--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:00:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/nrdH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -329.05 -331.88
2 -329.00 -332.56
--------------------------------------
TOTAL -329.02 -332.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891557 0.085386 0.350486 1.459238 0.867633 1424.90 1462.95 1.001
r(A<->C){all} 0.157155 0.018467 0.000018 0.434030 0.117488 96.76 210.91 1.000
r(A<->G){all} 0.174476 0.020801 0.000036 0.463031 0.137529 271.91 324.00 1.002
r(A<->T){all} 0.166482 0.020144 0.000092 0.453990 0.129377 163.98 290.16 1.000
r(C<->G){all} 0.165297 0.019253 0.000268 0.448381 0.127883 155.75 234.60 1.000
r(C<->T){all} 0.167980 0.018892 0.000092 0.438739 0.134653 163.22 242.05 1.000
r(G<->T){all} 0.168610 0.021558 0.000003 0.467380 0.126027 146.74 162.21 1.004
pi(A){all} 0.196822 0.000601 0.151634 0.248086 0.195785 1461.63 1481.32 1.001
pi(C){all} 0.286837 0.000843 0.230237 0.343309 0.286140 1351.64 1426.32 1.000
pi(G){all} 0.315853 0.000880 0.258217 0.374486 0.315785 1218.15 1290.05 1.000
pi(T){all} 0.200489 0.000633 0.149760 0.249912 0.200118 1147.13 1221.66 1.000
alpha{1,2} 0.417208 0.235077 0.000231 1.365056 0.248163 1243.91 1294.84 1.000
alpha{3} 0.452233 0.236961 0.000112 1.396547 0.299047 1335.22 1415.85 1.000
pinvar{all} 0.992794 0.000080 0.976256 0.999994 0.995702 1454.91 1477.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -304.903735
Model 2: PositiveSelection -304.903736
Model 0: one-ratio -304.903736
Model 7: beta -304.903733
Model 8: beta&w>1 -304.903734
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C2
VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C3
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C4
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C5
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C6
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=81
C1 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C2 VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C3 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C4 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C5 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C6 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
*************************************************
C1 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C2 QAPVVVAGNNHWSGFRPDRIKALAGAVLTA-
C3 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C4 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C5 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C6 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2440]--->[2430]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.602 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C2 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C3 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C4 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C5 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C6 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
**************************************************
C1 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C2 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C3 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C4 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C5 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C6 APVVVAGNNHWSGFRPDRIKALAGAVLTA
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C2 GTGATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C3 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C4 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C5 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C6 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
***********************************************
C1 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C2 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C3 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C4 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C5 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C6 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
**************************************************
C1 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C2 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C3 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C4 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C5 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C6 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
**************************************************
C1 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C2 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C3 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C4 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C5 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C6 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
**************************************************
C1 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C2 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C3 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C4 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C5 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C6 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
****************************************
>C1
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C2
GTGATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C3
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C4
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C5
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C6
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C1
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C2
VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C3
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C4
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C5
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C6
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 243 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784334
Setting output file names to "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 328322732
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9061336601
Seed = 1105577539
Swapseed = 1579784334
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -534.576166 -- -24.965149
Chain 2 -- -534.576246 -- -24.965149
Chain 3 -- -534.576247 -- -24.965149
Chain 4 -- -534.576166 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -534.576246 -- -24.965149
Chain 2 -- -534.576246 -- -24.965149
