) (-1638.876) [-1642.545] * (-1643.031) [-1642.146] (-1646.411) (-1636.802) -- 0:02:04 8500 -- (-1643.199) (-1638.012) (-1637.229) [-1634.538] * (-1642.373) [-1640.330] (-1638.130) (-1631.407) -- 0:01:56 9000 -- (-1648.405) [-1636.981] (-1635.695) (-1633.024) * (-1632.336) (-1642.682) (-1637.418) [-1638.122] -- 0:01:50 9500 -- (-1637.833) (-1645.502) [-1636.023] (-1635.812) * (-1633.391) [-1633.853] (-1639.011) (-1637.009) -- 0:01:44 10000 -- (-1630.168) (-1630.802) (-1633.497) [-1626.525] * [-1633.638] (-1638.204) (-1631.978) (-1635.433) -- 0:01:39 Average standard deviation of split frequencies: 0.112695 10500 -- (-1639.747) (-1638.089) (-1634.941) [-1627.947] * [-1631.427] (-1638.072) (-1632.256) (-1645.048) -- 0:01:34 11000 -- [-1639.544] (-1648.588) (-1637.005) (-1629.923) * [-1629.788] (-1636.165) (-1633.915) (-1647.790) -- 0:01:29 11500 -- (-1633.966) [-1631.061] (-1637.579) (-1631.889) * (-1637.118) (-1633.630) [-1637.548] (-1642.186) -- 0:01:25 12000 -- [-1639.698] (-1638.428) (-1636.292) (-1628.608) * (-1642.822) (-1637.516) (-1636.814) [-1635.975] -- 0:01:22 12500 -- (-1638.763) (-1635.077) (-1642.021) [-1626.873] * (-1637.671) (-1640.178) [-1637.772] (-1642.363) -- 0:01:19 13000 -- [-1634.355] (-1638.880) (-1632.933) (-1630.797) * [-1629.674] (-1636.789) (-1640.531) (-1635.021) -- 0:01:15 13500 -- [-1641.320] (-1634.157) (-1637.332) (-1626.830) * (-1642.511) (-1639.709) (-1644.568) [-1636.955] -- 0:01:13 14000 -- (-1645.192) [-1638.711] (-1640.091) (-1630.016) * [-1634.648] (-1637.660) (-1640.286) (-1634.191) -- 0:01:10 14500 -- (-1636.770) [-1639.310] (-1641.233) (-1627.871) * (-1636.044) (-1640.229) [-1640.034] (-1637.736) -- 0:01:07 15000 -- (-1646.169) (-1640.111) [-1636.176] (-1629.486) * (-1646.703) (-1637.135) [-1635.379] (-1638.630) -- 0:01:05 Average standard deviation of split frequencies: 0.086915 15500 -- (-1636.952) (-1640.278) (-1639.419) [-1627.915] * (-1638.028) (-1637.928) [-1631.736] (-1634.325) -- 0:01:03 16000 -- (-1636.916) (-1634.658) (-1634.188) [-1626.944] * (-1643.757) [-1640.318] (-1637.484) (-1643.745) -- 0:02:03 16500 -- [-1635.556] (-1645.280) (-1650.825) (-1626.715) * (-1631.237) (-1634.982) [-1637.508] (-1641.279) -- 0:01:59 17000 -- (-1642.639) (-1648.056) [-1632.676] (-1628.384) * (-1641.473) (-1640.117) [-1635.036] (-1638.767) -- 0:01:55 17500 -- [-1636.088] (-1641.511) (-1644.300) (-1627.706) * (-1639.857) (-1636.576) (-1633.374) [-1638.322] -- 0:01:52 18000 -- [-1635.491] (-1635.961) (-1634.437) (-1627.310) * (-1638.654) [-1635.078] (-1633.614) (-1638.663) -- 0:01:49 18500 -- [-1635.431] (-1636.619) (-1637.909) (-1627.918) * (-1640.709) [-1636.149] (-1634.929) (-1636.844) -- 0:01:46 19000 -- (-1642.744) [-1633.088] (-1637.122) (-1627.938) * (-1637.032) (-1635.189) [-1636.851] (-1640.207) -- 0:01:43 19500 -- [-1641.847] (-1639.642) (-1645.089) (-1627.793) * (-1637.937) (-1635.313) (-1641.993) [-1639.981] -- 0:01:40 20000 -- (-1638.806) (-1641.377) [-1633.346] (-1626.427) * (-1636.694) [-1632.678] (-1639.084) (-1634.564) -- 0:01:38 Average standard deviation of split frequencies: 0.064828 20500 -- (-1639.386) (-1643.107) [-1634.701] (-1626.399) * [-1632.021] (-1638.080) (-1636.704) (-1630.982) -- 0:01:35 21000 -- (-1644.478) (-1631.790) [-1636.528] (-1626.604) * (-1636.052) [-1629.880] (-1636.425) (-1638.481) -- 0:01:33 21500 -- (-1641.103) (-1628.202) [-1638.228] (-1631.641) * [-1636.415] (-1639.050) (-1637.048) (-1634.458) -- 0:01:31 22000 -- (-1637.143) [-1626.714] (-1642.594) (-1630.750) * (-1638.054) [-1645.030] (-1638.384) (-1635.090) -- 0:01:28 22500 -- (-1644.426) (-1630.046) (-1636.798) [-1629.806] * (-1633.955) (-1644.450) [-1635.007] (-1641.214) -- 0:01:26 23000 -- [-1635.096] (-1632.758) (-1637.917) (-1627.623) * (-1637.914) [-1632.837] (-1642.356) (-1634.775) -- 0:01:24 23500 -- (-1644.318) (-1634.130) [-1636.404] (-1628.583) * (-1641.079) [-1636.206] (-1641.943) (-1636.754) -- 0:01:23 24000 -- (-1638.409) (-1626.988) (-1635.737) [-1628.314] * [-1642.598] (-1634.812) (-1641.915) (-1635.890) -- 0:01:21 24500 -- (-1634.465) [-1627.404] (-1634.711) (-1632.966) * (-1635.659) (-1646.466) [-1631.770] (-1639.368) -- 0:01:19 25000 -- (-1635.589) (-1626.783) (-1636.100) [-1627.125] * (-1640.754) (-1635.009) (-1638.965) [-1637.167] -- 0:01:18 Average standard deviation of split frequencies: 0.053529 25500 -- [-1638.800] (-1630.610) (-1636.813) (-1625.905) * (-1636.814) [-1631.386] (-1634.999) (-1635.012) -- 0:01:16 26000 -- (-1640.377) (-1628.332) [-1640.112] (-1629.944) * [-1635.734] (-1643.863) (-1635.006) (-1638.770) -- 0:01:14 26500 -- (-1635.351) (-1630.786) [-1633.409] (-1628.830) * (-1636.270) [-1635.247] (-1639.578) (-1643.150) -- 0:01:13 27000 -- (-1633.968) (-1630.279) [-1636.831] (-1627.028) * (-1641.663) (-1637.834) [-1630.311] (-1634.190) -- 0:01:12 27500 -- (-1641.272) (-1633.025) [-1635.048] (-1627.631) * (-1637.870) (-1640.326) [-1636.229] (-1636.974) -- 0:01:10 28000 -- (-1643.373) (-1628.247) [-1629.132] (-1627.764) * (-1637.412) (-1635.108) (-1639.876) [-1639.156] -- 0:01:09 28500 -- (-1639.622) (-1626.668) [-1631.183] (-1626.293) * (-1641.516) [-1640.238] (-1638.018) (-1636.219) -- 0:01:08 29000 -- (-1639.585) (-1627.451) (-1632.267) [-1627.518] * [-1641.175] (-1637.454) (-1644.738) (-1639.716) -- 0:01:06 29500 -- [-1640.080] (-1628.903) (-1639.852) (-1626.963) * (-1640.596) [-1636.775] (-1634.938) (-1640.378) -- 0:01:05 30000 -- (-1640.904) [-1629.237] (-1636.941) (-1627.628) * (-1634.577) (-1634.554) [-1630.570] (-1639.927) -- 0:01:04 Average standard deviation of split frequencies: 0.047653 30500 -- (-1636.286) (-1627.677) [-1636.408] (-1631.620) * [-1630.569] (-1635.626) (-1643.064) (-1636.445) -- 0:01:03 31000 -- [-1635.215] (-1628.438) (-1636.992) (-1627.061) * [-1635.181] (-1637.839) (-1637.566) (-1639.723) -- 0:01:02 31500 -- (-1634.525) (-1628.488) [-1636.037] (-1627.686) * (-1634.094) (-1632.408) [-1639.917] (-1634.883) -- 0:01:32 32000 -- [-1638.566] (-1625.908) (-1635.962) (-1628.351) * (-1634.820) [-1634.649] (-1643.932) (-1633.964) -- 0:01:30 32500 -- (-1645.643) (-1628.083) [-1631.470] (-1629.716) * [-1639.971] (-1642.710) (-1642.341) (-1644.783) -- 0:01:29 33000 -- [-1639.898] (-1626.740) (-1640.382) (-1627.232) * (-1641.537) (-1637.520) (-1637.694) [-1635.412] -- 0:01:27 33500 -- (-1627.951) [-1626.530] (-1637.011) (-1626.907) * (-1632.731) [-1639.242] (-1638.674) (-1642.504) -- 0:01:26 34000 -- (-1629.408) (-1627.599) (-1635.350) [-1627.394] * (-1636.032) [-1637.781] (-1641.470) (-1642.521) -- 0:01:25 34500 -- [-1630.573] (-1626.878) (-1639.758) (-1626.655) * (-1639.858) (-1637.350) [-1636.154] (-1642.174) -- 0:01:23 35000 -- (-1629.064) (-1629.268) [-1634.667] (-1626.985) * (-1638.542) (-1632.667) (-1637.453) [-1637.081] -- 0:01:22 Average standard deviation of split frequencies: 0.043025 35500 -- (-1632.979) (-1627.713) [-1633.638] (-1627.299) * (-1635.262) (-1632.020) (-1641.525) [-1634.186] -- 0:01:21 36000 -- (-1629.816) (-1628.191) (-1636.150) [-1627.536] * (-1642.771) [-1635.048] (-1636.836) (-1640.061) -- 0:01:20 36500 -- (-1629.846) (-1627.628) [-1630.994] (-1628.519) * (-1636.186) [-1632.024] (-1635.078) (-1632.422) -- 0:01:19 37000 -- (-1629.649) [-1629.020] (-1635.344) (-1626.133) * (-1638.609) (-1637.669) [-1636.176] (-1632.303) -- 0:01:18 37500 -- (-1627.320) (-1632.090) (-1633.171) [-1627.891] * [-1629.298] (-1644.382) (-1634.169) (-1629.327) -- 0:01:17 38000 -- (-1627.013) (-1631.306) (-1639.777) [-1627.943] * [-1640.406] (-1641.853) (-1637.246) (-1630.351) -- 0:01:15 38500 -- (-1627.924) (-1628.595) (-1641.398) [-1630.530] * (-1635.930) (-1641.984) [-1645.310] (-1629.092) -- 0:01:14 39000 -- (-1627.999) (-1629.902) (-1639.843) [-1633.402] * [-1642.422] (-1643.195) (-1637.019) (-1628.551) -- 0:01:13 39500 -- (-1628.566) [-1626.431] (-1639.373) (-1628.117) * (-1640.924) (-1637.085) (-1635.065) [-1628.201] -- 0:01:12 40000 -- (-1630.939) [-1626.227] (-1636.887) (-1628.426) * (-1634.052) [-1638.336] (-1634.576) (-1627.128) -- 0:01:12 Average standard deviation of split frequencies: 0.041731 40500 -- (-1627.660) [-1629.103] (-1645.611) (-1630.523) * (-1647.596) [-1639.340] (-1635.641) (-1629.125) -- 0:01:11 41000 -- (-1629.454) (-1634.339) (-1634.689) [-1627.432] * (-1637.133) (-1635.245) [-1636.751] (-1625.977) -- 0:01:10 41500 -- (-1628.408) (-1632.145) (-1630.207) [-1627.241] * (-1634.921) (-1637.456) (-1635.684) [-1627.709] -- 0:01:09 42000 -- (-1628.219) (-1628.530) (-1629.183) [-1627.201] * (-1633.875) (-1635.335) [-1633.284] (-1626.998) -- 0:01:08 42500 -- (-1629.692) [-1626.968] (-1626.499) (-1627.456) * (-1635.981) [-1631.859] (-1645.141) (-1627.965) -- 0:01:07 43000 -- (-1630.241) (-1628.786) (-1627.536) [-1626.077] * (-1643.432) [-1633.521] (-1637.169) (-1626.756) -- 0:01:06 43500 -- (-1626.283) (-1628.829) (-1627.689) [-1627.713] * (-1640.935) [-1641.216] (-1641.624) (-1626.164) -- 0:01:05 44000 -- (-1626.390) [-1626.868] (-1627.334) (-1627.416) * [-1632.989] (-1642.673) (-1649.782) (-1626.349) -- 0:01:05 44500 -- (-1628.922) (-1627.669) [-1627.350] (-1626.863) * (-1643.209) (-1637.696) (-1636.593) [-1625.802] -- 0:01:04 45000 -- (-1628.856) [-1630.216] (-1628.567) (-1629.034) * (-1636.178) (-1634.292) [-1637.352] (-1626.943) -- 0:01:03 Average standard deviation of split frequencies: 0.030744 45500 -- (-1628.598) (-1628.745) (-1628.877) [-1629.988] * [-1639.311] (-1634.649) (-1635.754) (-1626.136) -- 0:01:02 46000 -- (-1628.636) [-1626.912] (-1626.602) (-1628.950) * (-1639.966) [-1630.597] (-1636.994) (-1626.120) -- 0:01:02 46500 -- [-1629.564] (-1631.419) (-1626.499) (-1629.188) * [-1631.814] (-1630.847) (-1640.499) (-1633.081) -- 0:01:01 47000 -- (-1628.604) (-1631.412) (-1625.959) [-1626.903] * [-1643.520] (-1635.052) (-1635.588) (-1632.306) -- 0:01:21 47500 -- (-1629.427) (-1626.865) (-1626.574) [-1628.391] * (-1633.990) (-1638.549) (-1635.601) [-1630.617] -- 0:01:20 48000 -- (-1632.028) (-1627.718) (-1626.576) [-1627.060] * [-1631.284] (-1643.373) (-1632.217) (-1632.846) -- 0:01:19 48500 -- (-1631.054) [-1628.029] (-1629.240) (-1628.109) * (-1641.753) [-1639.117] (-1644.495) (-1632.760) -- 0:01:18 49000 -- (-1630.582) [-1626.907] (-1629.999) (-1627.769) * (-1636.258) [-1634.695] (-1653.018) (-1630.094) -- 0:01:17 49500 -- (-1629.231) (-1628.346) (-1631.557) [-1627.546] * [-1634.451] (-1633.792) (-1635.109) (-1629.559) -- 0:01:16 50000 -- (-1629.745) (-1628.414) (-1626.964) [-1628.574] * [-1633.254] (-1636.035) (-1634.201) (-1627.205) -- 0:01:16 Average standard deviation of split frequencies: 0.032141 50500 -- (-1626.428) (-1628.415) (-1629.374) [-1631.140] * [-1636.053] (-1647.590) (-1637.208) (-1626.700) -- 0:01:15 51000 -- (-1627.241) (-1627.178) [-1631.496] (-1627.140) * (-1631.226) [-1636.443] (-1636.388) (-1626.875) -- 0:01:14 51500 -- (-1630.132) (-1627.859) (-1629.828) [-1628.811] * (-1636.980) [-1639.506] (-1639.628) (-1630.366) -- 0:01:13 52000 -- (-1626.932) (-1628.557) [-1628.179] (-1627.524) * (-1632.309) [-1633.678] (-1645.859) (-1626.717) -- 0:01:12 52500 -- (-1627.881) [-1628.739] (-1626.176) (-1627.322) * (-1626.570) [-1641.295] (-1634.377) (-1625.917) -- 0:01:12 53000 -- [-1626.969] (-1626.960) (-1626.888) (-1626.936) * (-1628.975) [-1641.660] (-1641.152) (-1627.324) -- 0:01:11 53500 -- (-1626.617) (-1628.140) [-1630.205] (-1626.648) * [-1627.935] (-1637.550) (-1638.706) (-1626.656) -- 0:01:10 54000 -- [-1627.268] (-1628.137) (-1628.415) (-1626.138) * (-1627.932) (-1646.880) [-1630.972] (-1626.347) -- 0:01:10 54500 -- (-1630.535) (-1627.721) (-1628.441) [-1626.565] * (-1630.762) (-1636.374) [-1633.185] (-1626.432) -- 0:01:09 55000 -- (-1629.508) (-1633.349) (-1625.915) [-1626.538] * (-1632.973) (-1640.561) [-1637.162] (-1628.128) -- 0:01:08 Average standard deviation of split frequencies: 0.029262 55500 -- [-1630.243] (-1630.915) (-1626.503) (-1626.442) * (-1629.503) [-1631.920] (-1634.377) (-1628.150) -- 0:01:08 56000 -- (-1629.644) (-1628.950) [-1628.191] (-1627.726) * [-1627.858] (-1638.916) (-1639.617) (-1631.578) -- 0:01:07 56500 -- (-1626.915) (-1627.725) [-1627.032] (-1636.341) * [-1628.033] (-1642.748) (-1640.000) (-1627.089) -- 0:01:06 57000 -- [-1627.076] (-1627.725) (-1627.692) (-1634.295) * (-1625.827) [-1639.423] (-1636.456) (-1629.198) -- 0:01:06 57500 -- (-1629.841) (-1630.589) [-1627.342] (-1633.856) * (-1627.924) (-1638.978) [-1634.757] (-1628.756) -- 0:01:05 58000 -- (-1634.183) [-1629.736] (-1627.244) (-1633.759) * (-1628.809) [-1634.318] (-1631.114) (-1628.700) -- 0:01:04 58500 -- (-1632.133) (-1628.408) [-1626.371] (-1634.554) * (-1627.104) [-1631.493] (-1644.090) (-1628.275) -- 0:01:04 59000 -- [-1630.385] (-1629.257) (-1628.421) (-1630.141) * (-1626.161) [-1636.841] (-1641.703) (-1631.779) -- 0:01:03 59500 -- (-1629.579) (-1633.650) [-1627.880] (-1630.638) * (-1627.336) (-1641.702) [-1640.579] (-1626.630) -- 0:01:03 60000 -- [-1628.415] (-1631.752) (-1630.615) (-1627.524) * (-1629.104) [-1633.501] (-1635.010) (-1626.712) -- 0:01:02 Average standard deviation of split frequencies: 0.026583 60500 -- [-1627.957] (-1630.076) (-1627.823) (-1628.601) * [-1628.025] (-1640.207) (-1631.746) (-1626.942) -- 0:01:02 61000 -- (-1627.105) (-1627.462) (-1628.669) [-1628.297] * (-1627.409) [-1636.096] (-1634.224) (-1629.189) -- 0:01:01 61500 -- (-1628.166) (-1626.103) (-1627.732) [-1627.966] * (-1627.409) [-1636.340] (-1629.666) (-1632.637) -- 0:01:01 62000 -- (-1627.334) (-1628.909) (-1626.151) [-1629.295] * (-1627.409) (-1636.029) (-1641.401) [-1631.046] -- 0:01:00 62500 -- (-1627.747) (-1626.721) [-1630.207] (-1630.948) * (-1635.325) [-1637.477] (-1634.565) (-1627.879) -- 0:01:15 63000 -- (-1630.291) (-1626.862) (-1633.197) [-1631.058] * (-1628.512) (-1636.167) [-1633.850] (-1626.688) -- 0:01:14 63500 -- [-1627.448] (-1626.862) (-1628.945) (-1630.046) * (-1630.236) (-1639.449) [-1633.325] (-1628.421) -- 0:01:13 64000 -- (-1626.837) (-1629.305) (-1628.419) [-1634.700] * [-1629.590] (-1641.987) (-1639.627) (-1626.562) -- 0:01:13 64500 -- (-1627.244) (-1627.255) [-1629.789] (-1631.726) * [-1626.581] (-1634.434) (-1639.422) (-1627.743) -- 0:01:12 65000 -- [-1628.589] (-1626.206) (-1629.069) (-1630.592) * [-1628.173] (-1632.875) (-1634.780) (-1627.041) -- 0:01:11 Average standard deviation of split frequencies: 0.026189 65500 -- (-1626.476) [-1627.904] (-1627.170) (-1630.475) * (-1628.998) [-1633.369] (-1633.233) (-1629.428) -- 0:01:11 66000 -- (-1627.085) (-1627.420) (-1626.496) [-1630.123] * (-1628.378) (-1635.869) [-1633.751] (-1629.159) -- 0:01:10 66500 -- [-1627.030] (-1626.475) (-1627.211) (-1629.861) * (-1628.610) (-1644.938) [-1638.231] (-1629.271) -- 0:01:10 67000 -- (-1626.715) [-1627.605] (-1626.948) (-1628.267) * [-1628.101] (-1643.851) (-1636.360) (-1627.999) -- 0:01:09 67500 -- (-1627.192) (-1626.497) (-1628.522) [-1626.691] * [-1631.539] (-1631.127) (-1635.890) (-1627.875) -- 0:01:09 68000 -- (-1626.943) (-1627.489) (-1628.125) [-1626.761] * [-1628.510] (-1634.986) (-1635.356) (-1627.631) -- 0:01:08 68500 -- (-1627.736) (-1626.740) (-1627.122) [-1626.636] * (-1629.556) (-1633.968) [-1634.019] (-1628.628) -- 0:01:07 69000 -- (-1631.113) (-1626.553) (-1626.899) [-1627.620] * [-1627.162] (-1637.728) (-1642.871) (-1629.433) -- 0:01:07 69500 -- [-1633.689] (-1626.406) (-1630.252) (-1627.563) * (-1628.648) (-1640.340) [-1634.342] (-1627.964) -- 0:01:06 70000 -- [-1631.267] (-1628.323) (-1629.980) (-1630.275) * [-1626.921] (-1635.521) (-1634.670) (-1627.964) -- 0:01:06 Average standard deviation of split frequencies: 0.022347 70500 -- [-1627.830] (-1627.825) (-1626.861) (-1627.413) * [-1628.479] (-1635.105) (-1631.922) (-1628.533) -- 0:01:05 71000 -- [-1626.276] (-1630.484) (-1628.084) (-1626.818) * (-1625.940) [-1635.181] (-1635.945) (-1628.484) -- 0:01:05 71500 -- [-1626.862] (-1628.146) (-1628.480) (-1628.578) * (-1628.932) (-1634.613) (-1636.252) [-1631.739] -- 0:01:04 72000 -- (-1627.109) (-1627.024) [-1628.357] (-1627.261) * [-1628.854] (-1636.252) (-1643.083) (-1629.484) -- 0:01:04 72500 -- [-1627.312] (-1627.437) (-1628.035) (-1628.883) * (-1628.189) (-1635.499) [-1632.229] (-1628.780) -- 0:01:03 73000 -- (-1627.270) (-1630.005) (-1628.189) [-1629.041] * (-1630.254) (-1644.388) [-1634.069] (-1628.240) -- 0:01:03 73500 -- (-1628.096) [-1628.634] (-1628.686) (-1627.576) * (-1628.579) [-1629.750] (-1646.573) (-1627.587) -- 0:01:03 74000 -- (-1628.424) (-1629.006) [-1631.051] (-1632.258) * (-1629.599) (-1635.120) [-1637.747] (-1627.759) -- 0:01:02 74500 -- [-1626.971] (-1629.114) (-1629.742) (-1630.697) * (-1629.264) (-1637.402) [-1639.894] (-1628.173) -- 0:01:02 75000 -- [-1627.424] (-1626.445) (-1629.731) (-1628.711) * (-1627.662) (-1641.235) [-1634.028] (-1627.161) -- 0:01:01 Average standard deviation of split frequencies: 0.022743 75500 -- (-1629.434) [-1626.903] (-1630.806) (-1626.843) * (-1626.856) (-1640.551) [-1633.626] (-1628.201) -- 0:01:01 76000 -- (-1630.227) [-1626.130] (-1630.962) (-1628.021) * (-1629.955) (-1637.802) [-1638.654] (-1629.532) -- 0:01:00 76500 -- [-1627.465] (-1626.405) (-1630.029) (-1626.770) * (-1627.227) [-1635.818] (-1638.784) (-1628.201) -- 0:01:00 77000 -- (-1627.357) (-1626.800) (-1631.676) [-1626.223] * (-1627.223) (-1639.286) (-1638.233) [-1630.893] -- 0:00:59 77500 -- (-1627.635) (-1627.859) (-1629.562) [-1626.273] * [-1626.879] (-1636.985) (-1636.112) (-1627.357) -- 0:01:11 78000 -- [-1632.714] (-1628.429) (-1628.608) (-1627.927) * (-1626.573) [-1632.747] (-1636.771) (-1629.286) -- 0:01:10 78500 -- (-1627.512) [-1627.054] (-1628.924) (-1627.010) * [-1628.142] (-1632.033) (-1637.604) (-1626.896) -- 0:01:10 79000 -- (-1626.758) (-1629.449) (-1629.688) [-1626.381] * (-1627.429) (-1640.051) (-1636.113) [-1627.389] -- 0:01:09 79500 -- [-1626.633] (-1626.532) (-1629.254) (-1626.860) * (-1627.420) (-1644.288) [-1633.507] (-1630.242) -- 0:01:09 80000 -- (-1628.127) [-1627.143] (-1628.887) (-1626.567) * (-1630.236) (-1639.505) (-1646.285) [-1635.235] -- 0:01:09 Average standard deviation of split frequencies: 0.020161 80500 -- (-1628.012) [-1626.675] (-1627.552) (-1626.903) * (-1626.826) (-1636.881) [-1626.836] (-1634.207) -- 0:01:08 81000 -- (-1629.137) (-1630.898) (-1629.421) [-1626.995] * (-1627.260) (-1637.214) (-1626.356) [-1630.800] -- 0:01:08 81500 -- (-1626.905) (-1626.509) (-1627.023) [-1627.613] * (-1628.377) [-1637.915] (-1626.573) (-1629.126) -- 0:01:07 82000 -- (-1627.777) [-1626.368] (-1628.670) (-1631.135) * (-1627.740) [-1637.456] (-1627.083) (-1629.091) -- 0:01:07 82500 -- [-1626.994] (-1626.920) (-1630.733) (-1630.374) * (-1627.338) [-1638.165] (-1628.275) (-1628.838) -- 0:01:06 83000 -- (-1626.719) [-1630.050] (-1628.564) (-1626.391) * (-1628.236) (-1637.841) (-1628.629) [-1629.380] -- 0:01:06 83500 -- [-1626.719] (-1626.933) (-1626.646) (-1626.002) * [-1626.536] (-1637.161) (-1627.595) (-1627.072) -- 0:01:05 84000 -- (-1628.981) (-1627.517) (-1629.879) [-1625.724] * [-1630.995] (-1636.843) (-1628.028) (-1626.954) -- 0:01:05 84500 -- [-1628.993] (-1627.639) (-1627.087) (-1625.816) * (-1626.299) (-1637.738) [-1630.432] (-1627.370) -- 0:01:05 85000 -- (-1632.205) [-1627.141] (-1626.220) (-1625.734) * (-1626.828) (-1639.184) [-1628.077] (-1632.280) -- 0:01:04 Average standard deviation of split frequencies: 0.024014 85500 -- (-1631.319) (-1626.310) [-1626.409] (-1626.004) * [-1627.204] (-1634.226) (-1628.644) (-1635.402) -- 0:01:04 86000 -- (-1627.079) (-1628.536) (-1628.341) [-1627.874] * (-1627.430) (-1639.619) [-1628.761] (-1627.973) -- 0:01:03 86500 -- (-1627.322) (-1628.533) [-1632.920] (-1625.855) * [-1626.862] (-1639.333) (-1628.997) (-1627.457) -- 0:01:03 87000 -- (-1629.165) (-1628.260) [-1631.060] (-1625.816) * (-1628.756) [-1635.275] (-1630.764) (-1627.510) -- 0:01:02 87500 -- (-1627.050) [-1627.889] (-1630.254) (-1626.399) * (-1628.907) [-1637.485] (-1628.558) (-1627.819) -- 0:01:02 88000 -- (-1629.200) (-1634.366) (-1628.797) [-1626.792] * [-1628.666] (-1636.860) (-1627.038) (-1631.113) -- 0:01:02 88500 -- (-1630.248) (-1627.459) [-1626.262] (-1626.190) * (-1628.090) (-1631.627) (-1628.543) [-1630.431] -- 0:01:01 89000 -- (-1632.413) (-1626.104) (-1627.405) [-1625.963] * (-1630.317) (-1634.334) [-1627.988] (-1627.273) -- 0:01:01 89500 -- (-1631.226) (-1627.399) (-1631.472) [-1630.021] * (-1628.078) (-1636.754) (-1628.020) [-1626.041] -- 0:01:01 90000 -- (-1627.764) (-1626.542) (-1627.927) [-1629.263] * (-1630.849) (-1647.444) (-1627.476) [-1626.697] -- 0:01:00 Average standard deviation of split frequencies: 0.025006 90500 -- (-1629.168) (-1626.547) [-1626.778] (-1629.915) * (-1628.263) [-1637.264] (-1629.864) (-1629.757) -- 0:01:00 91000 -- (-1627.939) [-1627.480] (-1627.746) (-1629.113) * (-1626.190) (-1634.447) [-1630.844] (-1627.443) -- 0:00:59 91500 -- [-1627.238] (-1627.968) (-1633.131) (-1630.255) * (-1627.112) [-1641.588] (-1629.749) (-1626.787) -- 0:00:59 92000 -- [-1626.917] (-1625.762) (-1630.141) (-1629.931) * (-1626.573) [-1641.270] (-1628.924) (-1627.523) -- 0:00:59 92500 -- (-1627.609) (-1625.694) (-1633.913) [-1629.593] * (-1627.327) [-1635.490] (-1628.843) (-1627.995) -- 0:00:58 93000 -- (-1626.461) [-1625.974] (-1638.809) (-1629.802) * (-1626.312) (-1642.431) (-1626.705) [-1626.045] -- 0:00:58 93500 -- (-1627.639) (-1626.159) (-1630.382) [-1629.126] * (-1626.370) [-1634.979] (-1626.081) (-1627.248) -- 0:01:07 94000 -- (-1626.694) (-1628.842) (-1633.535) [-1628.843] * (-1626.370) [-1640.105] (-1626.029) (-1628.029) -- 0:01:07 94500 -- (-1626.747) (-1627.550) (-1629.394) [-1627.998] * [-1626.625] (-1636.784) (-1630.269) (-1628.735) -- 0:01:07 95000 -- [-1625.725] (-1626.988) (-1628.100) (-1625.681) * (-1627.195) (-1637.156) [-1627.823] (-1626.919) -- 0:01:06 Average standard deviation of split frequencies: 0.025328 95500 -- (-1626.771) (-1629.333) (-1625.734) [-1628.296] * [-1629.798] (-1633.711) (-1628.994) (-1626.908) -- 0:01:06 96000 -- [-1627.443] (-1631.091) (-1627.886) (-1628.356) * (-1628.994) [-1642.123] (-1627.550) (-1626.886) -- 0:01:05 96500 -- (-1627.490) (-1629.699) (-1629.535) [-1629.185] * [-1627.060] (-1640.193) (-1628.157) (-1627.870) -- 0:01:05 97000 -- [-1628.507] (-1626.394) (-1628.859) (-1627.530) * (-1628.977) (-1643.389) (-1627.199) [-1627.270] -- 0:01:05 97500 -- (-1630.410) (-1626.478) [-1630.359] (-1627.101) * (-1627.139) (-1637.242) [-1627.971] (-1627.588) -- 0:01:04 98000 -- (-1628.926) [-1627.557] (-1630.947) (-1628.691) * (-1627.810) (-1646.630) (-1627.971) [-1627.515] -- 0:01:04 98500 -- [-1626.759] (-1632.106) (-1631.274) (-1628.834) * (-1626.909) [-1635.281] (-1630.652) (-1629.038) -- 0:01:04 99000 -- (-1627.157) [-1632.355] (-1628.681) (-1630.055) * (-1630.991) (-1642.767) [-1628.778] (-1627.774) -- 0:01:03 99500 -- (-1627.341) (-1629.482) (-1628.215) [-1625.979] * (-1627.091) [-1639.273] (-1626.838) (-1628.073) -- 0:01:03 100000 -- (-1632.760) [-1628.968] (-1628.251) (-1626.314) * [-1626.456] (-1640.731) (-1626.633) (-1628.062) -- 0:01:02 Average standard deviation of split frequencies: 0.026618 100500 -- [-1627.197] (-1629.632) (-1631.683) (-1625.745) * (-1627.740) [-1631.425] (-1626.687) (-1627.846) -- 0:01:02 101000 -- (-1626.901) (-1627.861) (-1629.934) [-1629.289] * (-1626.488) (-1640.811) [-1626.517] (-1633.016) -- 0:01:02 101500 -- (-1626.811) [-1625.855] (-1632.713) (-1629.051) * (-1626.487) (-1628.535) [-1626.512] (-1626.300) -- 0:01:01 102000 -- [-1626.820] (-1626.675) (-1635.429) (-1626.915) * (-1626.847) (-1628.829) (-1626.755) [-1627.079] -- 0:01:01 102500 -- (-1626.545) (-1627.034) (-1634.434) [-1627.380] * [-1627.712] (-1627.412) (-1626.220) (-1631.580) -- 0:01:01 103000 -- [-1626.389] (-1628.213) (-1633.329) (-1632.501) * [-1627.330] (-1625.983) (-1627.940) (-1627.730) -- 0:01:00 103500 -- (-1626.476) (-1626.255) (-1631.522) [-1629.149] * (-1628.051) [-1628.166] (-1627.618) (-1627.866) -- 0:01:00 104000 -- (-1626.542) (-1626.256) (-1628.588) [-1626.480] * (-1633.317) (-1627.322) [-1630.035] (-1629.719) -- 0:01:00 104500 -- (-1626.647) [-1626.890] (-1627.159) (-1631.346) * (-1631.344) [-1625.938] (-1629.571) (-1627.596) -- 0:00:59 105000 -- (-1626.514) (-1627.956) (-1627.159) [-1626.726] * (-1631.943) [-1628.054] (-1630.412) (-1629.318) -- 0:00:59 Average standard deviation of split frequencies: 0.023875 105500 -- (-1625.712) [-1627.484] (-1626.726) (-1626.895) * (-1630.365) (-1629.172) (-1628.745) [-1627.535] -- 0:00:59 106000 -- [-1625.687] (-1627.732) (-1627.594) (-1626.610) * (-1629.453) (-1627.628) (-1627.757) [-1627.070] -- 0:00:59 106500 -- [-1628.608] (-1626.692) (-1627.357) (-1626.684) * (-1630.165) (-1628.064) [-1627.211] (-1626.890) -- 0:00:58 107000 -- (-1627.699) [-1626.730] (-1627.182) (-1632.046) * (-1630.252) (-1629.123) [-1627.681] (-1626.064) -- 0:00:58 107500 -- (-1628.352) (-1630.067) (-1627.548) [-1626.947] * (-1627.901) [-1626.543] (-1627.540) (-1626.017) -- 0:00:58 108000 -- (-1629.807) (-1627.856) [-1628.028] (-1628.325) * (-1626.891) (-1626.681) (-1629.560) [-1626.149] -- 0:00:57 108500 -- (-1628.628) [-1628.208] (-1626.478) (-1629.428) * (-1626.903) (-1630.418) [-1630.944] (-1626.459) -- 0:00:57 109000 -- (-1628.942) (-1626.717) [-1627.731] (-1626.406) * (-1627.860) (-1626.447) [-1631.438] (-1628.981) -- 0:01:05 109500 -- (-1629.243) [-1628.295] (-1627.727) (-1628.216) * [-1627.932] (-1628.003) (-1626.917) (-1629.682) -- 0:01:05 110000 -- (-1629.259) (-1626.169) (-1627.762) [-1628.715] * [-1627.466] (-1633.786) (-1627.185) (-1629.131) -- 0:01:04 Average standard deviation of split frequencies: 0.021298 110500 -- [-1631.224] (-1627.810) (-1630.129) (-1626.413) * (-1626.918) (-1633.548) (-1628.169) [-1629.780] -- 0:01:04 111000 -- (-1627.738) [-1627.258] (-1629.360) (-1628.428) * (-1627.174) [-1627.292] (-1627.106) (-1635.472) -- 0:01:04 111500 -- [-1627.293] (-1629.233) (-1629.018) (-1628.552) * [-1627.344] (-1625.887) (-1628.608) (-1629.773) -- 0:01:03 112000 -- [-1626.537] (-1630.582) (-1629.346) (-1627.793) * (-1630.226) (-1627.437) (-1629.118) [-1627.205] -- 0:01:03 112500 -- [-1626.949] (-1629.918) (-1632.251) (-1627.450) * [-1627.785] (-1627.377) (-1626.112) (-1626.590) -- 0:01:03 113000 -- (-1628.032) (-1631.371) [-1628.692] (-1629.817) * (-1628.683) (-1630.211) (-1626.745) [-1627.375] -- 0:01:02 113500 -- (-1627.923) (-1634.672) [-1627.449] (-1630.092) * (-1627.075) (-1632.988) (-1627.348) [-1628.496] -- 0:01:02 114000 -- [-1627.466] (-1627.714) (-1625.810) (-1627.258) * [-1628.568] (-1631.689) (-1628.604) (-1629.426) -- 0:01:02 114500 -- [-1627.264] (-1627.465) (-1626.018) (-1628.980) * (-1628.648) (-1626.409) [-1627.954] (-1628.929) -- 0:01:01 115000 -- (-1628.572) (-1629.384) (-1627.888) [-1626.613] * (-1629.076) (-1626.830) [-1628.038] (-1628.862) -- 0:01:01 Average standard deviation of split frequencies: 0.020533 115500 -- (-1628.714) [-1627.787] (-1626.651) (-1628.253) * (-1628.407) [-1628.038] (-1629.866) (-1627.715) -- 0:01:01 116000 -- (-1632.687) (-1628.513) (-1627.189) [-1628.620] * (-1629.490) [-1629.550] (-1626.383) (-1627.958) -- 0:01:00 116500 -- (-1626.569) (-1626.888) [-1627.227] (-1628.211) * (-1634.813) (-1626.265) [-1626.704] (-1631.832) -- 0:01:00 117000 -- (-1628.747) (-1626.179) [-1628.028] (-1628.404) * (-1631.582) (-1626.436) [-1626.040] (-1630.512) -- 0:01:00 117500 -- [-1630.129] (-1627.088) (-1627.712) (-1627.780) * [-1628.464] (-1626.086) (-1626.983) (-1632.840) -- 0:01:00 118000 -- (-1626.828) [-1627.003] (-1628.210) (-1628.334) * (-1629.962) [-1626.059] (-1626.000) (-1629.702) -- 0:00:59 118500 -- [-1626.844] (-1626.710) (-1633.113) (-1635.729) * (-1628.096) (-1626.939) [-1627.789] (-1629.258) -- 0:00:59 119000 -- (-1626.784) (-1627.133) [-1629.707] (-1631.358) * (-1628.943) (-1626.877) [-1628.475] (-1631.244) -- 0:00:59 119500 -- (-1626.829) [-1627.562] (-1628.488) (-1630.596) * (-1628.525) [-1628.174] (-1625.715) (-1630.081) -- 0:00:58 120000 -- (-1634.835) [-1628.097] (-1625.730) (-1630.918) * (-1627.854) (-1626.473) [-1626.817] (-1628.629) -- 0:00:58 Average standard deviation of split frequencies: 0.019328 120500 -- (-1628.544) [-1628.382] (-1625.797) (-1629.475) * (-1627.884) [-1629.168] (-1627.448) (-1631.559) -- 0:00:58 121000 -- (-1631.224) [-1627.136] (-1626.309) (-1627.649) * (-1628.456) (-1629.777) [-1627.448] (-1632.914) -- 0:00:58 121500 -- (-1629.005) (-1627.693) [-1627.284] (-1627.253) * (-1628.694) (-1626.916) [-1627.216] (-1632.125) -- 0:00:57 122000 -- [-1628.641] (-1626.530) (-1628.364) (-1630.857) * (-1628.213) [-1626.951] (-1627.033) (-1636.485) -- 0:00:57 122500 -- (-1631.449) [-1626.841] (-1628.188) (-1629.286) * (-1627.832) (-1628.011) (-1625.956) [-1628.575] -- 0:00:57 123000 -- (-1632.375) (-1628.560) (-1628.710) [-1628.246] * [-1627.884] (-1628.011) (-1626.430) (-1630.174) -- 0:00:57 123500 -- (-1628.715) [-1628.637] (-1626.765) (-1629.172) * [-1628.592] (-1627.450) (-1627.713) (-1629.066) -- 0:00:56 124000 -- (-1627.983) (-1629.549) [-1626.826] (-1628.757) * [-1628.000] (-1627.092) (-1626.453) (-1629.717) -- 0:00:56 124500 -- (-1630.596) (-1629.032) [-1626.283] (-1631.669) * (-1629.268) (-1627.787) [-1628.712] (-1629.530) -- 0:00:56 125000 -- (-1628.767) (-1629.641) (-1625.949) [-1627.495] * (-1629.552) (-1627.822) [-1625.868] (-1628.211) -- 0:01:03 Average standard deviation of split frequencies: 0.019494 125500 -- (-1629.391) [-1627.493] (-1629.385) (-1628.127) * (-1629.988) (-1626.445) (-1627.434) [-1628.055] -- 0:01:02 126000 -- (-1626.945) [-1628.767] (-1631.281) (-1633.069) * (-1630.855) (-1627.660) (-1627.157) [-1630.069] -- 0:01:02 126500 -- (-1628.412) (-1626.785) [-1628.271] (-1633.780) * (-1626.743) [-1626.562] (-1626.962) (-1628.280) -- 0:01:02 127000 -- (-1628.756) [-1626.642] (-1629.655) (-1631.841) * (-1627.232) (-1626.210) [-1627.372] (-1629.595) -- 0:01:01 127500 -- [-1629.213] (-1631.486) (-1628.238) (-1629.426) * (-1627.009) (-1627.513) (-1628.083) [-1626.437] -- 0:01:01 128000 -- (-1628.843) (-1633.276) (-1628.371) [-1627.338] * (-1626.618) (-1627.178) [-1626.465] (-1629.478) -- 0:01:01 128500 -- (-1629.199) [-1631.851] (-1626.956) (-1628.960) * [-1626.091] (-1627.178) (-1628.301) (-1626.307) -- 0:01:01 129000 -- (-1628.992) (-1627.014) [-1626.988] (-1626.238) * (-1625.860) (-1627.063) (-1627.338) [-1626.255] -- 0:01:00 129500 -- (-1628.539) [-1626.634] (-1632.425) (-1626.238) * [-1627.581] (-1626.990) (-1626.123) (-1626.016) -- 0:01:00 130000 -- (-1628.484) (-1626.412) (-1628.274) [-1626.092] * (-1628.316) (-1626.417) (-1627.404) [-1628.954] -- 0:01:00 Average standard deviation of split frequencies: 0.018418 130500 -- (-1628.661) (-1626.834) [-1627.099] (-1626.742) * (-1629.439) (-1628.033) (-1627.361) [-1630.605] -- 0:00:59 131000 -- (-1630.514) (-1631.074) (-1627.302) [-1626.737] * (-1629.036) (-1627.535) [-1626.964] (-1629.741) -- 0:00:59 131500 -- (-1630.273) (-1632.992) (-1628.584) [-1626.743] * (-1628.359) (-1627.344) (-1627.222) [-1632.218] -- 0:00:59 132000 -- [-1628.339] (-1630.516) (-1627.493) (-1627.072) * (-1627.367) (-1627.186) (-1627.413) [-1627.524] -- 0:00:59 132500 -- (-1631.747) (-1635.049) [-1626.819] (-1627.737) * (-1626.817) (-1627.292) [-1631.962] (-1629.781) -- 0:00:58 133000 -- (-1630.835) (-1634.168) [-1629.250] (-1627.767) * (-1635.452) (-1636.380) (-1626.413) [-1630.754] -- 0:00:58 133500 -- (-1629.221) (-1630.482) [-1627.286] (-1631.329) * (-1630.790) [-1630.354] (-1626.077) (-1629.996) -- 0:00:58 134000 -- (-1628.260) (-1630.469) (-1626.063) [-1626.667] * (-1627.515) (-1630.059) (-1627.581) [-1629.451] -- 0:00:58 134500 -- (-1627.795) [-1627.689] (-1627.383) (-1626.919) * [-1626.718] (-1629.759) (-1627.641) (-1628.622) -- 0:00:57 135000 -- [-1627.124] (-1628.936) (-1627.677) (-1626.995) * (-1630.403) (-1631.589) [-1627.849] (-1627.818) -- 0:00:57 Average standard deviation of split frequencies: 0.016176 135500 -- [-1626.904] (-1627.744) (-1627.202) (-1626.516) * (-1627.506) (-1627.848) [-1627.732] (-1628.738) -- 0:00:57 136000 -- [-1627.413] (-1630.709) (-1632.201) (-1631.342) * [-1626.809] (-1627.395) (-1629.158) (-1627.603) -- 0:00:57 136500 -- (-1626.566) (-1626.383) (-1626.599) [-1627.871] * [-1627.019] (-1626.449) (-1625.935) (-1631.469) -- 0:00:56 137000 -- (-1631.367) [-1629.464] (-1627.885) (-1629.131) * (-1629.835) (-1626.929) [-1626.020] (-1626.996) -- 0:00:56 137500 -- (-1629.076) (-1629.968) (-1626.757) [-1628.088] * (-1629.029) [-1626.124] (-1630.304) (-1627.603) -- 0:00:56 138000 -- (-1629.301) (-1630.897) [-1628.769] (-1627.970) * (-1629.298) (-1631.468) [-1625.650] (-1626.898) -- 0:00:56 138500 -- (-1633.789) [-1631.520] (-1627.477) (-1627.613) * (-1632.003) (-1628.131) [-1627.105] (-1627.031) -- 0:00:55 139000 -- (-1634.689) (-1626.895) [-1628.805] (-1627.718) * (-1630.343) (-1629.377) (-1628.651) [-1627.012] -- 0:00:55 139500 -- (-1630.666) (-1629.176) (-1631.281) [-1626.494] * (-1630.346) (-1630.437) [-1627.540] (-1626.340) -- 0:00:55 140000 -- (-1629.906) (-1627.352) (-1629.951) [-1626.512] * (-1631.740) (-1631.706) [-1627.331] (-1625.625) -- 0:00:55 Average standard deviation of split frequencies: 0.013996 140500 -- (-1628.856) (-1629.202) (-1632.391) [-1627.714] * (-1630.087) (-1628.945) (-1627.384) [-1627.790] -- 0:01:01 141000 -- (-1630.871) (-1626.823) [-1633.039] (-1629.953) * (-1627.814) (-1629.471) (-1626.653) [-1627.864] -- 0:01:00 141500 -- (-1629.591) [-1626.772] (-1631.515) (-1629.827) * (-1628.844) [-1630.355] (-1625.792) (-1627.767) -- 0:01:00 142000 -- (-1628.808) (-1627.285) (-1630.929) [-1627.629] * [-1627.940] (-1630.248) (-1626.799) (-1627.560) -- 0:01:00 142500 -- (-1627.676) (-1627.002) (-1633.216) [-1626.637] * (-1627.997) (-1628.176) (-1626.836) [-1625.886] -- 0:01:00 143000 -- (-1628.721) (-1627.763) (-1633.390) [-1627.187] * (-1626.636) (-1631.363) [-1626.038] (-1630.511) -- 0:00:59 143500 -- [-1627.631] (-1629.474) (-1632.866) (-1626.539) * (-1626.515) (-1628.454) (-1627.261) [-1625.795] -- 0:00:59 144000 -- (-1631.614) (-1629.932) [-1628.892] (-1626.856) * (-1626.899) (-1626.225) (-1628.136) [-1626.555] -- 0:00:59 144500 -- (-1630.327) (-1628.358) [-1627.170] (-1629.930) * (-1627.169) (-1625.738) (-1627.110) [-1626.972] -- 0:00:59 145000 -- [-1629.646] (-1628.404) (-1628.707) (-1636.263) * [-1626.852] (-1626.069) (-1628.341) (-1628.902) -- 0:00:58 Average standard deviation of split frequencies: 0.014625 145500 -- (-1626.557) (-1627.428) [-1628.048] (-1635.371) * (-1627.582) [-1626.195] (-1631.287) (-1631.315) -- 0:00:58 146000 -- (-1627.196) (-1629.425) [-1627.415] (-1628.845) * (-1627.624) (-1626.932) (-1628.450) [-1631.463] -- 0:00:58 146500 -- (-1629.972) (-1629.273) [-1629.070] (-1628.908) * [-1628.472] (-1626.990) (-1627.856) (-1629.543) -- 0:00:58 147000 -- (-1630.878) [-1627.568] (-1627.750) (-1627.631) * [-1628.274] (-1629.384) (-1626.320) (-1628.905) -- 0:00:58 147500 -- [-1628.591] (-1628.320) (-1627.568) (-1626.706) * (-1627.075) (-1630.157) [-1626.556] (-1629.537) -- 0:00:57 148000 -- (-1635.962) (-1628.258) [-1628.219] (-1630.468) * (-1630.249) (-1630.586) (-1632.295) [-1628.387] -- 0:00:57 148500 -- [-1627.698] (-1630.443) (-1629.818) (-1627.509) * [-1627.175] (-1629.789) (-1629.738) (-1627.667) -- 0:00:57 149000 -- (-1628.959) (-1626.814) (-1627.585) [-1629.018] * (-1626.856) (-1628.047) [-1629.855] (-1627.864) -- 0:00:57 149500 -- (-1628.870) [-1630.016] (-1627.688) (-1632.051) * [-1626.438] (-1628.858) (-1627.176) (-1628.313) -- 0:00:56 150000 -- (-1626.662) [-1627.051] (-1627.929) (-1628.182) * (-1626.694) (-1627.674) (-1629.106) [-1628.821] -- 0:00:56 Average standard deviation of split frequencies: 0.013210 150500 -- [-1629.201] (-1630.800) (-1627.090) (-1627.254) * [-1626.510] (-1627.471) (-1628.484) (-1629.220) -- 0:00:56 151000 -- (-1628.250) [-1628.493] (-1626.053) (-1627.913) * [-1626.432] (-1629.168) (-1627.237) (-1630.052) -- 0:00:56 151500 -- (-1630.995) (-1627.776) [-1626.519] (-1628.196) * (-1627.739) (-1629.483) [-1627.279] (-1628.054) -- 0:00:56 152000 -- [-1629.416] (-1626.945) (-1627.578) (-1627.850) * [-1626.289] (-1629.274) (-1632.040) (-1631.130) -- 0:00:55 152500 -- (-1629.215) (-1626.257) (-1626.646) [-1627.198] * (-1630.314) (-1628.278) [-1627.600] (-1630.034) -- 0:00:55 153000 -- (-1627.172) (-1629.425) [-1625.907] (-1627.198) * [-1630.185] (-1628.805) (-1627.351) (-1631.780) -- 0:00:55 153500 -- (-1626.597) (-1628.597) (-1626.043) [-1627.295] * (-1629.027) (-1627.357) [-1627.669] (-1630.683) -- 0:00:55 154000 -- (-1627.207) [-1627.569] (-1629.604) (-1627.689) * [-1630.953] (-1629.197) (-1632.919) (-1626.779) -- 0:00:54 154500 -- (-1625.725) (-1628.806) (-1629.333) [-1626.576] * (-1626.756) [-1626.171] (-1632.046) (-1627.347) -- 0:00:54 155000 -- (-1625.644) (-1627.699) (-1632.560) [-1626.102] * (-1625.939) (-1626.171) [-1630.043] (-1628.627) -- 0:00:54 Average standard deviation of split frequencies: 0.014473 155500 -- (-1626.944) (-1628.513) [-1629.621] (-1626.570) * (-1625.891) (-1626.157) (-1630.809) [-1627.315] -- 0:00:54 156000 -- (-1628.716) (-1627.537) (-1630.077) [-1626.193] * (-1626.627) [-1626.218] (-1630.053) (-1629.313) -- 0:00:59 156500 -- [-1627.190] (-1630.200) (-1632.611) (-1630.050) * (-1628.735) (-1626.051) (-1630.011) [-1627.838] -- 0:00:59 157000 -- (-1627.277) (-1630.979) (-1628.301) [-1628.363] * (-1628.963) (-1628.020) [-1627.496] (-1628.281) -- 0:00:59 157500 -- (-1627.676) (-1626.817) [-1627.520] (-1627.837) * (-1628.420) (-1627.146) [-1626.206] (-1629.656) -- 0:00:58 158000 -- [-1628.730] (-1626.054) (-1628.940) (-1627.977) * [-1630.610] (-1626.086) (-1626.206) (-1630.785) -- 0:00:58 158500 -- (-1627.963) (-1626.054) [-1629.354] (-1629.477) * [-1627.894] (-1627.385) (-1625.854) (-1630.855) -- 0:00:58 159000 -- (-1627.702) (-1629.672) (-1630.036) [-1628.684] * (-1627.499) [-1629.668] (-1626.753) (-1627.882) -- 0:00:58 159500 -- (-1627.905) (-1629.232) [-1628.838] (-1626.102) * (-1629.341) (-1629.120) (-1627.094) [-1629.334] -- 0:00:57 160000 -- (-1630.095) [-1629.743] (-1627.863) (-1626.472) * (-1628.127) (-1626.800) (-1627.680) [-1629.446] -- 0:00:57 Average standard deviation of split frequencies: 0.013589 160500 -- [-1631.237] (-1629.316) (-1626.965) (-1626.781) * (-1628.001) (-1626.793) (-1627.707) [-1630.265] -- 0:00:57 161000 -- (-1625.837) (-1627.658) [-1628.642] (-1626.615) * [-1630.953] (-1628.292) (-1627.769) (-1628.015) -- 0:00:57 161500 -- [-1627.924] (-1627.083) (-1627.406) (-1629.625) * (-1629.066) (-1627.642) (-1628.514) [-1627.608] -- 0:00:57 162000 -- (-1626.867) (-1627.158) [-1630.082] (-1628.639) * (-1628.667) (-1625.951) [-1627.324] (-1627.436) -- 