Chain 3 -- -534.576246 -- -24.965149
Chain 4 -- -534.576247 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-534.576] (-534.576) (-534.576) (-534.576) * [-534.576] (-534.576) (-534.576) (-534.576)
500 -- [-333.441] (-344.293) (-335.724) (-338.793) * (-336.142) (-338.318) [-338.281] (-341.857) -- 0:00:00
1000 -- (-341.760) (-340.471) [-344.039] (-341.616) * [-336.875] (-338.295) (-346.964) (-342.818) -- 0:00:00
1500 -- [-335.735] (-339.242) (-342.124) (-339.810) * (-338.703) [-340.466] (-339.866) (-346.009) -- 0:00:00
2000 -- (-347.957) [-338.926] (-338.731) (-334.948) * [-342.718] (-342.768) (-335.660) (-342.564) -- 0:00:00
2500 -- (-345.548) [-342.880] (-339.791) (-334.924) * (-341.228) [-340.813] (-334.155) (-342.200) -- 0:00:00
3000 -- (-338.459) (-351.150) [-337.237] (-342.797) * [-336.438] (-342.372) (-341.071) (-339.161) -- 0:00:00
3500 -- [-336.987] (-338.299) (-339.291) (-337.636) * (-338.856) [-335.474] (-335.415) (-343.711) -- 0:00:00
4000 -- [-339.763] (-338.785) (-346.850) (-336.827) * [-337.421] (-343.016) (-347.078) (-336.931) -- 0:00:00
4500 -- (-340.411) (-340.781) (-340.660) [-342.553] * [-335.062] (-338.692) (-341.490) (-335.980) -- 0:00:00
5000 -- (-348.637) [-334.029] (-339.527) (-344.574) * (-339.772) (-339.934) [-337.152] (-339.471) -- 0:00:00
Average standard deviation of split frequencies: 0.102479
5500 -- (-342.593) [-337.943] (-345.781) (-349.375) * [-340.003] (-333.345) (-348.073) (-337.730) -- 0:00:00
6000 -- (-344.612) (-345.436) [-339.356] (-350.490) * (-343.620) [-339.955] (-341.259) (-337.399) -- 0:00:00
6500 -- (-337.650) [-336.753] (-340.293) (-346.034) * (-344.824) [-336.742] (-353.181) (-341.523) -- 0:00:00
7000 -- (-335.088) (-341.951) [-335.768] (-339.452) * (-333.314) (-337.714) [-343.380] (-332.948) -- 0:00:00
7500 -- (-336.679) (-340.037) [-340.808] (-341.339) * [-337.729] (-341.160) (-348.762) (-338.176) -- 0:00:00
8000 -- (-340.143) (-340.347) (-344.877) [-333.163] * (-331.350) (-334.098) (-346.994) [-336.058] -- 0:02:04
8500 -- (-341.571) (-351.549) [-338.984] (-337.091) * [-328.112] (-337.947) (-340.033) (-334.965) -- 0:01:56
9000 -- (-338.430) [-340.241] (-336.348) (-333.005) * (-330.215) (-341.234) [-339.735] (-344.188) -- 0:01:50
9500 -- [-334.182] (-336.200) (-337.118) (-333.125) * (-327.956) [-336.756] (-346.772) (-348.118) -- 0:01:44
10000 -- (-337.879) (-337.971) [-333.925] (-342.639) * [-329.811] (-338.049) (-355.674) (-340.183) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-333.828) [-336.666] (-342.903) (-341.328) * [-328.203] (-332.021) (-353.110) (-337.798) -- 0:01:34
11000 -- (-342.047) [-341.154] (-343.796) (-340.174) * (-329.906) (-336.860) (-347.655) [-336.380] -- 0:01:29
11500 -- [-338.365] (-346.242) (-339.061) (-338.617) * (-329.051) (-342.770) (-346.087) [-336.844] -- 0:01:25
12000 -- (-344.315) (-344.107) (-346.430) [-339.688] * (-329.285) (-338.304) (-334.576) [-341.009] -- 0:01:22
12500 -- (-339.090) [-340.277] (-344.690) (-338.062) * (-333.658) [-334.255] (-329.351) (-350.778) -- 0:01:19
13000 -- (-337.003) (-335.609) [-332.540] (-345.662) * [-334.643] (-333.456) (-331.178) (-352.183) -- 0:01:15
13500 -- (-344.354) (-342.931) [-338.930] (-337.523) * (-331.288) (-347.413) [-331.466] (-341.537) -- 0:01:13
14000 -- (-343.563) (-344.015) (-341.828) [-339.148] * (-329.602) [-342.017] (-332.372) (-339.095) -- 0:01:10
14500 -- (-346.451) [-339.239] (-338.467) (-341.515) * (-329.562) [-340.680] (-331.593) (-335.269) -- 0:01:07
15000 -- [-343.804] (-349.004) (-337.487) (-348.758) * (-330.187) (-339.119) (-329.630) [-330.225] -- 0:01:05
Average standard deviation of split frequencies: 0.066679
15500 -- (-338.531) (-355.550) [-338.133] (-343.529) * (-328.039) (-346.648) [-329.233] (-331.082) -- 0:01:03
16000 -- (-342.484) (-345.292) [-338.118] (-337.000) * [-329.719] (-342.350) (-332.146) (-327.970) -- 0:01:01
16500 -- [-329.819] (-338.902) (-349.786) (-342.985) * (-329.097) (-343.167) [-331.330] (-330.324) -- 0:00:59
17000 -- (-330.734) (-330.892) [-344.075] (-336.507) * [-328.839] (-338.637) (-331.064) (-329.008) -- 0:00:57
17500 -- (-330.251) (-327.617) (-339.689) [-338.769] * (-329.183) [-338.206] (-328.264) (-328.136) -- 0:00:56
18000 -- (-331.065) (-329.204) [-340.041] (-336.851) * [-329.405] (-339.024) (-328.613) (-328.886) -- 0:00:54
18500 -- (-329.099) [-328.127] (-338.725) (-339.553) * (-329.234) (-337.859) (-328.509) [-329.312] -- 0:00:53
19000 -- (-335.420) (-328.373) [-334.981] (-345.527) * (-328.717) (-337.326) (-328.529) [-330.004] -- 0:00:51
19500 -- (-331.832) [-329.187] (-340.846) (-341.401) * [-330.078] (-340.315) (-329.104) (-331.302) -- 0:00:50
20000 -- (-330.405) [-328.885] (-332.315) (-335.423) * (-329.147) (-340.140) [-329.826] (-329.602) -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- [-331.260] (-328.731) (-352.486) (-342.964) * (-328.303) (-342.063) (-330.692) [-328.686] -- 0:00:47
21000 -- (-328.091) (-329.526) (-355.040) [-346.681] * (-329.524) (-344.426) [-327.730] (-329.493) -- 0:00:46
21500 -- [-328.288] (-330.986) (-336.383) (-339.800) * (-330.247) (-336.101) (-327.924) [-328.225] -- 0:00:45
22000 -- [-330.249] (-331.159) (-345.798) (-345.919) * [-328.602] (-338.541) (-329.108) (-328.472) -- 0:00:44
22500 -- (-329.017) (-329.707) (-348.226) [-338.302] * (-328.969) (-343.908) (-330.378) [-328.464] -- 0:01:26
23000 -- (-328.550) (-330.102) (-344.509) [-336.213] * (-329.614) [-333.385] (-328.897) (-328.406) -- 0:01:24
23500 -- (-329.149) [-329.031] (-334.528) (-334.184) * (-329.214) [-338.423] (-329.931) (-328.491) -- 0:01:23
24000 -- [-328.439] (-331.792) (-329.175) (-341.078) * [-329.116] (-343.561) (-334.755) (-330.653) -- 0:01:21
24500 -- [-330.860] (-329.394) (-329.209) (-339.695) * (-329.707) (-339.272) [-332.580] (-330.678) -- 0:01:19
25000 -- (-330.671) [-328.773] (-329.988) (-348.930) * (-332.439) [-339.111] (-331.843) (-327.681) -- 0:01:18
Average standard deviation of split frequencies: 0.042855
25500 -- (-330.024) (-330.409) (-329.540) [-344.558] * (-329.167) (-360.623) [-328.356] (-327.517) -- 0:01:16
26000 -- (-329.064) (-333.322) [-329.669] (-336.434) * [-329.851] (-340.333) (-328.287) (-328.108) -- 0:01:14
26500 -- [-331.859] (-332.570) (-327.932) (-336.667) * (-329.509) [-335.375] (-331.438) (-329.433) -- 0:01:13
27000 -- [-329.661] (-333.992) (-327.916) (-338.164) * (-329.419) [-338.741] (-330.362) (-331.141) -- 0:01:12
27500 -- (-330.870) (-331.838) [-335.199] (-342.734) * (-333.555) [-348.629] (-328.476) (-333.209) -- 0:01:10