0:00:56 162500 -- (-1627.582) (-1629.228) [-1631.202] (-1627.189) * (-1629.608) [-1625.891] (-1627.608) (-1628.119) -- 0:00:56 163000 -- [-1626.717] (-1628.370) (-1627.014) (-1627.189) * [-1627.922] (-1626.900) (-1627.849) (-1627.498) -- 0:00:56 163500 -- (-1626.414) [-1627.710] (-1628.568) (-1626.941) * (-1627.722) (-1626.998) [-1628.221] (-1630.131) -- 0:00:56 164000 -- (-1626.492) [-1627.516] (-1628.352) (-1626.951) * (-1629.037) [-1628.942] (-1628.230) (-1628.927) -- 0:00:56 164500 -- (-1626.576) [-1629.580] (-1629.623) (-1626.028) * [-1629.616] (-1633.748) (-1628.527) (-1628.161) -- 0:00:55 165000 -- (-1626.343) (-1628.864) (-1626.303) [-1626.716] * [-1627.853] (-1630.519) (-1628.161) (-1630.084) -- 0:00:55 Average standard deviation of split frequencies: 0.014483 165500 -- [-1628.135] (-1629.943) (-1628.990) (-1626.988) * (-1626.976) [-1625.843] (-1627.605) (-1630.107) -- 0:00:55 166000 -- (-1629.750) [-1629.419] (-1629.706) (-1627.185) * (-1627.096) [-1625.589] (-1627.788) (-1629.310) -- 0:00:55 166500 -- [-1628.527] (-1626.901) (-1627.743) (-1628.649) * (-1627.872) [-1626.361] (-1627.754) (-1628.533) -- 0:00:55 167000 -- [-1630.321] (-1628.688) (-1631.085) (-1626.999) * (-1626.385) [-1625.862] (-1627.139) (-1629.240) -- 0:00:54 167500 -- [-1628.815] (-1629.247) (-1628.751) (-1626.610) * (-1626.477) (-1626.850) [-1628.098] (-1627.641) -- 0:00:54 168000 -- (-1630.950) (-1629.320) [-1627.913] (-1626.622) * (-1627.665) (-1632.593) [-1626.590] (-1627.831) -- 0:00:54 168500 -- (-1631.414) [-1635.635] (-1629.446) (-1626.883) * (-1628.017) (-1630.074) (-1629.875) [-1627.044] -- 0:00:54 169000 -- (-1627.742) (-1630.201) [-1628.612] (-1628.073) * (-1626.107) (-1631.940) (-1626.682) [-1626.590] -- 0:00:54 169500 -- [-1626.195] (-1630.333) (-1628.411) (-1631.826) * (-1631.205) (-1632.931) (-1631.393) [-1628.293] -- 0:00:53 170000 -- (-1626.651) (-1628.391) [-1628.298] (-1627.076) * (-1628.219) [-1627.802] (-1627.053) (-1628.394) -- 0:00:53 Average standard deviation of split frequencies: 0.015652 170500 -- (-1626.475) (-1630.514) (-1628.774) [-1627.053] * (-1629.480) (-1627.613) [-1627.674] (-1627.793) -- 0:00:53 171000 -- [-1628.347] (-1627.767) (-1631.063) (-1628.108) * (-1628.089) (-1626.564) (-1628.551) [-1626.958] -- 0:00:53 171500 -- (-1627.729) [-1627.050] (-1628.321) (-1628.895) * (-1626.668) (-1626.161) [-1626.931] (-1629.097) -- 0:00:53 172000 -- [-1627.320] (-1628.109) (-1628.705) (-1628.976) * [-1626.286] (-1626.233) (-1627.997) (-1627.525) -- 0:00:52 172500 -- (-1628.609) (-1628.883) (-1627.376) [-1628.416] * (-1627.545) [-1626.521] (-1630.243) (-1628.036) -- 0:00:57 173000 -- (-1628.679) (-1628.290) (-1626.403) [-1629.526] * (-1629.172) (-1635.356) (-1629.242) [-1626.488] -- 0:00:57 173500 -- (-1627.288) (-1627.767) [-1627.448] (-1629.521) * (-1628.910) [-1629.425] (-1627.763) (-1631.127) -- 0:00:57 174000 -- (-1629.660) [-1626.034] (-1627.082) (-1626.296) * [-1627.060] (-1630.697) (-1627.439) (-1628.376) -- 0:00:56 174500 -- (-1627.051) (-1626.034) (-1626.476) [-1630.671] * (-1627.031) (-1629.168) [-1627.284] (-1627.436) -- 0:00:56 175000 -- (-1628.062) (-1627.153) [-1626.339] (-1627.121) * (-1626.997) [-1628.760] (-1628.277) (-1627.244) -- 0:00:56 Average standard deviation of split frequencies: 0.015922 175500 -- (-1627.513) (-1628.822) [-1626.791] (-1632.268) * (-1627.651) (-1628.828) [-1628.043] (-1630.555) -- 0:00:56 176000 -- [-1627.448] (-1632.271) (-1628.076) (-1628.946) * (-1627.018) [-1627.260] (-1629.039) (-1629.221) -- 0:00:56 176500 -- (-1627.499) (-1628.090) [-1626.535] (-1628.031) * (-1627.017) (-1628.302) [-1627.013] (-1630.292) -- 0:00:55 177000 -- (-1628.689) (-1627.149) (-1625.997) [-1629.126] * (-1627.722) (-1626.570) (-1627.015) [-1629.957] -- 0:00:55 177500 -- (-1628.690) (-1629.403) [-1629.160] (-1631.051) * (-1626.046) (-1626.227) [-1626.620] (-1627.821) -- 0:00:55 178000 -- (-1627.607) (-1629.681) [-1630.191] (-1632.212) * (-1629.891) (-1627.595) (-1627.488) [-1626.611] -- 0:00:55 178500 -- (-1627.530) (-1631.885) (-1629.774) [-1627.947] * (-1628.217) (-1629.355) [-1627.680] (-1626.827) -- 0:00:55 179000 -- [-1626.189] (-1632.084) (-1630.204) (-1626.508) * [-1628.198] (-1628.929) (-1626.667) (-1627.017) -- 0:00:55 179500 -- (-1627.282) [-1630.186] (-1636.775) (-1626.508) * (-1628.650) (-1630.889) [-1626.653] (-1626.408) -- 0:00:54 180000 -- (-1625.828) [-1627.459] (-1633.106) (-1626.890) * [-1628.477] (-1628.359) (-1626.163) (-1626.549) -- 0:00:54 Average standard deviation of split frequencies: 0.015195 180500 -- (-1627.656) [-1629.009] (-1628.097) (-1627.327) * (-1627.903) (-1628.657) (-1627.842) [-1627.295] -- 0:00:54 181000 -- (-1626.008) [-1626.436] (-1628.235) (-1627.057) * (-1626.202) (-1629.261) [-1625.918] (-1627.242) -- 0:00:54 181500 -- [-1625.887] (-1626.120) (-1629.799) (-1626.303) * [-1625.949] (-1629.950) (-1626.052) (-1627.248) -- 0:00:54 182000 -- [-1627.320] (-1626.186) (-1628.116) (-1626.731) * [-1627.502] (-1631.498) (-1627.905) (-1627.062) -- 0:00:53 182500 -- (-1628.963) (-1626.456) (-1629.559) [-1627.085] * [-1627.519] (-1635.919) (-1626.863) (-1628.715) -- 0:00:53 183000 -- (-1629.895) (-1629.048) (-1632.229) [-1626.550] * (-1630.132) (-1627.572) [-1628.705] (-1627.682) -- 0:00:53 183500 -- (-1629.114) (-1627.201) [-1628.778] (-1626.598) * (-1628.225) (-1627.315) [-1629.712] (-1628.231) -- 0:00:53 184000 -- [-1628.630] (-1627.469) (-1628.700) (-1626.433) * (-1628.166) [-1627.297] (-1627.463) (-1629.300) -- 0:00:53 184500 -- (-1632.079) (-1626.795) [-1629.835] (-1626.614) * [-1628.844] (-1628.819) (-1631.283) (-1629.385) -- 0:00:53 185000 -- (-1630.315) (-1631.126) (-1628.937) [-1627.338] * [-1626.222] (-1632.184) (-1627.140) (-1629.276) -- 0:00:52 Average standard deviation of split frequencies: 0.013939 185500 -- (-1628.698) [-1627.788] (-1630.489) (-1627.381) * (-1626.043) (-1627.711) (-1628.670) [-1628.038] -- 0:00:52 186000 -- (-1627.976) (-1628.696) (-1627.997) [-1628.090] * (-1626.741) [-1627.548] (-1627.575) (-1628.404) -- 0:00:52 186500 -- (-1628.608) [-1629.472] (-1637.252) (-1627.796) * (-1627.348) (-1627.879) (-1627.001) [-1629.497] -- 0:00:52 187000 -- (-1628.081) [-1626.883] (-1630.309) (-1626.778) * (-1626.858) [-1627.974] (-1635.289) (-1627.176) -- 0:00:52 187500 -- (-1628.422) (-1627.832) (-1628.437) [-1628.613] * (-1629.311) (-1626.419) [-1629.552] (-1629.602) -- 0:00:52 188000 -- [-1628.994] (-1626.808) (-1631.333) (-1627.149) * [-1631.259] (-1626.258) (-1627.164) (-1630.077) -- 0:00:56 188500 -- (-1627.338) [-1627.465] (-1628.523) (-1626.938) * (-1629.069) (-1626.236) [-1629.129] (-1627.125) -- 0:00:55 189000 -- [-1628.453] (-1626.554) (-1631.287) (-1626.456) * (-1627.905) (-1630.342) (-1626.624) [-1627.172] -- 0:00:55 189500 -- (-1628.142) (-1626.638) (-1628.238) [-1627.003] * [-1627.582] (-1628.027) (-1627.156) (-1626.629) -- 0:00:55 190000 -- (-1627.211) [-1626.980] (-1627.916) (-1628.751) * (-1627.155) (-1632.330) (-1630.234) [-1626.401] -- 0:00:55 Average standard deviation of split frequencies: 0.015355 190500 -- (-1626.874) [-1627.323] (-1627.444) (-1627.580) * (-1626.920) (-1631.583) [-1627.316] (-1627.214) -- 0:00:55 191000 -- (-1625.664) (-1626.837) (-1627.519) [-1629.475] * (-1630.413) (-1632.236) [-1627.043] (-1626.728) -- 0:00:55 191500 -- [-1628.130] (-1630.934) (-1628.160) (-1626.870) * (-1626.689) (-1631.989) [-1626.338] (-1627.892) -- 0:00:54 192000 -- [-1629.243] (-1630.734) (-1633.134) (-1627.788) * (-1630.820) (-1630.490) [-1627.962] (-1627.823) -- 0:00:54 192500 -- (-1628.056) [-1631.978] (-1629.916) (-1627.894) * [-1627.261] (-1628.271) (-1629.490) (-1629.743) -- 0:00:54 193000 -- [-1626.562] (-1630.405) (-1629.727) (-1631.532) * (-1628.467) (-1627.522) [-1629.060] (-1630.834) -- 0:00:54 193500 -- (-1626.916) [-1626.996] (-1627.547) (-1630.930) * (-1626.849) [-1628.763] (-1629.321) (-1627.515) -- 0:00:54 194000 -- (-1628.939) [-1626.657] (-1629.125) (-1630.493) * (-1626.692) (-1629.652) (-1627.229) [-1631.023] -- 0:00:54 194500 -- (-1627.330) [-1626.444] (-1628.127) (-1630.654) * (-1626.232) (-1630.816) (-1627.524) [-1628.345] -- 0:00:53 195000 -- [-1630.365] (-1632.439) (-1627.296) (-1629.280) * (-1626.203) [-1626.614] (-1627.034) (-1630.980) -- 0:00:53 Average standard deviation of split frequencies: 0.014698 195500 -- (-1631.126) (-1626.776) [-1625.947] (-1632.409) * (-1626.793) (-1628.001) [-1625.820] (-1630.544) -- 0:00:53 196000 -- (-1630.301) (-1629.657) (-1626.125) [-1628.323] * (-1626.814) (-1627.792) (-1626.339) [-1626.336] -- 0:00:53 196500 -- (-1629.466) [-1627.590] (-1626.069) (-1631.333) * (-1625.947) [-1627.580] (-1628.154) (-1626.782) -- 0:00:53 197000 -- (-1626.150) (-1630.104) [-1627.511] (-1633.808) * [-1626.093] (-1629.771) (-1627.046) (-1630.975) -- 0:00:52 197500 -- (-1626.127) (-1630.030) (-1626.760) [-1628.804] * (-1628.850) (-1628.832) (-1630.092) [-1630.777] -- 0:00:52 198000 -- (-1627.206) (-1628.261) (-1626.375) [-1632.049] * (-1629.330) (-1628.186) (-1629.669) [-1628.495] -- 0:00:52 198500 -- [-1626.439] (-1628.515) (-1626.518) (-1629.096) * (-1627.128) (-1630.432) [-1626.043] (-1626.253) -- 0:00:52 199000 -- (-1626.066) (-1629.649) [-1628.288] (-1628.732) * (-1629.649) (-1628.311) [-1627.252] (-1626.758) -- 0:00:52 199500 -- [-1627.159] (-1627.576) (-1629.772) (-1627.425) * (-1626.384) (-1631.089) [-1627.662] (-1626.253) -- 0:00:52 200000 -- (-1627.135) (-1628.800) (-1629.532) [-1628.268] * (-1628.721) (-1631.492) [-1630.853] (-1628.349) -- 0:00:51 Average standard deviation of split frequencies: 0.014372 200500 -- (-1626.315) [-1628.662] (-1628.439) (-1628.530) * (-1627.620) (-1635.099) (-1627.194) [-1631.044] -- 0:00:51 201000 -- (-1626.917) [-1631.661] (-1630.156) (-1626.205) * (-1626.575) (-1633.792) (-1627.050) [-1628.015] -- 0:00:51 201500 -- (-1626.208) [-1626.166] (-1628.683) (-1626.722) * [-1627.714] (-1635.308) (-1627.051) (-1631.033) -- 0:00:51 202000 -- [-1628.047] (-1633.914) (-1633.443) (-1629.605) * (-1629.821) (-1629.903) [-1626.527] (-1627.724) -- 0:00:51 202500 -- (-1626.428) (-1633.967) (-1629.620) [-1628.590] * [-1628.315] (-1627.884) (-1626.679) (-1628.491) -- 0:00:51 203000 -- (-1628.584) (-1627.293) (-1627.821) [-1627.462] * [-1630.116] (-1632.151) (-1632.521) (-1630.617) -- 0:00:51 203500 -- [-1626.165] (-1627.817) (-1627.682) (-1627.709) * [-1628.919] (-1628.049) (-1633.878) (-1626.209) -- 0:00:50 204000 -- (-1626.337) (-1627.223) [-1626.941] (-1631.305) * (-1631.852) [-1626.411] (-1631.794) (-1626.697) -- 0:00:54 204500 -- (-1627.529) (-1631.690) (-1627.580) [-1626.402] * [-1628.439] (-1627.315) (-1633.143) (-1627.997) -- 0:00:54 205000 -- (-1626.307) [-1629.664] (-1627.575) (-1627.130) * (-1627.875) (-1628.811) (-1633.502) [-1626.802] -- 0:00:54 Average standard deviation of split frequencies: 0.012243 205500 -- (-1626.133) (-1627.908) [-1628.967] (-1627.950) * (-1627.653) [-1630.255] (-1630.235) (-1626.948) -- 0:00:54 206000 -- (-1626.974) (-1630.061) [-1631.821] (-1626.817) * (-1627.144) (-1627.097) (-1628.446) [-1627.377] -- 0:00:53 206500 -- (-1626.706) [-1630.373] (-1627.474) (-1627.327) * [-1626.371] (-1626.326) (-1627.084) (-1627.056) -- 0:00:53 207000 -- (-1626.389) [-1626.373] (-1627.579) (-1627.503) * (-1627.909) [-1625.978] (-1626.352) (-1631.019) -- 0:00:53 207500 -- (-1626.400) (-1629.635) (-1628.426) [-1627.680] * [-1628.202] (-1626.673) (-1625.965) (-1630.007) -- 0:00:53 208000 -- (-1626.649) (-1628.585) [-1628.488] (-1628.550) * (-1628.176) (-1628.111) (-1626.054) [-1627.717] -- 0:00:53 208500 -- (-1626.506) [-1627.929] (-1628.365) (-1626.963) * (-1635.602) [-1629.127] (-1627.842) (-1626.346) -- 0:00:53 209000 -- (-1626.887) (-1627.544) [-1631.357] (-1628.941) * [-1633.685] (-1629.263) (-1628.288) (-1627.945) -- 0:00:52 209500 -- (-1626.731) (-1627.636) [-1628.111] (-1627.163) * (-1638.787) (-1627.744) (-1626.805) [-1632.460] -- 0:00:52 210000 -- [-1630.154] (-1627.526) (-1628.941) (-1630.175) * (-1628.886) [-1626.156] (-1627.376) (-1630.928) -- 0:00:52 Average standard deviation of split frequencies: 0.011715 210500 -- (-1626.940) [-1626.267] (-1628.577) (-1626.991) * [-1627.572] (-1627.836) (-1627.973) (-1626.949) -- 0:00:52 211000 -- (-1626.507) (-1626.219) (-1628.632) [-1626.049] * (-1627.889) [-1628.237] (-1628.686) (-1631.257) -- 0:00:52 211500 -- (-1629.864) (-1626.316) [-1631.551] (-1625.982) * (-1629.109) (-1627.980) (-1628.619) [-1629.725] -- 0:00:52 212000 -- (-1630.446) (-1626.772) (-1629.946) [-1625.908] * (-1629.191) (-1631.161) [-1628.543] (-1628.138) -- 0:00:52 212500 -- (-1630.186) (-1626.770) (-1629.193) [-1626.315] * (-1629.315) (-1633.248) (-1627.957) [-1628.346] -- 0:00:51 213000 -- [-1627.556] (-1631.370) (-1627.517) (-1627.171) * [-1628.255] (-1632.475) (-1627.305) (-1627.487) -- 0:00:51 213500 -- (-1627.781) (-1631.293) (-1626.828) [-1630.258] * (-1627.628) (-1629.614) (-1631.143) [-1627.773] -- 0:00:51 214000 -- [-1628.474] (-1627.581) (-1627.178) (-1628.943) * (-1628.201) (-1627.332) (-1628.431) [-1626.056] -- 0:00:51 214500 -- (-1628.009) (-1628.661) [-1628.403] (-1626.690) * (-1628.213) (-1628.207) (-1627.668) [-1626.507] -- 0:00:51 215000 -- (-1628.394) (-1629.804) [-1625.876] (-1626.694) * (-1628.200) (-1627.538) [-1629.255] (-1627.873) -- 0:00:51 Average standard deviation of split frequencies: 0.010655 215500 -- (-1627.938) (-1629.465) (-1628.295) [-1630.547] * (-1627.459) [-1627.465] (-1630.019) (-1627.577) -- 0:00:50 216000 -- [-1627.610] (-1628.197) (-1626.457) (-1627.474) * [-1627.820] (-1627.858) (-1629.514) (-1627.818) -- 0:00:50 216500 -- (-1626.221) (-1634.371) [-1626.058] (-1630.074) * (-1626.686) (-1627.596) [-1631.154] (-1629.009) -- 0:00:50 217000 -- [-1626.787] (-1631.197) (-1627.515) (-1627.500) * [-1627.186] (-1629.969) (-1629.910) (-1629.102) -- 0:00:50 217500 -- (-1627.122) (-1628.078) [-1628.859] (-1626.619) * (-1627.811) [-1628.192] (-1627.674) (-1627.895) -- 0:00:50 218000 -- (-1626.438) (-1629.046) (-1628.686) [-1626.229] * [-1627.461] (-1628.066) (-1628.728) (-1627.476) -- 0:00:50 218500 -- (-1627.199) (-1627.649) (-1634.746) [-1627.007] * [-1628.321] (-1630.045) (-1628.729) (-1628.538) -- 0:00:50 219000 -- (-1626.516) (-1632.166) [-1630.267] (-1630.075) * (-1627.546) [-1627.049] (-1630.382) (-1627.286) -- 0:00:49 219500 -- (-1626.038) (-1632.982) (-1628.905) [-1628.087] * [-1629.916] (-1627.159) (-1627.131) (-1626.886) -- 0:00:53 220000 -- (-1626.460) (-1628.663) [-1630.897] (-1628.353) * (-1632.828) [-1627.777] (-1627.070) (-1629.282) -- 0:00:53 Average standard deviation of split frequencies: 0.009676 220500 -- (-1627.149) (-1626.744) (-1628.251) [-1630.781] * (-1629.640) (-1627.700) (-1627.346) [-1627.725] -- 0:00:53 221000 -- (-1626.912) (-1627.919) (-1629.864) [-1630.608] * (-1629.220) (-1630.330) (-1627.517) [-1627.569] -- 0:00:52 221500 -- (-1626.536) (-1631.794) (-1627.921) [-1628.629] * (-1629.299) (-1629.417) (-1627.799) [-1626.527] -- 0:00:52 222000 -- (-1629.043) (-1627.736) [-1628.073] (-1626.192) * [-1629.116] (-1626.673) (-1627.972) (-1628.057) -- 0:00:52 222500 -- (-1628.207) (-1627.614) (-1628.271) [-1626.501] * (-1630.016) [-1626.804] (-1628.345) (-1626.914) -- 0:00:52 223000 -- (-1627.514) (-1628.816) [-1627.598] (-1626.909) * (-1630.015) (-1628.317) (-1627.728) [-1627.017] -- 0:00:52 223500 -- [-1627.551] (-1627.258) (-1629.508) (-1627.550) * (-1628.455) [-1627.938] (-1627.002) (-1626.102) -- 0:00:52 224000 -- (-1627.463) (-1627.967) (-1629.586) [-1629.158] * (-1628.733) [-1628.425] (-1626.571) (-1626.772) -- 0:00:51 224500 -- (-1626.165) (-1632.452) [-1627.485] (-1627.641) * (-1628.083) (-1628.652) [-1626.207] (-1626.906) -- 0:00:51 225000 -- [-1631.051] (-1627.574) (-1627.089) (-1626.614) * [-1631.613] (-1627.563) (-1627.019) (-1627.002) -- 0:00:51 Average standard deviation of split frequencies: 0.010082 225500 -- (-1627.938) [-1627.197] (-1626.841) (-1627.725) * (-1630.843) (-1628.020) [-1627.358] (-1628.568) -- 0:00:51 226000 -- [-1627.221] (-1626.463) (-1631.795) (-1627.078) * [-1629.452] (-1630.657) (-1626.571) (-1629.340) -- 0:00:51 226500 -- (-1630.294) (-1627.187) (-1628.036) [-1626.732] * (-1627.783) [-1629.950] (-1629.133) (-1628.640) -- 0:00:51 227000 -- (-1629.413) (-1627.790) (-1629.818) [-1626.367] * [-1629.985] (-1627.855) (-1627.093) (-1628.017) -- 0:00:51 227500 -- (-1629.576) (-1627.103) [-1628.661] (-1626.757) * (-1627.864) (-1628.942) (-1627.363) [-1629.695] -- 0:00:50 228000 -- [-1627.068] (-1629.691) (-1629.607) (-1625.980) * (-1629.644) (-1628.533) (-1627.216) [-1627.527] -- 0:00:50 228500 -- (-1627.517) (-1630.967) (-1628.600) [-1630.670] * (-1628.007) (-1627.196) (-1626.749) [-1626.730] -- 0:00:50 229000 -- (-1627.399) [-1635.663] (-1628.336) (-1631.184) * [-1627.849] (-1627.226) (-1627.526) (-1626.815) -- 0:00:50 229500 -- (-1627.934) (-1632.645) [-1628.490] (-1631.288) * (-1627.223) (-1627.743) [-1626.690] (-1629.737) -- 0:00:50 230000 -- (-1634.301) (-1627.822) [-1628.561] (-1631.015) * (-1627.479) (-1628.152) [-1626.499] (-1628.120) -- 0:00:50 Average standard deviation of split frequencies: 0.009737 230500 -- (-1627.094) (-1627.124) [-1628.276] (-1626.208) * (-1628.560) (-1631.416) (-1626.602) [-1627.292] -- 0:00:50 231000 -- (-1628.470) (-1626.330) [-1628.156] (-1625.969) * (-1627.382) [-1626.930] (-1632.371) (-1627.644) -- 0:00:49 231500 -- (-1629.038) [-1627.837] (-1627.094) (-1625.685) * [-1626.796] (-1626.937) (-1629.362) (-1629.252) -- 0:00:49 232000 -- (-1626.794) (-1630.031) (-1627.345) [-1625.881] * [-1626.402] (-1629.510) (-1626.824) (-1630.093) -- 0:00:49 232500 -- (-1627.369) [-1628.759] (-1626.668) (-1627.490) * (-1630.661) [-1630.685] (-1626.418) (-1629.884) -- 0:00:49 233000 -- (-1627.809) (-1627.399) [-1628.298] (-1628.032) * [-1629.993] (-1628.578) (-1627.972) (-1625.951) -- 0:00:49 233500 -- [-1626.598] (-1629.934) (-1627.714) (-1626.248) * (-1629.524) [-1626.557] (-1628.131) (-1626.393) -- 0:00:49 234000 -- (-1628.970) (-1631.424) (-1628.552) [-1626.736] * (-1629.815) [-1626.228] (-1631.453) (-1627.399) -- 0:00:49 234500 -- [-1629.234] (-1632.318) (-1627.545) (-1629.089) * (-1628.109) (-1629.222) [-1636.181] (-1630.298) -- 0:00:48 235000 -- (-1626.444) (-1635.476) (-1627.161) [-1628.410] * (-1626.689) (-1632.006) (-1629.112) [-1627.214] -- 0:00:52 Average standard deviation of split frequencies: 0.008460 235500 -- [-1627.040] (-1631.072) (-1626.152) (-1627.292) * (-1626.532) (-1631.729) (-1629.304) [-1627.038] -- 0:00:51 236000 -- (-1626.869) (-1627.368) [-1626.442] (-1627.036) * (-1626.606) (-1628.776) (-1628.196) [-1626.316] -- 0:00:51 236500 -- (-1627.075) [-1627.249] (-1627.600) (-1626.186) * (-1626.606) (-1628.302) (-1628.254) [-1626.152] -- 0:00:51 237000 -- (-1627.403) [-1627.147] (-1627.065) (-1626.165) * (-1626.371) (-1628.528) (-1627.103) [-1627.968] -- 0:00:51 237500 -- (-1627.320) (-1631.590) [-1627.065] (-1629.236) * (-1627.177) (-1628.189) [-1627.009] (-1627.472) -- 0:00:51 238000 -- (-1633.473) (-1631.964) (-1626.431) [-1626.724] * (-1634.338) [-1629.302] (-1627.154) (-1629.452) -- 0:00:51 238500 -- (-1626.873) (-1630.656) (-1626.676) [-1627.924] * (-1630.626) (-1635.358) [-1627.521] (-1627.271) -- 0:00:51 239000 -- (-1627.061) [-1629.334] (-1626.112) (-1632.198) * (-1630.626) (-1633.318) (-1626.873) [-1627.182] -- 0:00:50 239500 -- (-1627.695) (-1628.013) (-1626.386) [-1629.669] * (-1626.216) (-1628.904) (-1627.225) [-1625.946] -- 0:00:50 240000 -- (-1628.454) (-1629.606) [-1626.549] (-1627.257) * [-1627.470] (-1627.445) (-1628.314) (-1625.937) -- 0:00:50 Average standard deviation of split frequencies: 0.010600 240500 -- (-1631.462) (-1630.071) (-1626.622) [-1626.452] * (-1628.182) [-1628.045] (-1627.672) (-1628.772) -- 0:00:50 241000 -- [-1630.311] (-1627.510) (-1626.670) (-1626.892) * (-1627.794) (-1628.072) (-1626.907) [-1627.357] -- 0:00:50 241500 -- (-1628.174) [-1627.445] (-1626.668) (-1627.097) * (-1628.267) (-1628.487) [-1625.918] (-1626.317) -- 0:00:50 242000 -- [-1628.273] (-1627.595) (-1628.530) (-1629.881) * [-1628.841] (-1627.609) (-1629.621) (-1631.834) -- 0:00:50 242500 -- (-1628.589) [-1627.387] (-1628.411) (-1630.364) * [-1628.472] (-1628.175) (-1626.502) (-1631.893) -- 0:00:49 243000 -- (-1628.091) (-1629.707) [-1627.985] (-1629.096) * (-1628.435) [-1628.335] (-1626.212) (-1627.801) -- 0:00:49 243500 -- (-1628.956) (-1628.592) (-1627.590) [-1629.089] * (-1630.594) (-1628.406) (-1628.262) [-1626.535] -- 0:00:49 244000 -- (-1628.631) [-1630.526] (-1628.995) (-1628.867) * [-1629.887] (-1629.542) (-1628.332) (-1628.197) -- 0:00:49 244500 -- (-1627.414) (-1629.940) [-1629.846] (-1630.832) * (-1629.160) (-1627.063) [-1626.871] (-1627.754) -- 0:00:49 245000 -- [-1625.906] (-1628.395) (-1632.096) (-1629.893) * (-1628.487) [-1630.579] (-1631.754) (-1632.625) -- 0:00:49 Average standard deviation of split frequencies: 0.009049 245500 -- (-1626.285) [-1631.609] (-1631.011) (-1632.073) * (-1626.841) [-1627.008] (-1628.989) (-1629.325) -- 0:00:49 246000 -- (-1628.661) [-1628.031] (-1631.262) (-1629.600) * (-1627.512) (-1627.583) (-1628.900) [-1627.901] -- 0:00:49 246500 -- (-1626.463) [-1628.013] (-1627.359) (-1629.716) * (-1629.060) (-1629.012) (-1629.109) [-1627.108] -- 0:00:48 247000 -- [-1629.027] (-1627.914) (-1627.174) (-1628.511) * (-1628.633) (-1628.497) (-1627.614) [-1626.591] -- 0:00:48 247500 -- (-1628.154) (-1627.711) [-1629.459] (-1630.725) * (-1629.042) [-1626.346] (-1626.951) (-1633.614) -- 0:00:48 248000 -- (-1627.732) (-1630.182) (-1628.303) [-1631.156] * (-1630.295) (-1627.792) (-1628.807) [-1628.450] -- 0:00:48 248500 -- (-1627.733) (-1629.439) [-1627.046] (-1628.254) * (-1629.572) [-1626.247] (-1626.789) (-1626.287) -- 0:00:48 249000 -- (-1627.338) [-1628.560] (-1626.884) (-1629.194) * (-1629.088) (-1626.367) [-1626.497] (-1627.507) -- 0:00:48 249500 -- (-1626.678) (-1629.285) (-1626.081) [-1626.252] * (-1627.727) (-1627.329) (-1629.002) [-1626.995] -- 0:00:48 250000 -- (-1626.017) (-1629.129) (-1626.429) [-1626.233] * (-1629.232) (-1626.166) (-1629.276) [-1628.441] -- 0:00:48 Average standard deviation of split frequencies: 0.009925 250500 -- (-1626.659) [-1627.071] (-1626.979) (-1628.334) * (-1627.260) (-1626.379) (-1629.012) [-1627.693] -- 0:00:50 251000 -- (-1626.406) (-1627.258) [-1628.260] (-1627.091) * (-1626.908) (-1626.336) [-1627.909] (-1627.805) -- 0:00:50 251500 -- (-1628.068) [-1628.194] (-1628.240) (-1627.006) * [-1628.897] (-1625.819) (-1630.768) (-1628.366) -- 0:00:50 252000 -- [-1628.309] (-1626.350) (-1628.424) (-1629.156) * [-1626.085] (-1626.239) (-1629.538) (-1627.955) -- 0:00:50 252500 -- (-1626.342) (-1625.767) (-1628.663) [-1628.672] * (-1627.946) [-1627.885] (-1626.927) (-1626.734) -- 0:00:50 253000 -- (-1625.710) [-1626.601] (-1630.252) (-1633.786) * [-1628.343] (-1633.219) (-1627.282) (-1627.849) -- 0:00:50 253500 -- (-1625.744) (-1626.582) [-1627.821] (-1632.957) * [-1627.741] (-1628.731) (-1626.534) (-1626.024) -- 0:00:50 254000 -- (-1627.102) (-1627.923) [-1630.872] (-1627.720) * (-1627.225) [-1626.524] (-1627.327) (-1626.606) -- 0:00:49 254500 -- (-1629.388) [-1628.334] (-1632.098) (-1627.113) * (-1633.909) (-1626.456) (-1627.078) [-1631.175] -- 0:00:49 255000 -- [-1627.715] (-1631.347) (-1631.642) (-1629.030) * (-1628.315) [-1627.432] (-1630.330) (-1630.909) -- 0:00:49 Average standard deviation of split frequencies: 0.008723 255500 -- (-1630.340) [-1627.141] (-1627.209) (-1627.742) * [-1628.988] (-1630.853) (-1628.486) (-1628.064) -- 0:00:49 256000 -- (-1630.425) (-1627.377) (-1627.832) [-1628.777] * (-1628.431) [-1627.925] (-1628.534) (-1627.596) -- 0:00:49 256500 -- [-1627.405] (-1628.327) (-1626.416) (-1628.577) * (-1629.555) [-1627.882] (-1628.343) (-1631.452) -- 0:00:49 257000 -- (-1628.012) [-1628.835] (-1628.333) (-1628.194) * (-1628.691) [-1626.944] (-1628.349) (-1629.804) -- 0:00:49 257500 -- (-1630.685) (-1628.582) [-1629.396] (-1627.378) * (-1631.200) [-1628.342] (-1628.410) (-1629.161) -- 0:00:49 258000 -- (-1629.885) (-1627.398) [-1628.369] (-1630.164) * (-1629.288) (-1628.977) (-1627.401) [-1630.038] -- 0:00:48 258500 -- (-1629.997) (-1628.292) [-1627.783] (-1629.077) * (-1629.538) (-1627.621) (-1627.381) [-1633.718] -- 0:00:48 259000 -- (-1628.015) (-1627.822) [-1627.892] (-1630.380) * [-1630.059] (-1630.236) (-1628.467) (-1630.516) -- 0:00:48 259500 -- (-1632.680) (-1628.357) (-1627.713) [-1627.017] * [-1631.316] (-1628.616) (-1632.225) (-1625.846) -- 0:00:48 260000 -- (-1629.449) (-1632.786) [-1626.751] (-1626.059) * [-1628.565] (-1627.538) (-1631.473) (-1626.181) -- 0:00:48 Average standard deviation of split frequencies: 0.006948 260500 -- (-1628.098) [-1628.041] (-1628.901) (-1629.048) * (-1627.331) [-1628.023] (-1627.938) (-1627.472) -- 0:00:48 261000 -- (-1630.328) [-1628.833] (-1625.976) (-1627.251) * [-1628.606] (-1627.308) (-1630.124) (-1627.671) -- 0:00:48 261500 -- [-1628.658] (-1627.940) (-1630.627) (-1629.629) * (-1628.373) (-1627.535) [-1626.957] (-1629.073) -- 0:00:48 262000 -- [-1626.300] (-1627.927) (-1630.598) (-1632.348) * (-1627.100) (-1626.813) (-1627.996) [-1626.607] -- 0:00:47 262500 -- [-1628.365] (-1627.496) (-1626.583) (-1634.360) * (-1627.692) (-1628.857) (-1627.354) [-1626.310] -- 0:00:47 263000 -- (-1631.049) [-1632.262] (-1626.276) (-1631.690) * (-1626.908) (-1626.365) (-1630.471) [-1629.982] -- 0:00:47 263500 -- (-1627.196) (-1632.752) (-1627.651) [-1628.908] * (-1629.045) [-1634.691] (-1633.333) (-1627.982) -- 0:00:47 264000 -- (-1627.196) [-1628.556] (-1627.990) (-1627.035) * (-1626.936) [-1628.450] (-1630.773) (-1627.665) -- 0:00:47 264500 -- (-1629.951) [-1628.094] (-1631.266) (-1628.122) * [-1626.230] (-1627.160) (-1629.581) (-1628.605) -- 0:00:47 265000 -- [-1630.334] (-1633.245) (-1633.579) (-1629.017) * (-1629.700) (-1627.169) [-1631.762] (-1627.772) -- 0:00:47 Average standard deviation of split frequencies: 0.007835 265500 -- (-1629.325) [-1630.855] (-1631.546) (-1628.304) * (-1628.675) [-1626.413] (-1630.082) (-1628.922) -- 0:00:47 266000 -- (-1628.698) (-1630.704) [-1631.501] (-1628.130) * (-1629.980) [-1627.163] (-1629.899) (-1628.464) -- 0:00:46 266500 -- (-1628.696) (-1625.627) [-1626.039] (-1626.781) * [-1626.906] (-1627.294) (-1630.047) (-1627.927) -- 0:00:49 267000 -- (-1628.590) (-1626.864) (-1629.477) [-1625.834] * (-1627.311) (-1629.417) [-1628.035] (-1626.904) -- 0:00:49 267500 -- [-1627.683] (-1626.511) (-1626.998) (-1626.696) * (-1627.158) (-1630.524) (-1626.311) [-1626.989] -- 0:00:49 268000 -- (-1626.960) (-1626.830) [-1628.028] (-1629.994) * (-1632.572) (-1631.221) [-1628.016] (-1626.271) -- 0:00:49 268500 -- (-1628.911) (-1626.585) (-1627.446) [-1628.513] * [-1630.148] (-1630.829) (-1630.736) (-1627.305) -- 0:00:49 269000 -- [-1628.921] (-1627.288) (-1628.341) (-1629.739) * (-1630.070) [-1627.862] (-1631.770) (-1628.371) -- 0:00:48 269500 -- [-1628.782] (-1629.685) (-1626.680) (-1630.029) * (-1630.903) (-1628.023) (-1630.571) [-1627.530] -- 0:00:48 270000 -- (-1626.684) (-1627.752) [-1625.863] (-1630.502) * [-1627.923] (-1629.715) (-1628.325) (-1628.288) -- 0:00:48 Average standard deviation of split frequencies: 0.008800 270500 -- [-1626.709] (-1626.425) (-1626.207) (-1627.655) * (-1628.190) (-1626.679) (-1628.635) [-1626.413] -- 0:00:48 271000 -- (-1628.475) (-1630.818) [-1626.196] (-1627.909) * (-1629.364) (-1626.838) (-1629.784) [-1629.363] -- 0:00:48 271500 -- (-1627.119) (-1631.030) [-1625.893] (-1627.404) * (-1628.520) (-1627.432) (-1627.486) [-1629.971] -- 0:00:48 272000 -- (-1627.116) (-1630.103) (-1626.984) [-1627.255] * [-1630.040] (-1626.811) (-1627.163) (-1627.023) -- 0:00:48 272500 -- [-1627.134] (-1629.168) (-1628.368) (-1628.820) * [-1631.041] (-1626.856) (-1627.000) (-1628.967) -- 0:00:48 273000 -- (-1628.124) (-1626.499) [-1632.058] (-1628.274) * (-1629.332) (-1626.076) (-1626.014) [-1626.767] -- 0:00:47 273500 -- (-1629.094) (-1627.627) (-1629.429) [-1629.756] * [-1627.607] (-1631.996) (-1627.622) (-1627.589) -- 0:00:47 274000 -- (-1629.230) (-1625.893) [-1628.875] (-1630.678) * (-1628.402) [-1627.540] (-1625.953) (-1627.449) -- 0:00:47 274500 -- (-1634.539) (-1626.122) (-1628.826) [-1628.802] * (-1627.742) (-1630.653) [-1627.505] (-1627.949) -- 0:00:47 275000 -- (-1632.772) [-1627.586] (-1631.421) (-1628.611) * [-1629.991] (-1630.933) (-1627.938) (-1628.226) -- 0:00:47 Average standard deviation of split frequencies: 0.009259 275500 -- [-1629.650] (-1629.544) (-1627.923) (-1632.985) * (-1626.561) [-1630.836] (-1628.582) (-1631.390) -- 0:00:47 276000 -- (-1626.702) (-1628.600) (-1626.799) [-1628.004] * (-1629.660) [-1627.065] (-1636.095) (-1630.224) -- 0:00:47 276500 -- (-1626.696) (-1628.081) [-1626.727] (-1626.166) * (-1630.368) [-1627.916] (-1627.272) (-1629.328) -- 0:00:47 277000 -- (-1626.829) (-1626.241) (-1627.703) [-1626.844] * (-1628.716) (-1633.717) (-1627.288) [-1632.493] -- 0:00:46 277500 -- (-1627.170) (-1625.957) (-1627.546) [-1626.471] * (-1628.263) [-1629.264] (-1626.165) (-1629.854) -- 0:00:46 278000 -- (-1629.987) (-1627.091) (-1626.266) [-1627.561] * (-1633.523) (-1627.288) (-1628.126) [-1629.203] -- 0:00:46 278500 -- (-1630.013) (-1627.023) (-1626.267) [-1628.386] * [-1627.260] (-1630.782) (-1630.888) (-1632.698) -- 0:00:46 279000 -- (-1625.653) (-1626.236) [-1626.622] (-1630.132) * [-1626.185] (-1631.652) (-1628.414) (-1633.883) -- 0:00:46 279500 -- [-1626.481] (-1628.333) (-1628.877) (-1628.644) * (-1626.707) (-1632.811) (-1629.099) [-1629.770] -- 0:00:46 280000 -- (-1627.579) (-1629.031) (-1629.087) [-1627.172] * (-1627.053) (-1630.349) [-1626.331] (-1627.247) -- 0:00:46 Average standard deviation of split frequencies: 0.007691 280500 -- [-1627.003] (-1627.827) (-1627.680) (-1628.834) * (-1628.413) (-1626.787) (-1626.628) [-1627.911] -- 0:00:46 281000 -- (-1626.854) (-1629.952) (-1629.007) [-1626.663] * (-1628.995) (-1627.119) [-1632.773] (-1627.561) -- 0:00:46 281500 -- (-1629.097) (-1635.919) (-1626.959) [-1628.098] * [-1628.684] (-1627.102) (-1627.002) (-1628.762) -- 0:00:45 282000 -- (-1627.796) (-1631.722) (-1626.340) [-1627.319] * [-1627.270] (-1626.984) (-1627.294) (-1627.099) -- 0:00:48 282500 -- [-1627.154] (-1629.162) (-1627.047) (-1627.656) * (-1628.170) [-1626.526] (-1627.577) (-1626.348) -- 0:00:48 283000 -- (-1630.421) (-1626.556) [-1628.768] (-1626.878) * [-1628.006] (-1627.449) (-1628.195) (-1626.908) -- 0:00:48 283500 -- (-1633.521) [-1629.029] (-1629.807) (-1627.630) * (-1631.144) [-1629.081] (-1628.717) (-1626.569) -- 0:00:48 284000 -- (-1626.143) [-1629.663] (-1631.448) (-1626.491) * (-1627.917) [-1626.301] (-1627.918) (-1626.819) -- 0:00:47 284500 -- (-1626.077) (-1628.302) (-1633.071) [-1626.088] * (-1627.142) (-1627.427) [-1627.159] (-1626.908) -- 0:00:47 285000 -- (-1627.718) (-1628.455) (-1629.613) [-1629.093] * [-1627.266] (-1629.434) (-1627.456) (-1626.924) -- 0:00:47 Average standard deviation of split frequencies: 0.007808 285500 -- [-1629.613] (-1629.846) (-1629.529) (-1629.367) * (-1627.069) (-1626.738) [-1626.379] (-1626.349) -- 0:00:47 286000 -- (-1632.861) [-1630.985] (-1633.027) (-1627.056) * (-1627.584) (-1626.821) (-1626.756) [-1628.731] -- 0:00:47 286500 -- (-1629.291) (-1630.933) [-1635.521] (-1630.351) * (-1629.982) (-1626.460) (-1627.272) [-1628.668] -- 0:00:47 287000 -- [-1628.186] (-1631.311) (-1635.146) (-1627.378) * (-1627.635) [-1627.497] (-1627.689) (-1626.721) -- 0:00:47 287500 -- [-1625.627] (-1629.619) (-1631.220) (-1628.375) * (-1626.943) (-1627.286) [-1628.818] (-1626.247) -- 0:00:47 288000 -- [-1626.573] (-1631.381) (-1627.584) (-1630.000) * (-1629.576) (-1628.486) [-1630.409] (-1626.657) -- 0:00:46 288500 -- (-1627.296) (-1629.827) [-1627.132] (-1625.939) * [-1628.357] (-1629.358) (-1628.251) (-1626.484) -- 0:00:46 289000 -- [-1626.478] (-1627.441) (-1628.046) (-1625.870) * [-1628.896] (-1629.634) (-1627.970) (-1630.425) -- 0:00:46 289500 -- [-1626.449] (-1626.324) (-1628.046) (-1627.112) * (-1626.057) (-1629.172) [-1627.510] (-1629.915) -- 0:00:46 290000 -- (-1625.867) [-1627.353] (-1628.876) (-1627.660) * (-1629.209) (-1628.545) [-1626.105] (-1632.523) -- 0:00:46 Average standard deviation of split frequencies: 0.008536 290500 -- (-1626.428) [-1626.501] (-1627.263) (-1626.874) * (-1628.352) (-1628.453) (-1629.473) [-1629.567] -- 0:00:46 291000 -- (-1627.762) [-1627.021] (-1628.354) (-1626.972) * (-1627.378) (-1630.512) (-1629.559) [-1629.831] -- 0:00:46 291500 -- (-1626.654) (-1627.276) (-1626.805) [-1627.370] * [-1626.585] (-1630.305) (-1627.884) (-1630.320) -- 0:00:46 292000 -- [-1627.055] (-1627.473) (-1627.063) (-1626.702) * [-1628.992] (-1627.291) (-1626.013) (-1628.563) -- 0:00:46 292500 -- (-1627.651) (-1626.807) (-1627.516) [-1628.379] * (-1627.978) (-1626.575) (-1626.013) [-1627.003] -- 0:00:45 293000 -- (-1630.636) (-1628.054) (-1629.552) [-1628.526] * (-1628.190) (-1627.598) [-1625.843] (-1627.319) -- 0:00:45 293500 -- (-1628.413) [-1627.903] (-1627.678) (-1627.331) * (-1626.707) (-1628.166) (-1626.249) [-1628.546] -- 0:00:45 294000 -- (-1630.088) [-1628.200] (-1626.605) (-1626.802) * (-1626.328) (-1630.717) [-1626.532] (-1626.701) -- 0:00:45 294500 -- [-1627.127] (-1630.320) (-1628.469) (-1626.610) * [-1627.764] (-1628.940) (-1627.737) (-1626.687) -- 0:00:45 295000 -- (-1627.703) (-1628.904) [-1627.760] (-1627.327) * (-1629.744) (-1631.590) (-1629.159) [-1629.331] -- 0:00:45 Average standard deviation of split frequencies: 0.009462 295500 -- (-1629.479) (-1629.466) [-1629.335] (-1627.642) * (-1628.014) (-1626.351) (-1632.955) [-1627.711] -- 0:00:45 296000 -- (-1637.757) [-1628.626] (-1632.979) (-1628.333) * (-1627.065) (-1627.334) [-1629.518] (-1626.366) -- 0:00:45 296500 -- (-1629.646) (-1627.799) [-1627.315] (-1626.615) * (-1626.788) (-1629.540) [-1629.863] (-1626.947) -- 0:00:45 297000 -- (-1629.612) (-1631.597) [-1627.240] (-1626.617) * [-1627.988] (-1629.618) (-1629.609) (-1627.488) -- 0:00:44 297500 -- (-1629.567) (-1630.339) [-1627.797] (-1627.615) * (-1630.026) [-1632.673] (-1628.110) (-1627.809) -- 0:00:44 298000 -- (-1627.574) (-1628.249) [-1627.472] (-1628.966) * (-1627.463) (-1627.037) (-1629.296) [-1625.865] -- 0:00:47 298500 -- (-1628.530) (-1629.042) (-1631.228) [-1631.018] * (-1627.401) (-1627.798) (-1627.826) [-1626.332] -- 0:00:47 299000 -- (-1629.384) (-1627.655) (-1629.473) [-1627.349] * (-1627.435) (-1627.934) [-1627.324] (-1627.469) -- 0:00:46 299500 -- (-1627.364) (-1627.351) [-1627.930] (-1627.679) * (-1626.096) (-1627.940) [-1628.195] (-1626.896) -- 0:00:46 300000 -- (-1629.247) [-1627.601] (-1628.946) (-1626.994) * [-1626.287] (-1626.906) (-1627.906) (-1628.940) -- 0:00:46 Average standard deviation of split frequencies: 0.009223 300500 -- [-1630.853] (-1630.614) (-1627.312) (-1628.177) * (-1626.889) (-1629.016) (-1625.873) [-1627.957] -- 0:00:46 301000 -- (-1628.239) [-1626.946] (-1629.030) (-1630.194) * (-1626.352) (-1628.534) (-1627.518) [-1628.993] -- 0:00:46 301500 -- (-1627.762) (-1626.521) [-1629.537] (-1626.919) * (-1626.399) (-1628.693) (-1630.281) [-1626.697] -- 0:00:46 302000 -- (-1628.545) (-1632.638) [-1629.621] (-1626.442) * (-1626.058) (-1628.431) (-1633.148) [-1629.293] -- 0:00:46 302500 -- (-1629.536) [-1626.978] (-1629.701) (-1627.219) * (-1626.058) [-1630.244] (-1626.804) (-1628.067) -- 0:00:46 303000 -- [-1625.880] (-1626.355) (-1629.792) (-1626.889) * (-1627.962) [-1628.184] (-1626.589) (-1632.567) -- 0:00:46 303500 -- (-1626.026) (-1627.981) (-1625.870) [-1625.882] * [-1626.473] (-1629.552) (-1626.700) (-1629.632) -- 0:00:45 304000 -- (-1630.201) (-1627.087) [-1627.891] (-1626.718) * [-1630.871] (-1626.462) (-1626.443) (-1630.889) -- 0:00:45 304500 -- [-1626.414] (-1628.977) (-1632.610) (-1626.965) * (-1627.821) (-1627.778) [-1629.973] (-1629.820) -- 0:00:45 305000 -- (-1626.446) (-1629.125) (-1629.342) [-1626.484] * (-1627.129) (-1627.090) [-1626.285] (-1629.909) -- 0:00:45 Average standard deviation of split frequencies: 0.010421 305500 -- (-1627.977) [-1631.261] (-1629.290) (-1632.474) * (-1627.148) (-1627.179) [-1627.580] (-1629.140) -- 0:00:45 306000 -- (-1629.342) (-1626.989) [-1628.731] (-1627.213) * [-1627.644] (-1628.623) (-1626.401) (-1628.176) -- 0:00:45 306500 -- [-1627.660] (-1627.247) (-1629.213) (-1627.929) * (-1626.985) (-1628.000) [-1625.862] (-1627.544) -- 0:00:45 307000 -- (-1627.351) (-1630.698) [-1626.880] (-1628.005) * (-1629.191) [-1626.461] (-1626.483) (-1629.124) -- 0:00:45 307500 -- (-1629.346) [-1629.121] (-1626.879) (-1627.564) * (-1633.025) (-1627.478) (-1627.282) [-1629.086] -- 0:00:45 308000 -- (-1630.319) (-1628.683) [-1628.892] (-1626.380) * [-1628.462] (-1626.221) (-1627.635) (-1627.337) -- 0:00:44 308500 -- (-1628.617) (-1627.266) (-1627.649) [-1628.167] * (-1629.515) (-1626.994) [-1626.816] (-1630.817) -- 0:00:44 309000 -- (-1627.663) (-1627.607) [-1629.894] (-1628.405) * (-1628.466) (-1627.079) (-1630.226) [-1628.807] -- 0:00:44 309500 -- [-1629.399] (-1627.905) (-1627.066) (-1626.760) * [-1628.446] (-1628.315) (-1626.782) (-1628.459) -- 0:00:44 310000 -- (-1628.465) (-1632.535) [-1628.515] (-1627.147) * [-1628.602] (-1628.685) (-1626.795) (-1630.294) -- 0:00:44 Average standard deviation of split frequencies: 0.009818 310500 -- (-1629.899) [-1626.651] (-1627.940) (-1629.996) * (-1632.285) (-1628.125) [-1629.748] (-1628.840) -- 0:00:44 311000 -- (-1627.884) (-1627.919) (-1627.409) [-1630.223] * (-1629.550) (-1628.398) (-1628.376) [-1628.578] -- 0:00:44 311500 -- [-1629.469] (-1630.901) (-1625.810) (-1627.613) * (-1627.854) (-1627.366) [-1628.359] (-1627.474) -- 0:00:44 312000 -- (-1627.972) (-1630.849) [-1625.810] (-1627.045) * (-1630.837) [-1627.289] (-1629.787) (-1625.918) -- 0:00:44 312500 -- (-1627.332) (-1628.328) [-1628.457] (-1629.578) * (-1630.621) (-1628.020) (-1629.887) [-1625.596] -- 0:00:44 313000 -- (-1626.031) [-1626.887] (-1629.942) (-1631.035) * (-1630.257) (-1627.879) [-1627.467] (-1625.784) -- 0:00:43 313500 -- [-1629.060] (-1627.408) (-1626.296) (-1628.933) * (-1628.444) [-1626.811] (-1627.658) (-1630.834) -- 0:00:43 314000 -- (-1629.191) (-1627.267) [-1627.162] (-1627.911) * (-1626.309) (-1627.691) (-1628.400) [-1628.375] -- 0:00:45 314500 -- (-1629.834) (-1629.641) [-1627.854] (-1628.209) * [-1626.297] (-1631.975) (-1628.484) (-1628.776) -- 0:00:45 315000 -- (-1631.035) [-1627.498] (-1626.691) (-1626.037) * (-1626.640) [-1626.640] (-1630.486) (-1628.001) -- 0:00:45 Average standard deviation of split frequencies: 0.009653 315500 -- (-1628.072) (-1627.640) (-1627.588) [-1627.381] * (-1627.004) (-1626.675) (-1628.244) [-1627.945] -- 0:00:45 316000 -- (-1629.399) [-1628.192] (-1626.631) (-1628.915) * (-1626.290) (-1628.027) (-1627.544) [-1625.961] -- 0:00:45 316500 -- (-1629.196) (-1632.145) [-1627.400] (-1628.108) * (-1630.837) (-1627.842) [-1626.384] (-1625.961) -- 0:00:45 317000 -- [-1627.547] (-1628.891) (-1628.607) (-1629.590) * (-1629.990) [-1627.598] (-1629.446) (-1626.215) -- 0:00:45 317500 -- (-1632.321) [-1627.473] (-1627.679) (-1629.869) * [-1627.224] (-1627.970) (-1629.384) (-1630.328) -- 0:00:45 318000 -- (-1627.470) (-1629.029) (-1627.497) [-1626.575] * (-1628.228) (-1629.338) (-1627.258) [-1628.996] -- 0:00:45 318500 -- (-1628.263) (-1628.574) [-1627.384] (-1629.606) * [-1627.889] (-1631.415) (-1627.585) (-1629.034) -- 0:00:44 319000 -- [-1629.424] (-1632.324) (-1627.096) (-1630.127) * [-1628.977] (-1628.790) (-1630.642) (-1627.780) -- 0:00:44 319500 -- [-1629.470] (-1626.946) (-1633.086) (-1628.193) * (-1632.369) (-1626.447) (-1630.478) [-1626.957] -- 0:00:44 320000 -- (-1629.076) (-1627.921) [-1633.015] (-1631.676) * (-1628.927) [-1628.239] (-1634.942) (-1627.557) -- 0:00:44 Average standard deviation of split frequencies: 0.008561 320500 -- [-1629.648] (-1627.032) (-1626.918) (-1629.309) * [-1627.863] (-1627.833) (-1632.472) (-1627.876) -- 0:00:44 321000 -- [-1629.185] (-1630.148) (-1628.519) (-1626.350) * (-1627.424) [-1629.634] (-1628.904) (-1628.995) -- 0:00:44 321500 -- (-1633.768) (-1629.799) (-1627.608) [-1628.559] * (-1626.844) (-1629.277) [-1628.806] (-1628.929) -- 0:00:44 322000 -- (-1629.624) (-1626.443) [-1628.997] (-1629.055) * (-1628.857) (-1631.046) [-1626.893] (-1628.969) -- 0:00:44 322500 -- [-1626.947] (-1626.443) (-1626.496) (-1633.706) * (-1630.572) [-1629.824] (-1629.527) (-1630.796) -- 0:00:44 323000 -- [-1628.752] (-1627.482) (-1626.546) (-1629.200) * (-1628.166) (-1631.374) (-1626.483) [-1626.545] -- 0:00:44 323500 -- (-1627.266) [-1628.809] (-1626.233) (-1628.586) * (-1631.432) (-1631.648) [-1627.000] (-1626.682) -- 0:00:43 324000 -- [-1627.335] (-1629.822) (-1629.759) (-1628.551) * (-1629.469) (-1627.284) (-1627.053) [-1631.035] -- 0:00:43 324500 -- (-1627.338) (-1627.551) (-1628.734) [-1626.539] * (-1629.464) [-1626.108] (-1627.094) (-1629.741) -- 0:00:43 325000 -- [-1627.001] (-1627.198) (-1626.482) (-1626.633) * [-1626.753] (-1630.718) (-1626.392) (-1626.826) -- 0:00:43 Average standard deviation of split frequencies: 0.007145 325500 -- (-1627.257) (-1633.430) (-1625.909) [-1626.868] * (-1626.955) [-1627.289] (-1631.333) (-1628.379) -- 0:00:43 326000 -- (-1627.474) [-1627.231] (-1625.966) (-1626.263) * [-1625.966] (-1626.787) (-1631.608) (-1629.063) -- 0:00:43 326500 -- (-1628.666) (-1629.908) (-1625.984) [-1626.110] * [-1628.089] (-1626.812) (-1631.500) (-1630.608) -- 0:00:43 327000 -- (-1628.556) [-1629.991] (-1626.198) (-1626.193) * [-1627.605] (-1628.118) (-1626.617) (-1629.249) -- 0:00:43 327500 -- (-1627.547) (-1632.107) (-1631.047) [-1626.527] * (-1627.145) (-1627.789) (-1628.163) [-1628.877] -- 0:00:43 328000 -- (-1627.583) (-1634.419) [-1626.679] (-1627.758) * (-1626.571) (-1630.593) (-1627.781) [-1627.129] -- 0:00:43 328500 -- (-1628.664) (-1635.722) [-1627.877] (-1628.662) * (-1627.491) (-1626.356) [-1626.413] (-1628.090) -- 0:00:42 329000 -- [-1628.025] (-1633.783) (-1627.647) (-1626.520) * (-1627.108) (-1626.356) (-1626.565) [-1629.442] -- 0:00:42 329500 -- (-1629.123) (-1629.927) (-1627.566) [-1627.968] * [-1628.225] (-1628.004) (-1632.667) (-1628.393) -- 0:00:44 330000 -- [-1627.744] (-1626.840) (-1628.608) (-1627.408) * (-1629.791) (-1627.312) (-1627.438) [-1628.695] -- 0:00:44 Average standard deviation of split frequencies: 0.006457 330500 -- (-1626.906) [-1626.622] (-1628.735) (-1628.141) * [-1628.117] (-1626.860) (-1628.410) (-1627.606) -- 0:00:44 331000 -- (-1626.908) (-1625.892) [-1627.193] (-1630.957) * (-1627.544) (-1628.316) [-1627.577] (-1627.030) -- 0:00:44 331500 -- (-1626.233) (-1627.564) [-1627.352] (-1629.715) * (-1627.594) (-1626.178) (-1628.205) [-1626.425] -- 0:00:44 332000 -- [-1626.233] (-1630.324) (-1627.717) (-1627.785) * (-1627.018) (-1626.919) (-1630.800) [-1628.475] -- 0:00:44 332500 -- (-1626.874) (-1628.300) (-1626.047) [-1626.356] * (-1627.043) [-1626.586] (-1637.393) (-1627.521) -- 0:00:44 333000 -- (-1629.128) [-1628.644] (-1626.615) (-1626.661) * (-1629.291) [-1627.854] (-1633.597) (-1627.794) -- 0:00:44 333500 -- (-1629.304) [-1627.845] (-1626.602) (-1626.735) * [-1626.520] (-1628.242) (-1627.239) (-1628.715) -- 0:00:43 334000 -- (-1627.771) (-1626.646) [-1627.495] (-1628.089) * [-1628.625] (-1627.345) (-1631.907) (-1628.429) -- 0:00:43 334500 -- [-1627.878] (-1625.757) (-1627.002) (-1628.814) * (-1629.073) [-1627.510] (-1627.685) (-1627.593) -- 0:00:43 335000 -- [-1627.885] (-1629.488) (-1627.605) (-1628.533) * (-1627.383) (-1627.538) (-1626.967) [-1627.553] -- 0:00:43 Average standard deviation of split frequencies: 0.006272 335500 -- (-1626.760) (-1627.162) [-1628.089] (-1628.595) * (-1627.253) (-1627.513) [-1634.825] (-1627.406) -- 0:00:43 336000 -- (-1627.724) (-1630.946) [-1627.752] (-1628.623) * (-1627.041) (-1626.045) [-1630.688] (-1626.058) -- 0:00:43 336500 -- (-1627.788) (-1627.515) [-1626.080] (-1629.188) * (-1626.860) [-1628.940] (-1627.573) (-1627.603) -- 0:00:43 337000 -- (-1626.952) [-1626.129] (-1628.035) (-1632.710) * [-1626.340] (-1633.057) (-1626.330) (-1626.927) -- 0:00:43 337500 -- (-1633.428) (-1626.845) [-1629.259] (-1629.768) * (-1626.247) (-1633.908) [-1627.755] (-1627.630) -- 0:00:43 338000 -- (-1628.556) [-1629.272] (-1629.258) (-1626.928) * (-1629.144) (-1630.297) [-1629.640] (-1626.552) -- 0:00:43 338500 -- (-1628.301) (-1629.391) (-1625.948) [-1625.935] * (-1625.946) (-1629.821) (-1631.114) [-1627.575] -- 0:00:42 339000 -- (-1627.856) (-1629.688) (-1629.167) [-1625.945] * (-1626.532) [-1629.252] (-1628.426) (-1627.902) -- 0:00:42 339500 -- (-1627.608) (-1628.647) [-1629.871] (-1625.928) * (-1627.408) [-1632.257] (-1629.322) (-1627.278) -- 0:00:42 340000 -- [-1628.035] (-1628.151) (-1629.265) (-1627.304) * (-1627.330) (-1627.647) [-1628.272] (-1626.887) -- 0:00:42 Average standard deviation of split frequencies: 0.006268 340500 -- [-1629.983] (-1628.583) (-1628.234) (-1626.229) * (-1630.657) [-1628.655] (-1628.537) (-1626.656) -- 0:00:42 341000 -- (-1630.551) (-1626.065) (-1626.308) [-1627.692] * (-1628.805) [-1627.656] (-1627.777) (-1626.372) -- 0:00:42 341500 -- (-1626.938) (-1630.635) [-1626.384] (-1627.351) * (-1630.984) (-1627.654) (-1628.160) [-1625.975] -- 0:00:42 342000 -- (-1631.631) [-1627.793] (-1628.014) (-1627.644) * (-1630.782) (-1627.654) (-1627.223) [-1626.664] -- 0:00:42 342500 -- (-1640.588) [-1629.802] (-1628.285) (-1626.195) * [-1626.928] (-1625.976) (-1626.106) (-1626.748) -- 0:00:42 343000 -- (-1629.231) (-1629.177) [-1628.064] (-1629.290) * [-1629.623] (-1625.955) (-1625.997) (-1627.887) -- 0:00:42 343500 -- (-1627.060) [-1627.064] (-1627.080) (-1628.380) * (-1634.832) (-1626.035) (-1626.708) [-1627.419] -- 0:00:42 344000 -- [-1627.831] (-1634.519) (-1627.161) (-1627.837) * (-1635.121) (-1626.025) (-1626.708) [-1626.194] -- 0:00:41 344500 -- (-1628.090) (-1627.805) (-1627.163) [-1626.500] * (-1630.353) (-1627.298) (-1631.046) [-1626.999] -- 0:00:41 345000 -- [-1626.468] (-1628.371) (-1628.643) (-1627.858) * (-1629.370) [-1627.103] (-1626.718) (-1629.979) -- 0:00:41 Average standard deviation of split frequencies: 0.006572 345500 -- (-1627.028) [-1628.314] (-1628.251) (-1627.541) * (-1629.960) [-1628.086] (-1626.717) (-1627.817) -- 0:00:43 346000 -- [-1627.216] (-1626.569) (-1631.266) (-1626.060) * (-1629.136) (-1627.542) [-1627.271] (-1626.885) -- 0:00:43 346500 -- (-1629.421) [-1627.941] (-1627.545) (-1627.663) * (-1630.819) [-1626.800] (-1628.769) (-1629.405) -- 0:00:43 347000 -- [-1627.305] (-1629.677) (-1628.528) (-1631.416) * (-1632.624) [-1628.165] (-1626.518) (-1628.560) -- 0:00:43 347500 -- (-1626.633) (-1628.681) (-1628.506) [-1628.795] * [-1630.761] (-1626.960) (-1628.129) (-1627.631) -- 0:00:43 348000 -- (-1628.291) (-1627.025) [-1630.668] (-1632.551) * [-1630.575] (-1626.895) (-1626.994) (-1627.301) -- 0:00:43 348500 -- [-1627.081] (-1631.110) (-1627.637) (-1629.861) * (-1629.769) (-1634.220) [-1626.385] (-1627.210) -- 0:00:42 349000 -- (-1628.013) (-1630.563) (-1629.908) [-1630.135] * (-1627.913) (-1627.308) (-1627.158) [-1629.317] -- 0:00:42 349500 -- [-1627.714] (-1630.944) (-1627.540) (-1629.891) * (-1628.462) (-1626.864) (-1627.790) [-1627.298] -- 0:00:42 350000 -- (-1627.207) (-1626.694) [-1636.163] (-1630.609) * [-1627.788] (-1627.621) (-1627.711) (-1626.935) -- 0:00:42 Average standard deviation of split frequencies: 0.006959 350500 -- (-1626.904) (-1627.548) [-1628.754] (-1630.138) * (-1627.806) [-1626.261] (-1625.770) (-1626.981) -- 0:00:42 351000 -- (-1628.613) (-1629.548) (-1630.806) [-1630.771] * (-1626.846) (-1629.303) (-1627.029) [-1626.818] -- 0:00:42 351500 -- (-1630.788) (-1630.178) [-1628.531] (-1626.955) * (-1630.127) (-1630.848) [-1628.836] (-1627.976) -- 0:00:42 352000 -- (-1628.602) [-1629.436] (-1626.266) (-1630.990) * (-1626.624) (-1627.568) [-1629.621] (-1629.247) -- 0:00:42 352500 -- [-1626.826] (-1628.996) (-1628.087) (-1626.417) * (-1627.227) [-1627.528] (-1632.993) (-1629.434) -- 0:00:42 353000 -- [-1626.114] (-1631.371) (-1626.258) (-1626.182) * (-1628.636) [-1631.898] (-1626.053) (-1629.107) -- 0:00:42 353500 -- [-1626.672] (-1631.483) (-1627.195) (-1626.239) * [-1628.059] (-1634.987) (-1628.072) (-1631.510) -- 0:00:42 354000 -- (-1626.669) (-1629.518) [-1626.548] (-1628.745) * [-1626.527] (-1631.674) (-1628.360) (-1641.807) -- 0:00:41 354500 -- (-1627.228) (-1626.500) [-1633.484] (-1628.702) * (-1627.368) [-1628.473] (-1629.641) (-1647.683) -- 0:00:41 355000 -- [-1628.660] (-1626.366) (-1630.785) (-1627.145) * (-1627.382) (-1628.579) (-1628.994) [-1629.751] -- 0:00:41 Average standard deviation of split frequencies: 0.006465 355500 -- [-1627.807] (-1626.171) (-1630.195) (-1627.147) * (-1630.438) (-1628.553) [-1630.125] (-1627.458) -- 0:00:41 356000 -- [-1630.505] (-1627.434) (-1629.440) (-1626.212) * (-1627.031) (-1632.999) [-1627.925] (-1628.508) -- 0:00:41 356500 -- (-1632.520) [-1629.038] (-1630.098) (-1628.972) * [-1627.264] (-1628.183) (-1627.741) (-1626.062) -- 0:00:41 357000 -- [-1630.541] (-1626.643) (-1627.676) (-1629.936) * (-1628.033) (-1626.981) (-1628.270) [-1627.396] -- 0:00:41 357500 -- (-1628.551) [-1627.012] (-1628.412) (-1627.200) * [-1625.949] (-1626.927) (-1627.887) (-1627.119) -- 0:00:41 358000 -- (-1628.376) (-1629.535) (-1632.229) [-1627.476] * (-1628.807) (-1629.204) [-1627.793] (-1626.797) -- 0:00:41 358500 -- [-1626.916] (-1626.723) (-1628.263) (-1628.256) * (-1628.567) [-1629.135] (-1626.810) (-1626.152) -- 0:00:41 359000 -- (-1629.491) (-1626.769) (-1626.111) [-1628.592] * [-1628.623] (-1630.786) (-1627.437) (-1626.151) -- 0:00:41 359500 -- (-1627.961) (-1628.508) (-1628.612) [-1631.264] * (-1627.047) [-1629.996] (-1627.359) (-1627.277) -- 0:00:40 360000 -- (-1628.064) (-1627.206) (-1633.301) [-1626.932] * (-1630.840) (-1627.626) [-1628.815] (-1626.904) -- 0:00:40 Average standard deviation of split frequencies: 0.007612 360500 -- (-1628.558) (-1626.864) [-1630.342] (-1628.729) * (-1630.949) [-1626.843] (-1633.069) (-1628.157) -- 0:00:40 361000 -- (-1631.407) [-1632.054] (-1628.992) (-1627.582) * [-1626.681] (-1632.047) (-1633.936) (-1631.364) -- 0:00:40 361500 -- (-1628.235) [-1629.283] (-1626.452) (-1627.651) * [-1626.540] (-1628.740) (-1630.498) (-1629.975) -- 0:00:42 362000 -- [-1626.745] (-1631.092) (-1627.947) (-1626.392) * (-1628.503) [-1629.666] (-1629.949) (-1626.374) -- 0:00:42 362500 -- [-1627.294] (-1631.342) (-1629.878) (-1626.435) * (-1628.630) [-1627.869] (-1629.087) (-1626.523) -- 0:00:42 363000 -- [-1626.948] (-1626.853) (-1627.626) (-1626.454) * (-1630.741) [-1628.273] (-1630.867) (-1626.225) -- 0:00:42 363500 -- [-1627.993] (-1627.511) (-1628.558) (-1627.413) * (-1627.831) (-1627.839) [-1628.597] (-1626.585) -- 0:00:42 364000 -- (-1625.939) (-1628.974) [-1627.606] (-1627.292) * (-1627.407) [-1627.636] (-1630.649) (-1626.686) -- 0:00:41 364500 -- (-1626.247) [-1627.661] (-1625.854) (-1628.196) * (-1626.700) (-1630.991) (-1631.211) [-1626.628] -- 0:00:41 365000 -- [-1626.250] (-1625.947) (-1629.290) (-1627.869) * (-1627.973) (-1627.440) (-1632.684) [-1625.974] -- 0:00:41 Average standard deviation of split frequencies: 0.007576 365500 -- (-1633.709) [-1628.204] (-1632.456) (-1629.675) * (-1627.045) (-1627.822) [-1628.636] (-1625.709) -- 0:00:41 366000 -- [-1629.927] (-1627.752) (-1627.732) (-1631.087) * (-1630.998) (-1631.351) (-1627.807) [-1626.792] -- 0:00:41 366500 -- [-1630.213] (-1628.110) (-1631.087) (-1628.856) * [-1629.156] (-1630.891) (-1628.220) (-1626.619) -- 