28000 -- (-329.875) (-328.534) (-328.651) [-333.201] * (-329.294) (-340.561) [-330.403] (-329.766) -- 0:01:09
28500 -- [-330.102] (-329.569) (-334.527) (-345.883) * [-330.397] (-340.497) (-329.586) (-329.338) -- 0:01:08
29000 -- (-332.978) (-330.453) (-328.342) [-337.996] * (-331.833) (-333.868) [-329.423] (-328.915) -- 0:01:06
29500 -- (-332.449) (-331.735) [-331.865] (-341.178) * (-330.433) (-354.036) [-330.933] (-330.646) -- 0:01:05
30000 -- (-331.411) [-331.576] (-328.721) (-336.304) * (-331.205) [-337.546] (-328.967) (-328.183) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-330.370) (-329.693) [-329.428] (-336.180) * (-330.996) [-339.494] (-328.727) (-327.941) -- 0:01:03
31000 -- (-330.798) (-328.002) (-329.010) [-339.159] * (-330.443) (-342.802) [-331.242] (-329.762) -- 0:01:02
31500 -- (-335.942) [-328.343] (-330.912) (-338.696) * (-328.120) (-331.094) [-329.733] (-328.916) -- 0:01:01
32000 -- [-331.963] (-328.146) (-328.940) (-346.072) * (-330.577) [-334.414] (-335.030) (-327.455) -- 0:01:00
32500 -- [-331.058] (-329.298) (-329.494) (-343.210) * (-328.379) [-329.310] (-333.290) (-329.850) -- 0:00:59
33000 -- (-331.825) [-331.060] (-328.891) (-339.298) * [-329.065] (-332.332) (-328.266) (-332.209) -- 0:00:58
33500 -- (-330.834) (-330.514) [-328.303] (-334.142) * (-330.606) (-330.252) (-329.580) [-331.348] -- 0:00:57
34000 -- [-328.520] (-328.537) (-331.290) (-341.264) * (-329.253) [-328.458] (-329.443) (-330.032) -- 0:00:56
34500 -- (-328.580) (-328.622) (-332.607) [-336.931] * [-333.298] (-329.799) (-327.374) (-332.178) -- 0:00:55
35000 -- (-330.518) [-330.370] (-332.930) (-340.597) * (-329.025) (-328.437) (-328.507) [-331.232] -- 0:00:55
Average standard deviation of split frequencies: 0.034160
35500 -- (-331.965) (-330.779) (-333.133) [-343.232] * (-328.159) (-330.735) [-334.099] (-330.699) -- 0:00:54
36000 -- (-330.944) [-328.654] (-334.163) (-337.829) * (-331.940) (-331.679) [-327.629] (-330.462) -- 0:00:53
36500 -- (-332.653) [-328.917] (-335.158) (-335.437) * [-328.103] (-330.099) (-330.145) (-329.400) -- 0:00:52
37000 -- (-330.444) (-330.232) [-329.969] (-338.423) * (-331.060) (-330.616) (-333.051) [-327.938] -- 0:01:18
37500 -- (-329.225) [-330.615] (-329.783) (-334.405) * (-328.955) (-329.834) [-329.011] (-329.520) -- 0:01:17
38000 -- (-328.342) [-329.250] (-331.590) (-332.039) * (-331.702) (-327.961) [-329.761] (-331.240) -- 0:01:15
38500 -- (-329.842) [-330.043] (-329.241) (-352.777) * (-328.378) (-330.813) [-327.551] (-332.288) -- 0:01:14
39000 -- (-331.542) (-329.517) [-328.664] (-354.509) * (-328.974) (-329.106) (-330.879) [-330.097] -- 0:01:13
39500 -- (-328.304) (-334.959) [-329.593] (-344.101) * (-328.703) [-329.133] (-329.090) (-327.716) -- 0:01:12
40000 -- (-328.962) (-332.447) (-328.886) [-341.221] * [-330.038] (-330.026) (-330.235) (-328.765) -- 0:01:12
Average standard deviation of split frequencies: 0.038253
40500 -- [-328.675] (-330.908) (-332.126) (-341.454) * [-330.779] (-329.691) (-328.881) (-332.809) -- 0:01:11
41000 -- (-328.846) [-327.984] (-327.926) (-350.967) * (-329.289) (-329.502) [-329.855] (-328.410) -- 0:01:10
41500 -- (-333.709) [-332.500] (-330.958) (-344.873) * (-329.098) (-327.781) [-328.274] (-329.920) -- 0:01:09
42000 -- (-331.664) (-328.621) (-329.399) [-334.504] * (-331.807) (-327.839) [-328.328] (-329.378) -- 0:01:08
42500 -- (-331.843) (-328.886) (-327.910) [-339.721] * (-331.254) (-331.776) (-328.394) [-328.748] -- 0:01:07
43000 -- [-328.430] (-331.833) (-328.512) (-336.820) * (-329.427) [-330.975] (-329.874) (-329.936) -- 0:01:06
43500 -- (-333.830) (-329.975) [-330.427] (-332.042) * (-327.705) (-331.891) (-331.268) [-329.736] -- 0:01:05
44000 -- (-330.513) (-329.005) [-330.572] (-331.261) * (-328.435) [-327.574] (-334.201) (-331.638) -- 0:01:05
44500 -- [-331.227] (-328.246) (-328.339) (-332.964) * [-329.251] (-329.781) (-332.692) (-331.027) -- 0:01:04
45000 -- (-330.125) (-329.005) (-329.229) [-330.408] * [-329.140] (-330.551) (-327.570) (-329.058) -- 0:01:03
Average standard deviation of split frequencies: 0.028792
45500 -- (-331.033) (-331.440) (-328.938) [-331.602] * (-330.969) [-327.995] (-332.023) (-329.605) -- 0:01:02
46000 -- [-328.278] (-331.842) (-328.852) (-330.281) * (-329.505) [-329.091] (-330.297) (-329.303) -- 0:01:02
46500 -- (-330.556) [-330.614] (-334.069) (-328.069) * (-328.661) [-330.887] (-328.980) (-331.496) -- 0:01:01
47000 -- (-331.243) [-329.969] (-331.934) (-331.047) * [-328.036] (-332.443) (-329.857) (-331.560) -- 0:01:00
47500 -- (-331.725) (-330.967) (-328.100) [-329.471] * (-329.560) (-328.273) [-334.008] (-328.703) -- 0:01:00
48000 -- (-330.272) (-331.144) [-329.893] (-330.535) * (-335.047) (-329.819) (-329.229) [-330.184] -- 0:00:59
48500 -- (-329.733) (-329.810) [-329.450] (-328.230) * (-329.826) [-329.933] (-328.055) (-329.239) -- 0:00:58
49000 -- [-329.166] (-329.660) (-329.441) (-331.991) * (-329.778) (-329.936) [-328.477] (-327.955) -- 0:00:58
49500 -- [-328.057] (-329.868) (-328.936) (-331.084) * (-329.457) [-334.430] (-336.377) (-329.666) -- 0:00:57
50000 -- (-334.137) (-330.279) (-331.363) [-330.324] * (-328.430) (-330.368) [-331.764] (-330.464) -- 0:00:57
Average standard deviation of split frequencies: 0.023482
50500 -- [-329.190] (-331.784) (-333.089) (-329.171) * [-327.649] (-331.396) (-330.361) (-329.247) -- 0:00:56
51000 -- (-330.510) (-327.743) [-330.682] (-330.544) * (-329.336) (-328.681) [-332.628] (-330.830) -- 0:00:55
51500 -- [-327.865] (-328.016) (-329.407) (-328.775) * (-328.951) (-329.828) [-333.965] (-330.788) -- 0:01:13
52000 -- (-329.789) (-330.273) [-330.387] (-330.542) * [-329.453] (-329.932) (-332.236) (-334.424) -- 0:01:12
52500 -- (-328.512) (-327.984) (-330.913) [-329.178] * (-332.265) [-331.820] (-332.495) (-333.832) -- 0:01:12
53000 -- (-329.109) (-332.796) [-327.921] (-330.305) * (-333.518) (-329.678) (-335.973) [-328.579] -- 0:01:11
53500 -- [-328.872] (-332.279) (-328.320) (-329.078) * [-329.259] (-331.669) (-334.125) (-328.960) -- 0:01:10
54000 -- [-327.902] (-328.493) (-329.162) (-330.202) * [-329.660] (-330.601) (-332.236) (-329.210) -- 0:01:10
54500 -- (-328.390) (-331.882) (-330.195) [-331.849] * (-329.338) (-329.172) [-331.953] (-333.720) -- 0:01:09
55000 -- (-328.228) (-328.933) (-329.703) [-330.715] * [-331.496] (-330.082) (-330.178) (-332.671) -- 0:01:08
Average standard deviation of split frequencies: 0.023149
55500 -- (-328.550) [-329.181] (-328.723) (-332.406) * (-330.175) (-330.903) [-328.510] (-331.012) -- 0:01:08
56000 -- (-328.774) (-329.422) (-330.115) [-328.550] * (-330.090) (-328.713) [-329.906] (-329.017) -- 0:01:07