0:00:41 367000 -- (-1629.868) (-1628.272) (-1627.916) [-1629.597] * (-1630.217) (-1630.668) [-1630.261] (-1629.193) -- 0:00:41 367500 -- (-1627.516) [-1626.886] (-1629.912) (-1629.112) * [-1626.739] (-1631.697) (-1627.624) (-1627.299) -- 0:00:41 368000 -- [-1625.919] (-1626.930) (-1632.489) (-1628.911) * (-1626.610) [-1631.923] (-1627.723) (-1630.779) -- 0:00:41 368500 -- (-1626.093) (-1632.574) [-1629.541] (-1628.202) * (-1627.453) (-1627.426) [-1630.601] (-1627.122) -- 0:00:41 369000 -- [-1627.115] (-1629.885) (-1628.853) (-1627.382) * (-1627.720) [-1629.932] (-1628.794) (-1627.240) -- 0:00:41 369500 -- (-1626.561) (-1630.030) (-1629.054) [-1627.233] * (-1627.892) (-1629.577) [-1628.794] (-1626.209) -- 0:00:40 370000 -- (-1626.970) [-1629.324] (-1628.013) (-1631.446) * (-1631.688) (-1632.401) [-1626.619] (-1627.361) -- 0:00:40 Average standard deviation of split frequencies: 0.008154 370500 -- (-1625.952) [-1631.403] (-1626.973) (-1629.503) * [-1627.921] (-1628.865) (-1627.118) (-1627.280) -- 0:00:40 371000 -- [-1626.874] (-1627.709) (-1626.478) (-1630.402) * (-1627.122) (-1630.067) (-1629.228) [-1628.484] -- 0:00:40 371500 -- [-1625.904] (-1630.035) (-1629.641) (-1633.330) * (-1626.460) [-1630.838] (-1632.901) (-1630.818) -- 0:00:40 372000 -- (-1626.473) (-1626.825) [-1628.342] (-1628.916) * [-1625.908] (-1627.328) (-1632.622) (-1629.160) -- 0:00:40 372500 -- [-1626.045] (-1626.512) (-1630.316) (-1628.406) * (-1626.074) [-1629.895] (-1626.792) (-1629.699) -- 0:00:40 373000 -- (-1629.073) (-1625.881) [-1629.408] (-1628.060) * (-1627.229) [-1629.101] (-1626.667) (-1628.872) -- 0:00:40 373500 -- (-1630.408) (-1628.259) (-1627.806) [-1633.386] * (-1627.161) (-1632.241) [-1626.281] (-1630.141) -- 0:00:40 374000 -- (-1631.376) [-1629.639] (-1628.280) (-1627.646) * (-1626.540) (-1628.718) [-1626.393] (-1629.626) -- 0:00:40 374500 -- (-1627.501) [-1627.523] (-1630.554) (-1628.183) * [-1626.539] (-1627.237) (-1626.865) (-1631.051) -- 0:00:40 375000 -- [-1628.936] (-1627.134) (-1627.186) (-1629.045) * (-1626.753) (-1628.274) [-1626.585] (-1631.890) -- 0:00:40 Average standard deviation of split frequencies: 0.008112 375500 -- (-1628.911) (-1628.306) (-1627.447) [-1628.257] * [-1627.235] (-1628.217) (-1627.292) (-1626.935) -- 0:00:39 376000 -- (-1626.826) (-1629.578) [-1632.026] (-1628.679) * [-1629.380] (-1634.153) (-1629.512) (-1626.537) -- 0:00:39 376500 -- (-1629.869) (-1636.040) (-1629.007) [-1626.388] * (-1627.269) (-1632.373) (-1627.910) [-1626.833] -- 0:00:39 377000 -- (-1628.633) [-1627.979] (-1628.964) (-1631.241) * (-1626.773) (-1628.005) (-1628.512) [-1629.693] -- 0:00:41 377500 -- (-1629.022) (-1628.160) (-1628.424) [-1630.462] * [-1628.371] (-1629.085) (-1628.277) (-1628.610) -- 0:00:41 378000 -- (-1627.616) (-1631.755) (-1626.121) [-1629.162] * (-1631.639) (-1630.118) [-1626.804] (-1630.905) -- 0:00:41 378500 -- (-1629.236) (-1628.785) [-1627.216] (-1626.215) * (-1631.041) (-1630.213) [-1626.955] (-1627.153) -- 0:00:41 379000 -- (-1628.056) (-1628.533) [-1627.245] (-1627.336) * (-1632.475) [-1626.204] (-1627.040) (-1627.017) -- 0:00:40 379500 -- [-1626.385] (-1632.045) (-1627.397) (-1626.563) * (-1630.396) (-1627.064) (-1626.372) [-1632.657] -- 0:00:40 380000 -- [-1628.107] (-1626.828) (-1626.534) (-1627.114) * (-1627.473) (-1626.346) [-1626.579] (-1634.820) -- 0:00:40 Average standard deviation of split frequencies: 0.008377 380500 -- (-1629.620) (-1628.140) [-1626.632] (-1627.019) * [-1629.624] (-1628.225) (-1628.322) (-1628.032) -- 0:00:40 381000 -- [-1629.457] (-1627.990) (-1627.489) (-1628.078) * (-1630.827) (-1627.642) (-1629.642) [-1627.890] -- 0:00:40 381500 -- [-1628.021] (-1629.314) (-1627.128) (-1628.408) * (-1630.510) (-1626.396) (-1627.913) [-1629.473] -- 0:00:40 382000 -- (-1627.565) (-1629.363) [-1630.092] (-1630.576) * (-1633.626) (-1626.099) (-1626.640) [-1627.951] -- 0:00:40 382500 -- [-1628.149] (-1628.165) (-1629.824) (-1630.068) * (-1630.914) (-1628.234) [-1626.829] (-1628.446) -- 0:00:40 383000 -- (-1629.766) (-1630.206) (-1627.602) [-1627.753] * [-1628.469] (-1627.568) (-1626.020) (-1628.081) -- 0:00:40 383500 -- (-1629.221) (-1629.087) (-1627.032) [-1627.802] * (-1627.509) (-1628.801) [-1625.847] (-1627.553) -- 0:00:40 384000 -- (-1629.213) (-1629.087) (-1626.225) [-1626.751] * (-1627.943) [-1628.496] (-1629.003) (-1627.723) -- 0:00:40 384500 -- (-1629.046) (-1630.445) (-1626.792) [-1627.547] * [-1627.933] (-1628.225) (-1626.262) (-1627.826) -- 0:00:40 385000 -- [-1628.860] (-1631.274) (-1626.772) (-1627.798) * (-1626.864) (-1629.375) [-1628.037] (-1625.716) -- 0:00:39 Average standard deviation of split frequencies: 0.008477 385500 -- [-1627.358] (-1627.432) (-1626.652) (-1629.326) * (-1629.255) [-1627.071] (-1626.877) (-1626.021) -- 0:00:39 386000 -- (-1630.483) (-1627.763) [-1629.905] (-1626.674) * (-1632.291) (-1627.766) [-1626.714] (-1626.480) -- 0:00:39 386500 -- (-1627.388) (-1628.877) [-1629.113] (-1628.112) * (-1630.569) [-1629.723] (-1629.794) (-1627.098) -- 0:00:39 387000 -- (-1635.179) [-1628.959] (-1626.892) (-1628.892) * [-1629.272] (-1627.417) (-1629.692) (-1628.804) -- 0:00:39 387500 -- (-1631.542) [-1626.572] (-1626.696) (-1627.534) * (-1627.057) (-1628.185) [-1626.788] (-1628.412) -- 0:00:39 388000 -- (-1630.811) (-1630.685) (-1627.701) [-1626.069] * [-1627.097] (-1628.035) (-1628.992) (-1628.541) -- 0:00:39 388500 -- (-1634.568) [-1626.671] (-1628.594) (-1627.917) * (-1629.448) [-1628.210] (-1629.220) (-1631.043) -- 0:00:39 389000 -- (-1628.718) (-1626.877) (-1633.714) [-1627.799] * (-1626.390) (-1632.637) (-1629.298) [-1629.260] -- 0:00:39 389500 -- (-1625.875) (-1631.765) (-1631.487) [-1627.306] * (-1627.772) (-1630.596) (-1628.758) [-1628.034] -- 0:00:39 390000 -- (-1625.875) (-1626.566) (-1627.907) [-1626.373] * (-1627.324) (-1632.782) [-1628.316] (-1631.003) -- 0:00:39 Average standard deviation of split frequencies: 0.008376 390500 -- (-1626.230) (-1627.467) [-1626.850] (-1626.373) * (-1628.366) [-1634.066] (-1629.365) (-1629.560) -- 0:00:39 391000 -- (-1626.601) (-1628.784) [-1631.297] (-1628.686) * (-1627.495) (-1627.013) (-1630.593) [-1631.231] -- 0:00:38 391500 -- (-1628.300) [-1627.762] (-1630.908) (-1627.415) * (-1627.280) (-1626.807) [-1628.549] (-1632.349) -- 0:00:38 392000 -- (-1626.215) (-1629.123) [-1627.713] (-1627.391) * [-1626.977] (-1628.484) (-1627.121) (-1628.400) -- 0:00:38 392500 -- [-1628.109] (-1629.714) (-1633.747) (-1629.644) * (-1629.075) (-1630.672) (-1631.768) [-1628.165] -- 0:00:38 393000 -- (-1628.392) (-1627.515) [-1625.792] (-1630.382) * (-1629.734) (-1628.133) [-1629.612] (-1628.191) -- 0:00:40 393500 -- (-1630.164) (-1627.573) [-1627.182] (-1626.328) * (-1627.283) (-1628.284) [-1631.237] (-1627.711) -- 0:00:40 394000 -- (-1629.542) (-1628.065) (-1628.208) [-1627.944] * (-1628.535) (-1628.059) (-1628.494) [-1628.836] -- 0:00:39 394500 -- (-1630.313) (-1627.506) [-1629.127] (-1628.726) * (-1631.349) (-1626.199) (-1627.523) [-1626.341] -- 0:00:39 395000 -- (-1627.849) (-1628.308) (-1627.861) [-1625.869] * [-1626.938] (-1626.104) (-1629.163) (-1626.585) -- 0:00:39 Average standard deviation of split frequencies: 0.009173 395500 -- (-1628.101) [-1628.516] (-1627.512) (-1630.007) * (-1629.257) (-1627.489) (-1628.560) [-1627.236] -- 0:00:39 396000 -- [-1627.540] (-1630.737) (-1627.533) (-1630.947) * (-1634.020) (-1626.650) (-1629.586) [-1626.732] -- 0:00:39 396500 -- (-1628.358) (-1627.857) [-1627.120] (-1630.042) * [-1633.447] (-1628.771) (-1626.754) (-1629.019) -- 0:00:39 397000 -- (-1626.747) (-1628.117) [-1627.195] (-1629.376) * (-1629.103) (-1630.621) (-1627.040) [-1629.077] -- 0:00:39 397500 -- (-1627.628) [-1627.563] (-1626.844) (-1627.880) * (-1628.951) [-1626.190] (-1626.773) (-1630.336) -- 0:00:39 398000 -- (-1627.747) [-1629.081] (-1626.796) (-1626.830) * (-1627.296) (-1626.686) (-1628.327) [-1629.747] -- 0:00:39 398500 -- (-1628.202) (-1627.431) [-1628.183] (-1629.118) * (-1627.510) [-1625.693] (-1626.814) (-1629.085) -- 0:00:39 399000 -- (-1626.554) (-1627.604) (-1631.374) [-1627.825] * (-1628.086) [-1626.104] (-1630.988) (-1630.212) -- 0:00:39 399500 -- (-1627.437) (-1627.931) (-1627.489) [-1626.498] * (-1628.496) [-1627.553] (-1631.461) (-1630.151) -- 0:00:39 400000 -- (-1629.690) (-1627.249) [-1627.006] (-1627.417) * (-1626.643) (-1627.328) [-1632.500] (-1627.747) -- 0:00:39 Average standard deviation of split frequencies: 0.008236 400500 -- (-1628.280) (-1627.623) [-1629.419] (-1633.260) * (-1627.274) (-1627.325) (-1631.857) [-1627.251] -- 0:00:38 401000 -- (-1628.950) (-1626.141) [-1631.032] (-1628.900) * (-1626.464) (-1626.969) [-1629.130] (-1627.305) -- 0:00:38 401500 -- (-1626.377) [-1626.562] (-1631.638) (-1627.294) * (-1626.511) (-1626.969) (-1626.735) [-1627.254] -- 0:00:38 402000 -- (-1626.029) [-1627.452] (-1629.560) (-1628.354) * (-1629.049) (-1628.688) [-1626.412] (-1627.861) -- 0:00:38 402500 -- (-1626.165) (-1631.625) (-1627.431) [-1629.972] * (-1628.012) [-1627.667] (-1626.584) (-1629.443) -- 0:00:38 403000 -- (-1628.733) [-1628.139] (-1627.200) (-1628.586) * (-1629.343) (-1628.213) (-1626.883) [-1626.304] -- 0:00:38 403500 -- (-1627.778) [-1629.829] (-1627.885) (-1628.259) * (-1628.439) (-1626.902) [-1627.974] (-1625.850) -- 0:00:38 404000 -- (-1626.398) [-1627.033] (-1626.851) (-1628.833) * [-1627.946] (-1629.484) (-1628.570) (-1626.397) -- 0:00:38 404500 -- (-1628.775) (-1627.955) (-1626.039) [-1628.221] * [-1628.170] (-1633.383) (-1628.091) (-1630.366) -- 0:00:38 405000 -- [-1628.373] (-1628.560) (-1626.874) (-1628.776) * [-1627.089] (-1633.552) (-1628.531) (-1626.766) -- 0:00:38 Average standard deviation of split frequencies: 0.008264 405500 -- (-1628.708) [-1628.520] (-1626.700) (-1626.758) * (-1629.989) (-1630.494) (-1632.084) [-1627.398] -- 0:00:38 406000 -- (-1631.760) [-1628.946] (-1626.673) (-1630.341) * (-1629.787) (-1628.644) (-1627.724) [-1627.930] -- 0:00:38 406500 -- [-1629.459] (-1629.435) (-1629.085) (-1626.664) * (-1630.183) [-1627.329] (-1627.003) (-1627.930) -- 0:00:37 407000 -- (-1626.335) (-1630.136) (-1631.401) [-1631.472] * [-1627.378] (-1626.695) (-1629.639) (-1631.894) -- 0:00:37 407500 -- [-1626.109] (-1628.015) (-1627.105) (-1627.138) * (-1626.624) [-1628.100] (-1629.620) (-1631.894) -- 0:00:37 408000 -- (-1626.296) [-1626.979] (-1629.683) (-1627.532) * (-1626.657) (-1628.547) [-1628.813] (-1628.270) -- 0:00:37 408500 -- (-1625.946) (-1627.392) (-1629.934) [-1629.700] * (-1625.744) [-1626.364] (-1627.614) (-1632.056) -- 0:00:39 409000 -- [-1626.251] (-1626.237) (-1631.650) (-1627.565) * (-1626.126) (-1626.309) [-1627.194] (-1628.772) -- 0:00:39 409500 -- (-1628.562) (-1627.169) (-1630.327) [-1627.565] * (-1628.713) [-1632.872] (-1627.556) (-1626.537) -- 0:00:38 410000 -- (-1630.513) (-1630.894) [-1627.501] (-1627.449) * (-1628.981) [-1628.674] (-1629.284) (-1626.766) -- 0:00:38 Average standard deviation of split frequencies: 0.008778 410500 -- (-1629.410) (-1628.459) [-1627.712] (-1629.050) * [-1630.807] (-1628.503) (-1629.799) (-1628.271) -- 0:00:38 411000 -- (-1633.296) (-1629.095) (-1626.335) [-1628.408] * (-1627.924) [-1630.484] (-1630.697) (-1629.386) -- 0:00:38 411500 -- (-1629.293) [-1629.034] (-1626.718) (-1630.152) * (-1629.629) (-1631.574) (-1631.306) [-1627.603] -- 0:00:38 412000 -- (-1629.161) [-1628.066] (-1626.962) (-1630.293) * (-1626.992) [-1626.247] (-1628.827) (-1627.877) -- 0:00:38 412500 -- [-1628.458] (-1629.497) (-1626.055) (-1628.009) * (-1627.466) (-1628.224) [-1629.852] (-1627.618) -- 0:00:38 413000 -- (-1627.091) [-1629.042] (-1626.055) (-1626.309) * (-1627.065) [-1626.023] (-1631.246) (-1626.658) -- 0:00:38 413500 -- (-1627.015) (-1626.779) [-1629.032] (-1625.874) * (-1628.129) (-1626.114) (-1629.262) [-1631.918] -- 0:00:38 414000 -- [-1626.328] (-1628.129) (-1628.080) (-1627.943) * [-1626.645] (-1626.306) (-1626.650) (-1627.387) -- 0:00:38 414500 -- [-1625.966] (-1632.572) (-1631.644) (-1628.920) * (-1626.729) [-1627.283] (-1627.338) (-1632.147) -- 0:00:38 415000 -- (-1626.306) (-1628.044) (-1628.989) [-1628.462] * (-1627.413) [-1627.689] (-1627.950) (-1628.112) -- 0:00:38 Average standard deviation of split frequencies: 0.007866 415500 -- (-1626.036) (-1627.998) (-1629.438) [-1630.697] * (-1627.709) (-1627.254) (-1630.946) [-1628.276] -- 0:00:37 416000 -- (-1626.391) (-1627.956) (-1629.377) [-1627.618] * (-1628.625) [-1627.762] (-1629.033) (-1627.303) -- 0:00:37 416500 -- (-1627.471) (-1626.722) (-1630.893) [-1628.082] * (-1632.192) (-1628.477) [-1629.934] (-1627.071) -- 0:00:37 417000 -- (-1627.360) (-1626.424) (-1628.856) [-1627.957] * (-1628.859) (-1628.584) (-1629.603) [-1627.677] -- 0:00:37 417500 -- (-1628.302) (-1630.361) (-1626.370) [-1628.757] * (-1628.292) (-1628.170) [-1632.790] (-1629.061) -- 0:00:37 418000 -- (-