56500 -- (-329.718) [-329.007] (-331.830) (-328.970) * (-331.915) (-328.711) (-327.866) [-329.677] -- 0:01:06
57000 -- [-329.570] (-335.807) (-330.682) (-329.221) * (-328.289) (-329.262) (-328.834) [-334.007] -- 0:01:06
57500 -- (-329.634) (-333.672) (-329.050) [-331.395] * (-328.320) (-332.084) [-327.816] (-331.569) -- 0:01:05
58000 -- (-328.568) (-329.826) [-328.209] (-327.629) * (-331.157) (-328.077) (-329.028) [-328.733] -- 0:01:04
58500 -- (-332.220) [-332.531] (-328.953) (-330.410) * [-331.230] (-328.581) (-329.710) (-328.946) -- 0:01:04
59000 -- (-334.396) [-333.162] (-328.439) (-330.428) * (-331.957) [-329.720] (-329.563) (-329.278) -- 0:01:03
59500 -- (-331.621) (-330.744) (-331.087) [-329.667] * (-330.599) (-328.410) [-328.585] (-329.249) -- 0:01:03
60000 -- [-329.402] (-327.989) (-327.416) (-330.197) * [-329.195] (-328.837) (-327.698) (-329.194) -- 0:01:02
Average standard deviation of split frequencies: 0.021026
60500 -- [-329.911] (-329.149) (-327.789) (-328.948) * (-327.879) (-328.613) [-328.185] (-331.546) -- 0:01:02
61000 -- [-330.409] (-328.798) (-328.941) (-331.765) * (-329.767) [-329.919] (-328.918) (-331.878) -- 0:01:01
61500 -- (-331.081) (-328.397) (-329.092) [-328.599] * (-328.758) (-329.374) [-328.376] (-332.093) -- 0:01:01
62000 -- [-332.289] (-327.999) (-330.064) (-328.646) * (-331.288) [-329.066] (-329.074) (-331.254) -- 0:01:00
62500 -- [-329.446] (-331.073) (-329.516) (-330.380) * (-327.950) (-329.703) [-330.423] (-328.978) -- 0:01:00
63000 -- (-330.325) (-328.054) (-328.711) [-328.742] * (-332.305) (-327.948) (-328.014) [-327.945] -- 0:00:59
63500 -- (-332.689) (-331.442) [-328.407] (-327.810) * (-330.736) (-328.366) [-327.989] (-328.976) -- 0:00:58
64000 -- [-329.211] (-334.400) (-328.981) (-329.217) * (-328.612) (-329.329) (-327.422) [-331.392] -- 0:00:58
64500 -- (-335.487) (-327.385) [-331.356] (-328.807) * [-330.498] (-328.896) (-328.370) (-331.923) -- 0:00:58
65000 -- (-331.190) (-331.756) (-330.257) [-328.445] * (-329.149) [-330.941] (-330.905) (-328.752) -- 0:00:57
Average standard deviation of split frequencies: 0.023700
65500 -- (-334.879) [-329.061] (-329.742) (-330.123) * (-329.297) [-330.507] (-330.775) (-333.430) -- 0:01:11
66000 -- (-330.507) [-332.170] (-328.862) (-329.719) * [-329.220] (-328.399) (-331.199) (-331.090) -- 0:01:10
66500 -- [-329.721] (-328.669) (-330.424) (-329.085) * (-329.955) (-329.863) [-329.945] (-327.777) -- 0:01:10
67000 -- [-330.343] (-329.615) (-330.917) (-329.815) * (-330.168) [-329.916] (-330.837) (-328.325) -- 0:01:09
67500 -- [-330.617] (-329.443) (-330.956) (-329.836) * (-334.352) (-329.566) [-329.757] (-328.258) -- 0:01:09
68000 -- (-332.115) [-330.732] (-330.318) (-328.117) * (-331.605) (-333.323) [-328.472] (-329.335) -- 0:01:08
68500 -- (-329.382) (-331.939) [-333.822] (-328.241) * (-332.347) (-330.020) [-329.349] (-329.214) -- 0:01:07
69000 -- (-330.553) (-328.357) [-329.390] (-329.804) * (-333.567) [-331.603] (-328.383) (-329.778) -- 0:01:07
69500 -- (-328.827) (-332.277) (-328.734) [-328.067] * [-329.372] (-329.390) (-336.494) (-329.262) -- 0:01:06
70000 -- [-328.682] (-329.860) (-330.166) (-328.724) * (-328.573) (-329.617) [-328.054] (-328.830) -- 0:01:06
Average standard deviation of split frequencies: 0.023681
70500 -- (-332.003) (-330.302) (-331.669) [-328.383] * (-327.938) [-333.889] (-328.611) (-328.406) -- 0:01:05
71000 -- (-328.390) (-328.386) [-330.322] (-330.781) * (-332.520) (-330.099) [-329.875] (-330.184) -- 0:01:05
71500 -- (-332.343) (-330.091) [-329.579] (-329.335) * (-328.837) [-328.629] (-331.770) (-328.425) -- 0:01:04
72000 -- (-328.593) (-327.965) [-330.192] (-327.673) * (-329.558) [-330.422] (-329.818) (-334.452) -- 0:01:04
72500 -- (-327.635) [-334.269] (-327.859) (-328.055) * (-327.931) (-331.022) [-330.676] (-329.701) -- 0:01:03
73000 -- (-331.339) [-328.066] (-328.381) (-330.215) * (-327.652) (-333.722) [-329.407] (-333.775) -- 0:01:03
73500 -- (-329.552) (-327.855) (-328.080) [-328.985] * [-328.417] (-328.841) (-328.064) (-337.764) -- 0:01:03
74000 -- (-328.563) (-332.347) (-328.238) [-328.566] * (-328.744) [-327.439] (-334.889) (-331.743) -- 0:01:02
74500 -- (-330.502) (-330.101) (-330.029) [-329.913] * [-330.483] (-327.970) (-332.321) (-332.338) -- 0:01:02
75000 -- (-329.604) [-330.232] (-328.572) (-327.843) * (-331.899) (-328.481) (-331.472) [-331.534] -- 0:01:01
Average standard deviation of split frequencies: 0.023880
75500 -- (-330.507) [-328.363] (-328.480) (-329.967) * (-328.997) (-330.487) [-336.906] (-329.670) -- 0:01:01
76000 -- (-329.225) (-330.093) (-330.531) [-333.650] * [-328.943] (-335.733) (-329.370) (-333.241) -- 0:01:00
76500 -- (-328.326) [-328.619] (-329.639) (-330.839) * [-329.225] (-333.109) (-329.848) (-330.440) -- 0:01:00
77000 -- (-328.596) [-333.709] (-328.845) (-332.290) * [-328.462] (-332.405) (-331.139) (-329.480) -- 0:00:59
77500 -- (-328.570) (-330.610) (-334.376) [-331.451] * (-334.487) [-327.959] (-328.548) (-328.987) -- 0:00:59
78000 -- (-330.012) [-329.949] (-329.496) (-331.214) * (-329.951) (-328.691) [-329.829] (-332.456) -- 0:00:59
78500 -- [-335.134] (-327.985) (-328.531) (-328.079) * (-328.140) [-328.058] (-328.617) (-329.430) -- 0:00:58
79000 -- (-329.093) (-329.874) [-331.838] (-330.021) * (-330.410) (-331.045) [-327.769] (-327.922) -- 0:00:58
79500 -- (-328.121) (-331.020) (-330.792) [-328.467] * (-328.761) [-331.281] (-335.510) (-330.046) -- 0:00:57
80000 -- [-327.943] (-328.886) (-329.318) (-329.241) * (-328.843) [-328.360] (-331.218) (-331.235) -- 0:00:57
Average standard deviation of split frequencies: 0.024913
80500 -- (-332.219) (-328.304) (-330.273) [-328.805] * (-329.135) (-329.616) (-330.039) [-328.998] -- 0:01:08
81000 -- (-327.652) [-329.194] (-336.833) (-331.148) * [-328.423] (-328.921) (-330.275) (-330.358) -- 0:01:08
81500 -- [-329.328] (-336.331) (-330.084) (-335.610) * (-333.508) [-328.126] (-329.294) (-328.265) -- 0:01:07
82000 -- [-330.227] (-330.388) (-334.378) (-328.546) * (-329.291) [-328.514] (-328.231) (-328.175) -- 0:01:07
82500 -- [-331.680] (-330.053) (-338.961) (-331.951) * (-333.109) (-327.623) (-328.472) [-328.212] -- 0:01:06
83000 -- [-330.241] (-329.573) (-330.715) (-328.742) * (-329.537) (-329.454) (-328.383) [-330.796] -- 0:01:06
83500 -- (-331.103) [-327.823] (-330.835) (-329.330) * (-332.722) [-328.779] (-329.831) (-330.136) -- 0:01:05
84000 -- (-331.802) (-329.847) [-328.875] (-330.372) * (-329.645) (-328.497) [-328.967] (-328.079) -- 0:01:05
84500 -- (-329.568) [-329.109] (-331.808) (-330.934) * [-332.527] (-329.945) (-332.163) (-327.563) -- 0:01:05
85000 -- [-328.999] (-332.972) (-328.980) (-331.225) * (-333.257) (-329.871) [-330.017] (-328.137) -- 0:01:04
Average standard deviation of split frequencies: 0.024392
85500 -- [-328.648] (-329.138) (-328.334) (-329.190) * (-334.027) [-332.712] (-327.972) (-332.114) -- 0:01:04
86000 -- (-331.857) (-327.584) [-330.339] (-328.094) * [-330.267] (-331.678) (-329.988) (-330.176) -- 0:01:03
86500 -- [-330.171] (-327.614) (-329.914) (-329.475) * [-327.771] (-331.249) (-329.799) (-327.948) -- 0:01:03
87000 -- (-334.138) (-331.046) [-329.362] (-333.703) * (-331.073) (-327.830) (-330.816) [-328.762] -- 0:01:02
87500 -- (-327.966) [-330.978] (-327.706) (-329.328) * (-328.663) (-329.483) [-330.436] (-328.563) -- 0:01:02
88000 -- (-329.934) (-338.095) (-330.691) [-329.207] * (-329.225) [-330.681] (-330.394) (-330.517) -- 0:01:02
88500 -- (-330.419) (-332.771) [-329.768] (-328.473) * (-331.157) [-332.131] (-329.601) (-327.968) -- 0:01:01
89000 -- (-327.908) (-328.806) [-330.079] (-330.743) * (-332.551) (-331.230) [-328.942] (-330.550) -- 0:01:01
89500 -- [-331.490] (-330.758) (-330.055) (-329.712) * (-327.966) (-329.494) (-330.396) [-330.291] -- 0:01:01
90000 -- (-329.221) (-329.965) [-332.682] (-331.822) * [-329.927] (-329.253) (-331.409) (-331.722) -- 0:01:00
Average standard deviation of split frequencies: 0.025449
90500 -- (-329.731) (-329.487) (-329.674) [-332.538] * [-329.519] (-335.405) (-332.730) (-327.510) -- 0:01:00
91000 -- (-335.516) (-331.785) (-331.774) [-329.122] * (-332.371) (-333.056) [-330.155] (-329.496) -- 0:00:59
91500 -- [-328.757] (-330.006) (-328.678) (-328.882) * (-330.556) (-335.007) [-328.307] (-331.009) -- 0:00:59
92000 -- (-332.244) [-331.517] (-328.656) (-330.273) * [-330.744] (-327.865) (-329.227) (-330.172) -- 0:00:59
92500 -- [-328.225] (-329.039) (-330.215) (-332.525) * [-328.058] (-328.094) (-332.346) (-328.949) -- 0:00:58
93000 -- (-329.954) (-330.213) (-328.699) [-329.612] * (-329.319) (-329.025) (-328.405) [-327.682] -- 0:00:58
93500 -- (-330.601) (-329.036) [-330.285] (-330.370) * (-329.937) (-330.250) [-327.729] (-330.479) -- 0:00:58
94000 -- (-332.569) [-331.294] (-328.780) (-328.264) * (-328.475) (-331.395) (-329.481) [-327.939] -- 0:00:57
94500 -- (-331.782) (-331.203) (-333.439) [-329.729] * (-328.390) [-329.543] (-329.978) (-328.145) -- 0:00:57
95000 -- (-337.363) (-329.720) (-329.398) [-328.516] * (-330.013) (-329.966) [-330.010] (-330.420) -- 0:01:06
Average standard deviation of split frequencies: 0.023777
95500 -- (-333.636) [-330.133] (-333.561) (-327.968) * (-332.518) (-329.552) (-331.097) [-328.277] -- 0:01:06
96000 -- [-334.045] (-330.010) (-332.051) (-333.985) * (-331.300) (-331.951) (-328.804) [-328.256] -- 0:01:05
96500 -- (-328.500) (-330.619) [-329.362] (-335.825) * (-333.308) (-331.273) (-328.450) [-330.694] -- 0:01:05
97000 -- (-328.384) (-328.942) [-330.284] (-329.651) * (-332.804) [-329.796] (-329.734) (-327.953) -- 0:01:05
97500 -- (-329.263) [-330.099] (-331.601) (-328.764) * (-329.405) (-334.852) [-329.756] (-331.580) -- 0:01:04
98000 -- (-330.839) (-333.818) (-328.501) [-327.536] * (-329.110) [-330.496] (-329.347) (-329.634) -- 0:01:04
98500 -- [-328.370] (-331.238) (-331.384) (-329.701) * (-330.011) (-328.521) (-330.559) [-328.648] -- 0:01:04
99000 -- (-328.519) (-333.126) (-335.320) [-327.968] * (-328.485) [-332.907] (-330.189) (-329.939) -- 0:01:03
99500 -- [-328.521] (-330.528) (-328.689) (-328.978) * (-329.708) (-330.751) (-330.200) [-329.552] -- 0:01:03
100000 -- (-331.466) (-329.471) (-328.858) [-329.587] * (-328.966) (-328.753) [-329.951] (-328.663) -- 0:01:02
Average standard deviation of split frequencies: 0.022675
100500 -- (-332.071) [-328.968] (-331.777) (-329.394) * (-328.965) (-328.682) (-329.390) [-329.013] -- 0:01:02
101000 -- [-332.146] (-338.182) (-330.906) (-328.623) * [-330.118] (-329.424) (-329.186) (-328.687) -- 0:01:02
101500 -- (-330.792) (-332.393) [-331.477] (-327.515) * (-333.817) [-334.544] (-335.037) (-331.422) -- 0:01:01
102000 -- (-329.139) [-328.783] (-329.128) (-327.632) * (-328.566) (-330.303) (-334.921) [-333.393] -- 0:01:01
102500 -- (-330.725) (-329.731) (-331.895) [-328.003] * (-328.754) [-330.613] (-333.093) (-329.800) -- 0:01:01
103000 -- [-329.903] (-330.437) (-328.579) (-329.705) * (-328.747) [-331.220] (-334.868) (-329.427) -- 0:01:00
103500 -- (-332.378) (-329.666) [-329.265] (-330.220) * (-329.866) [-330.305] (-331.188) (-329.267) -- 0:01:00
104000 -- (-332.360) (-330.273) (-332.726) [-331.101] * (-329.142) (-333.639) [-328.780] (-332.719) -- 0:01:00
104500 -- [-330.425] (-328.018) (-330.924) (-328.503) * (-331.497) (-329.483) [-329.865] (-329.770) -- 0:00:59
105000 -- (-331.629) [-328.512] (-331.405) (-328.907) * (-328.537) [-328.843] (-329.414) (-328.871) -- 0:00:59
Average standard deviation of split frequencies: 0.023570
105500 -- [-330.657] (-331.638) (-330.344) (-330.438) * [-328.241] (-334.602) (-330.952) (-330.363) -- 0:00:59
106000 -- [-328.804] (-329.531) (-333.121) (-328.190) * (-331.497) [-328.348] (-328.641) (-330.677) -- 0:00:59
106500 -- (-328.792) (-328.606) [-327.982] (-328.971) * [-329.898] (-329.132) (-327.921) (-334.620) -- 0:00:58
107000 -- [-330.122] (-329.366) (-332.966) (-329.467) * (-329.334) [-328.843] (-328.567) (-332.826) -- 0:00:58
107500 -- [-331.973] (-328.287) (-330.239) (-331.494) * [-328.676] (-327.561) (-329.177) (-328.635) -- 0:00:58
108000 -- (-329.218) (-329.086) (-330.097) [-333.361] * (-331.972) (-329.731) (-329.614) [-328.087] -- 0:00:57
108500 -- (-330.240) [-328.590] (-329.444) (-334.034) * (-332.259) [-329.472] (-330.085) (-329.575) -- 0:00:57
109000 -- [-328.019] (-327.614) (-330.531) (-329.758) * [-329.951] (-330.559) (-329.896) (-328.308) -- 0:00:57
109500 -- (-328.659) (-330.232) [-329.855] (-328.241) * (-328.985) (-328.728) [-331.644] (-327.958) -- 0:01:05
110000 -- (-328.410) [-331.069] (-328.412) (-328.010) * (-330.557) (-329.227) (-331.698) [-329.985] -- 0:01:04
Average standard deviation of split frequencies: 0.024885
110500 -- (-333.363) (-328.529) [-328.706] (-329.252) * [-330.159] (-331.949) (-330.381) (-329.616) -- 0:01:04
111000 -- (-331.193) (-330.647) [-329.107] (-328.405) * (-330.786) (-329.151) (-333.567) [-328.716] -- 0:01:04
111500 -- [-329.780] (-330.903) (-329.589) (-328.548) * [-328.501] (-329.268) (-337.151) (-328.519) -- 0:01:03
112000 -- (-331.797) [-329.438] (-332.781) (-328.184) * (-328.298) (-331.078) (-330.605) [-331.951] -- 0:01:03
112500 -- (-328.690) (-329.126) [-332.837] (-328.403) * [-328.609] (-333.354) (-330.197) (-330.118) -- 0:01:03
113000 -- (-328.857) (-329.143) (-329.338) [-328.553] * (-331.125) (-334.360) (-329.233) [-328.511] -- 0:01:02
113500 -- (-331.133) (-329.128) [-328.223] (-329.010) * (-329.065) [-329.131] (-328.949) (-332.228) -- 0:01:02
114000 -- (-331.492) (-328.878) [-332.762] (-327.484) * (-328.595) (-329.464) [-330.693] (-333.469) -- 0:01:02
114500 -- (-334.328) [-331.885] (-327.936) (-327.766) * (-329.240) (-330.095) [-329.167] (-332.284) -- 0:01:01
115000 -- (-331.163) (-328.658) (-328.102) [-327.968] * (-328.835) (-331.734) (-329.098) [-327.586] -- 0:01:01
Average standard deviation of split frequencies: 0.024835
115500 -- (-328.120) (-328.573) (-329.939) [-328.090] * (-331.125) (-331.266) (-330.416) [-328.281] -- 0:01:01
116000 -- (-328.250) [-333.094] (-329.947) (-334.019) * (-332.326) [-327.810] (-331.215) (-329.820) -- 0:01:00
116500 -- (-327.536) [-329.379] (-331.096) (-338.221) * (-331.733) [-329.362] (-331.780) (-329.099) -- 0:01:00
117000 -- (-328.692) [-329.535] (-328.753) (-336.367) * [-330.894] (-330.087) (-329.402) (-329.053) -- 0:01:00
117500 -- (-329.098) (-328.688) (-328.306) [-333.872] * (-329.424) (-329.699) (-330.245) [-330.733] -- 0:01:00
118000 -- (-332.774) (-328.568) [-328.907] (-329.947) * [-330.667] (-336.595) (-327.512) (-328.499) -- 0:00:59
118500 -- (-331.464) (-331.776) (-328.671) [-330.261] * [-330.350] (-328.703) (-332.816) (-331.266) -- 0:00:59
119000 -- (-328.892) (-334.494) (-328.862) [-330.480] * (-330.970) [-329.371] (-329.147) (-332.964) -- 0:00:59
119500 -- (-328.283) (-332.720) (-329.182) [-329.907] * (-330.524) (-330.868) (-329.433) [-337.489] -- 0:00:58
120000 -- [-330.882] (-333.152) (-330.030) (-329.010) * (-329.502) (-328.879) (-333.058) [-332.818] -- 0:00:58
Average standard deviation of split frequencies: 0.024742
120500 -- [-328.773] (-329.043) (-328.015) (-331.033) * (-332.126) [-331.908] (-333.686) (-331.186) -- 0:00:58
121000 -- [-327.771] (-329.410) (-329.165) (-335.310) * (-329.915) (-332.040) (-329.768) [-327.701] -- 0:00:58
121500 -- [-328.867] (-328.866) (-332.821) (-331.778) * (-329.145) (-332.583) (-330.560) [-327.907] -- 0:00:57
122000 -- (-332.441) (-328.700) [-329.339] (-334.219) * (-329.188) (-328.546) (-328.856) [-328.563] -- 0:00:57
122500 -- (-334.056) (-330.824) (-328.364) [-332.316] * (-328.006) (-331.374) [-328.669] (-328.118) -- 0:00:57
123000 -- (-330.474) (-330.874) (-330.593) [-333.529] * [-330.013] (-332.767) (-330.420) (-330.825) -- 0:00:57
123500 -- (-328.778) [-329.521] (-330.202) (-328.897) * [-339.135] (-332.483) (-329.727) (-328.881) -- 0:00:56
124000 -- (-330.677) (-329.421) [-330.025] (-330.115) * [-331.313] (-329.521) (-330.709) (-331.876) -- 0:01:03
124500 -- (-329.267) (-330.536) (-329.529) [-328.972] * (-332.000) (-331.136) [-330.351] (-331.318) -- 0:01:03
125000 -- (-328.391) (-332.184) [-331.421] (-329.639) * (-331.318) [-328.626] (-329.179) (-328.961) -- 0:01:03
Average standard deviation of split frequencies: 0.025628
125500 -- [-328.676] (-328.668) (-327.742) (-331.030) * (-330.670) (-330.085) [-327.983] (-331.520) -- 0:01:02
126000 -- [-330.964] (-328.363) (-331.732) (-329.506) * (-329.967) (-328.449) [-328.359] (-328.543) -- 0:01:02
126500 -- (-329.302) [-329.776] (-329.219) (-331.217) * (-335.099) [-328.385] (-330.576) (-328.224) -- 0:01:02
127000 -- (-328.543) (-329.575) [-327.560] (-333.379) * (-329.502) (-328.692) (-335.211) [-328.477] -- 0:01:01
127500 -- (-328.459) (-328.001) [-328.374] (-337.548) * (-330.078) (-335.163) [-331.156] (-329.612) -- 0:01:01
128000 -- (-330.516) (-331.513) [-329.044] (-328.955) * (-328.218) (-330.247) [-329.022] (-331.158) -- 0:01:01
128500 -- (-330.208) (-330.351) [-330.246] (-328.100) * (-328.638) (-329.758) [-330.402] (-329.448) -- 0:01:01
129000 -- [-328.268] (-332.963) (-329.782) (-330.645) * (-332.926) (-328.815) (-332.425) [-330.703] -- 0:01:00
129500 -- (-331.464) [-328.926] (-327.512) (-331.202) * [-331.542] (-330.204) (-331.298) (-330.740) -- 0:01:00
130000 -- (-332.054) (-332.672) (-329.766) [-330.543] * (-329.777) [-330.719] (-331.900) (-330.625) -- 0:01:00
Average standard deviation of split frequencies: 0.024494
130500 -- (-329.594) (-330.944) [-328.682] (-330.999) * (-328.697) (-328.318) [-331.848] (-331.305) -- 0:00:59
131000 -- (-328.173) (-328.886) (-331.855) [-331.541] * (-328.675) (-329.860) (-331.149) [-328.835] -- 0:00:59
131500 -- (-328.961) (-330.944) (-331.220) [-331.637] * [-330.783] (-331.009) (-332.043) (-330.391) -- 0:00:59
132000 -- (-329.087) [-328.684] (-333.405) (-330.709) * (-329.200) (-327.836) [-331.407] (-329.482) -- 0:00:59
132500 -- (-330.363) (-331.440) (-328.685) [-328.797] * (-328.030) (-328.481) [-331.738] (-331.001) -- 0:00:58
133000 -- (-328.882) [-327.580] (-330.167) (-328.435) * (-329.938) [-330.552] (-330.821) (-330.410) -- 0:00:58
133500 -- (-328.555) [-329.921] (-329.402) (-329.073) * (-330.437) [-327.620] (-329.911) (-329.962) -- 0:00:58
134000 -- (-329.781) (-332.224) (-328.047) [-331.498] * (-329.611) [-328.649] (-330.986) (-331.189) -- 0:00:58
134500 -- (-329.639) (-331.610) (-328.356) [-329.034] * (-327.688) [-331.422] (-330.701) (-330.591) -- 0:00:57
135000 -- [-329.307] (-328.055) (-330.825) (-329.257) * (-328.293) [-328.084] (-330.680) (-328.972) -- 0:00:57
Average standard deviation of split frequencies: 0.024263
135500 -- (-327.791) (-327.841) (-329.466) [-330.139] * (-328.412) (-329.820) [-330.858] (-329.517) -- 0:00:57
136000 -- [-329.443] (-332.012) (-332.584) (-329.917) * [-327.642] (-329.040) (-330.629) (-328.108) -- 0:00:57
136500 -- (-329.378) (-329.350) (-329.834) [-332.954] * [-329.070] (-333.088) (-337.708) (-331.642) -- 0:00:56
137000 -- [-327.925] (-331.875) (-329.294) (-334.099) * (-329.899) [-327.484] (-329.845) (-328.294) -- 0:00:56
137500 -- (-334.813) (-328.166) (-333.467) [-329.687] * [-330.975] (-329.815) (-330.455) (-329.208) -- 0:00:56
138000 -- [-330.709] (-328.316) (-329.614) (-334.024) * [-330.235] (-331.512) (-332.893) (-329.888) -- 0:00:56
138500 -- [-330.453] (-330.515) (-329.705) (-328.517) * (-329.004) [-328.829] (-328.331) (-329.959) -- 0:01:02
139000 -- (-332.074) [-332.308] (-332.714) (-331.331) * (-328.286) (-329.105) (-329.940) [-328.255] -- 0:01:01
139500 -- (-329.221) (-332.164) (-331.780) [-328.666] * (-330.979) [-329.639] (-328.868) (-329.807) -- 0:01:01
140000 -- [-328.220] (-331.490) (-329.445) (-331.312) * (-329.702) (-329.837) (-329.096) [-332.018] -- 0:01:01
Average standard deviation of split frequencies: 0.024576
140500 -- (-330.048) [-331.829] (-329.419) (-328.400) * (-328.483) (-330.208) (-329.358) [-329.150] -- 0:01:01
141000 -- [-328.451] (-328.020) (-328.722) (-330.178) * (-327.808) [-330.636] (-327.725) (-328.274) -- 0:01:00
141500 -- (-329.952) (-330.113) (-331.284) [-334.686] * (-328.990) [-328.553] (-331.614) (-330.302) -- 0:01:00
142000 -- [-333.908] (-329.856) (-333.702) (-330.789) * (-339.158) (-329.828) (-330.600) [-329.697] -- 0:01:00
142500 -- (-333.149) (-331.025) (-335.191) [-329.581] * [-330.624] (-330.374) (-328.773) (-334.550) -- 0:01:00
143000 -- [-330.766] (-328.996) (-331.383) (-330.096) * (-328.983) (-330.029) [-328.548] (-330.694) -- 0:00:59
143500 -- (-331.337) (-329.256) (-328.553) [-328.075] * (-328.989) (-330.848) [-329.245] (-330.033) -- 0:00:59
144000 -- (-330.238) (-330.586) [-327.691] (-329.337) * [-327.948] (-328.627) (-330.170) (-330.085) -- 0:00:59
144500 -- (-328.289) (-328.739) (-329.979) [-328.747] * (-328.260) (-327.903) (-330.231) [-329.600] -- 0:00:59
145000 -- (-329.108) [-329.923] (-330.316) (-328.210) * (-335.790) (-329.454) [-330.669] (-328.163) -- 0:00:58
Average standard deviation of split frequencies: 0.023570
145500 -- (-330.894) [-331.284] (-328.549) (-331.075) * (-328.305) [-328.412] (-334.761) (-331.196) -- 0:00:58
146000 -- (-328.414) (-332.340) [-330.548] (-330.203) * (-328.278) (-331.686) (-332.501) [-331.482] -- 0:00:58
146500 -- (-328.755) [-328.939] (-331.766) (-328.959) * [-329.714] (-328.913) (-332.120) (-328.838) -- 0:00:58
147000 -- (-330.852) [-328.214] (-329.701) (-333.215) * (-330.043) (-331.360) (-329.664) [-330.728] -- 0:00:58
147500 -- (-327.739) (-332.090) (-328.494) [-333.093] * (-331.641) (-330.381) [-330.244] (-330.428) -- 0:00:57
148000 -- [-328.184] (-331.327) (-328.862) (-328.860) * (-329.886) (-334.318) [-329.539] (-329.757) -- 0:00:57
148500 -- (-329.505) (-329.698) (-327.704) [-328.300] * (-331.246) [-327.918] (-328.934) (-328.067) -- 0:00:57
149000 -- (-329.342) (-329.569) (-330.375) [-331.580] * (-328.490) [-330.354] (-328.664) (-329.097) -- 0:00:57
149500 -- [-329.454] (-331.547) (-332.904) (-329.604) * (-327.743) (-332.730) [-330.883] (-330.695) -- 0:00:56
150000 -- [-330.494] (-334.157) (-330.856) (-328.462) * [-328.340] (-332.378) (-328.904) (-329.663) -- 0:00:56
Average standard deviation of split frequencies: 0.022890
150500 -- (-328.782) (-329.339) (-330.612) [-331.445] * (-330.356) (-328.627) [-328.020] (-328.160) -- 0:00:56
151000 -- (-329.049) [-328.194] (-329.271) (-331.812) * (-329.259) [-330.592] (-328.116) (-329.236) -- 0:00:56
151500 -- (-329.805) [-330.324] (-335.643) (-333.049) * (-329.298) (-330.100) (-327.763) [-330.560] -- 0:00:56
152000 -- [-330.432] (-329.053) (-330.911) (-334.445) * (-330.653) (-332.242) [-329.767] (-328.980) -- 0:00:55
152500 -- (-330.334) (-329.606) [-329.594] (-328.493) * [-327.475] (-331.062) (-331.466) (-329.382) -- 0:00:55
153000 -- (-328.672) [-332.355] (-328.644) (-328.826) * (-328.593) (-328.826) [-334.073] (-329.858) -- 0:01:00
153500 -- (-332.301) (-332.692) (-328.368) [-328.916] * [-329.705] (-329.334) (-334.812) (-328.352) -- 0:01:00
154000 -- (-330.170) (-334.094) (-330.273) [-330.138] * [-330.994] (-336.677) (-332.139) (-330.560) -- 0:01:00
154500 -- [-331.364] (-330.268) (-328.792) (-328.067) * (-328.733) (-329.889) (-334.833) [-329.164] -- 0:01:00
155000 -- (-329.296) (-333.980) (-330.523) [-329.184] * (-328.815) (-327.712) (-328.133) [-332.586] -- 0:00:59
Average standard deviation of split frequencies: 0.021153
155500 -- (-327.875) (-333.069) (-330.581) [-328.979] * (-329.576) [-327.488] (-330.439) (-329.115) -- 0:00:59
156000 -- (-331.474) [-330.741] (-328.264) (-329.451) * (-329.943) (-328.095) (-328.802) [-333.222] -- 0:00:59
156500 -- [-328.046] (-332.311) (-328.812) (-328.950) * [-332.299] (-329.046) (-330.816) (-329.316) -- 0:00:59
157000 -- [-331.445] (-330.608) (-332.050) (-329.910) * [-331.046] (-333.355) (-335.273) (-335.754) -- 0:00:59
157500 -- (-329.271) [-329.964] (-330.906) (-329.433) * [-330.367] (-329.768) (-327.970) (-331.409) -- 0:00:58
158000 -- [-329.663] (-328.446) (-333.760) (-328.533) * (-329.165) [-329.746] (-331.288) (-328.801) -- 0:00:58
158500 -- (-328.761) (-332.224) [-329.966] (-329.222) * [-329.571] (-328.529) (-330.369) (-331.152) -- 0:00:58
159000 -- (-331.210) (-328.885) (-334.660) [-329.427] * [-328.726] (-329.762) (-327.732) (-330.753) -- 0:00:58
159500 -- [-329.025] (-329.061) (-330.710) (-328.274) * (-331.566) (-333.319) (-330.456) [-329.290] -- 0:00:57
160000 -- (-329.031) [-332.917] (-330.275) (-329.075) * (-331.446) (-331.374) [-327.915] (-328.983) -- 0:00:57
Average standard deviation of split frequencies: 0.020538
160500 -- [-330.001] (-328.875) (-330.625) (-329.588) * (-330.380) [-329.066] (-332.084) (-330.023) -- 0:00:57
161000 -- (-329.440) [-329.165] (-328.704) (-333.654) * (-330.918) (-330.975) [-329.720] (-328.850) -- 0:00:57
161500 -- (-329.761) [-328.456] (-329.971) (-328.771) * [-331.238] (-332.659) (-330.238) (-330.448) -- 0:00:57
162000 -- (-329.804) (-330.322) (-328.929) [-329.327] * [-330.345] (-330.016) (-329.293) (-329.200) -- 0:00:56
162500 -- [-330.028] (-330.152) (-328.228) (-329.611) * (-328.268) (-330.872) (-329.274) [-329.499] -- 0:00:56
163000 -- [-329.488] (-332.030) (-331.405) (-330.043) * (-328.235) [-328.471] (-329.108) (-328.912) -- 0:00:56
163500 -- (-328.914) [-327.989] (-332.407) (-327.935) * (-331.754) (-331.603) (-329.316) [-330.537] -- 0:00:56
164000 -- [-332.900] (-328.704) (-329.700) (-329.859) * (-333.720) (-331.445) (-329.699) [-331.506] -- 0:00:56
164500 -- (-329.379) (-332.701) [-327.888] (-329.670) * (-329.959) [-329.777] (-330.388) (-331.177) -- 0:00:55
165000 -- (-329.912) [-331.626] (-328.904) (-332.274) * (-328.396) (-328.917) (-328.957) [-329.773] -- 0:00:55
Average standard deviation of split frequencies: 0.018601
165500 -- (-329.008) [-329.313] (-331.848) (-329.631) * (-331.603) [-328.831] (-330.009) (-327.916) -- 0:00:55
166000 -- (-329.992) (-329.805) [-331.073] (-329.841) * (-328.062) (-330.248) [-329.404] (-329.128) -- 0:00:55
166500 -- (-330.861) [-329.615] (-329.184) (-328.547) * (-328.940) [-329.474] (-330.226) (-330.913) -- 0:00:55
167000 -- (-328.620) (-329.732) [-328.718] (-328.141) * (-332.625) (-331.851) [-330.407] (-331.538) -- 0:00:54
167500 -- (-329.180) (-333.230) (-331.430) [-328.208] * (-332.039) [-330.599] (-329.243) (-328.403) -- 0:00:54
168000 -- (-327.994) (-329.417) (-327.676) [-328.991] * (-329.811) (-329.902) [-328.912] (-327.774) -- 0:00:59
168500 -- (-328.024) (-329.509) (-327.393) [-329.209] * (-329.136) (-330.419) [-331.001] (-329.427) -- 0:00:59
169000 -- (-330.595) [-329.206] (-327.553) (-331.047) * (-327.735) [-328.158] (-329.375) (-328.615) -- 0:00:59
169500 -- (-328.016) (-331.578) [-329.684] (-329.758) * [-329.434] (-328.842) (-329.750) (-329.300) -- 0:00:58
170000 -- [-328.531] (-329.969) (-328.127) (-329.984) * [-329.392] (-330.352) (-330.956) (-332.234) -- 0:00:58
Average standard deviation of split frequencies: 0.015701
170500 -- (-331.934) [-330.046] (-328.474) (-332.876) * [-328.621] (-331.741) (-332.699) (-330.551) -- 0:00:58
171000 -- (-327.525) (-330.214) (-330.207) [-327.641] * (-329.125) (-329.817) (-332.950) [-328.383] -- 0:00:58
171500 -- (-329.715) [-328.556] (-328.976) (-329.335) * (-329.640) (-328.986) [-329.602] (-329.183) -- 0:00:57
172000 -- (-328.344) (-332.652) [-329.214] (-333.804) * (-329.747) [-328.666] (-328.410) (-328.647) -- 0:00:57
172500 -- (-328.054) (-330.456) [-329.366] (-330.614) * (-331.237) (-328.257) [-333.137] (-329.658) -- 0:00:57
173000 -- (-328.983) (-328.498) (-333.393) [-329.244] * (-328.606) (-328.435) [-329.534] (-329.415) -- 0:00:57
173500 -- (-329.303) (-329.567) (-330.534) [-329.726] * (-330.431) (-330.604) [-333.676] (-329.710) -- 0:00:57
174000 -- (-330.129) (-329.486) (-331.900) [-329.108] * [-330.043] (-331.520) (-331.297) (-328.552) -- 0:00:56
174500 -- (-328.647) [-329.420] (-329.973) (-331.035) * [-328.822] (-330.259) (-330.227) (-328.875) -- 0:00:56
175000 -- (-330.890) (-332.632) [-332.476] (-328.058) * [-328.985] (-330.870) (-335.073) (-327.876) -- 0:00:56
Average standard deviation of split frequencies: 0.015475
175500 -- (-330.957) [-329.566] (-331.392) (-330.793) * (-332.360) (-328.195) (-331.064) [-328.675] -- 0:00:56
176000 -- (-338.907) [-327.875] (-329.770) (-330.366) * (-328.445) [-328.070] (-329.721) (-332.623) -- 0:00:56
176500 -- (-337.002) (-327.468) [-329.407] (-328.399) * (-329.991) (-332.409) (-330.181) [-330.446] -- 0:00:55
177000 -- [-329.658] (-328.362) (-331.105) (-328.249) * (-332.821) (-331.249) [-329.203] (-329.571) -- 0:00:55
177500 -- (-331.693) [-327.638] (-330.600) (-330.681) * [-329.374] (-328.538) (-328.316) (-330.409) -- 0:00:55
178000 -- [-329.426] (-330.872) (-330.081) (-331.090) * (-328.426) (-328.565) [-330.197] (-328.135) -- 0:00:55
178500 -- (-331.815) (-329.114) (-330.280) [-330.548] * [-327.477] (-334.807) (-329.485) (-328.712) -- 0:00:55
179000 -- [-331.879] (-331.166) (-333.649) (-327.928) * [-329.464] (-330.451) (-328.343) (-332.732) -- 0:00:55
179500 -- (-330.972) [-328.558] (-332.318) (-327.650) * (-330.510) (-330.461) [-330.709] (-332.496) -- 0:00:54
180000 -- (-330.132) [-328.844] (-329.475) (-329.950) * (-328.663) (-331.563) [-331.614] (-329.144) -- 0:00:54
Average standard deviation of split frequencies: 0.014641
180500 -- [-330.451] (-329.400) (-327.838) (-330.500) * [-328.592] (-329.985) (-329.114) (-328.831) -- 0:00:54
181000 -- [-331.340] (-329.744) (-329.828) (-330.562) * (-332.713) (-329.483) [-328.898] (-329.245) -- 0:00:54
181500 -- (-335.613) [-327.920] (-329.055) (-331.611) * (-331.345) [-329.187] (-330.824) (-332.954) -- 0:00:54
182000 -- [-332.820] (-331.099) (-329.080) (-335.488) * (-334.061) (-329.795) [-330.868] (-330.672) -- 0:00:53
182500 -- [-329.098] (-330.200) (-332.584) (-331.341) * (-329.439) (-330.368) [-328.086] (-328.093) -- 0:00:58
183000 -- (-329.298) [-331.358] (-329.918) (-333.722) * (-329.726) (-332.814) (-327.549) [-329.371] -- 0:00:58
183500 -- [-328.549] (-331.786) (-332.383) (-329.996) * [-328.830] (-331.273) (-330.583) (-329.630) -- 0:00:57
184000 -- [-329.144] (-339.424) (-330.516) (-340.368) * (-331.041) [-327.952] (-330.836) (-331.086) -- 0:00:57
184500 -- (-331.095) [-332.561] (-329.107) (-329.542) * [-329.395] (-328.198) (-330.815) (-331.038) -- 0:00:57
185000 -- (-331.865) (-330.217) (-330.560) [-329.892] * (-336.541) [-329.577] (-332.745) (-328.686) -- 0:00:57
Average standard deviation of split frequencies: 0.014139
185500 -- (-328.632) (-329.360) [-334.699] (-330.961) * [-328.571] (-328.109) (-335.321) (-329.383) -- 0:00:57
186000 -- [-327.742] (-333.773) (-329.265) (-329.668) * (-328.364) (-332.390) [-329.640] (-328.640) -- 0:00:56
186500 -- (-328.772) (-328.655) [-329.859] (-328.602) * (-330.203) (-332.064) (-329.682) [-331.240] -- 0:00:56
187000 -- [-328.792] (-331.806) (-332.900) (-328.801) * (-330.518) (-337.526) [-328.448] (-329.479) -- 0:00:56
187500 -- (-330.334) (-331.956) [-332.156] (-328.700) * (-335.285) (-328.380) [-327.693] (-329.607) -- 0:00:56
188000 -- (-331.267) [-329.062] (-328.326) (-331.933) * (-328.772) (-329.976) [-327.948] (-328.457) -- 0:00:56
188500 -- (-331.578) [-328.449] (-331.023) (-330.928) * (-331.413) (-331.985) [-331.377] (-329.942) -- 0:00:55
189000 -- (-328.053) [-330.921] (-329.593) (-334.721) * [-329.517] (-329.726) (-328.715) (-329.532) -- 0:00:55
189500 -- (-334.518) (-328.007) (-328.282) [-330.757] * (-329.004) [-328.310] (-330.259) (-331.503) -- 0:00:55
190000 -- (-331.073) (-328.076) [-328.391] (-332.228) * (-329.639) (-331.433) [-329.983] (-328.753) -- 0:00:55
Average standard deviation of split frequencies: 0.014560
190500 -- [-329.960] (-330.804) (-330.677) (-329.592) * (-335.661) [-329.936] (-329.233) (-327.904) -- 0:00:55
191000 -- (-330.221) (-330.233) [-331.060] (-330.458) * (-338.050) [-327.899] (-328.323) (-328.670) -- 0:00:55
191500 -- (-328.759) [-328.204] (-332.531) (-329.525) * (-330.871) [-331.370] (-330.418) (-331.481) -- 0:00:54
192000 -- (-328.501) (-328.292) [-328.501] (-329.071) * (-327.991) (-328.820) [-328.903] (-330.363) -- 0:00:54
192500 -- (-332.713) (-328.782) [-329.595] (-329.083) * (-332.077) (-329.952) (-330.014) [-329.886] -- 0:00:54
193000 -- [-329.907] (-329.832) (-333.285) (-328.145) * (-330.412) [-330.828] (-329.925) (-329.117) -- 0:00:54
193500 -- [-328.466] (-330.366) (-327.957) (-332.342) * (-329.980) [-329.258] (-332.576) (-330.355) -- 0:00:54
194000 -- (-329.467) [-328.363] (-328.763) (-330.512) * (-331.584) (-328.224) (-330.951) [-329.226] -- 0:00:54
194500 -- [-329.004] (-330.734) (-329.395) (-332.125) * (-329.012) (-327.903) [-330.575] (-330.576) -- 0:00:53
195000 -- (-327.839) [-327.701] (-328.539) (-328.828) * (-332.596) [-328.755] (-332.064) (-335.214) -- 0:00:53
Average standard deviation of split frequencies: 0.015099
195500 -- [-330.113] (-334.087) (-328.407) (-328.150) * [-328.493] (-329.217) (-329.994) (-329.770) -- 0:00:53
196000 -- [-327.945] (-332.000) (-329.255) (-330.162) * (-330.394) [-328.608] (-330.331) (-329.528) -- 0:00:53
196500 -- (-329.443) (-329.228) [-330.934] (-331.030) * (-328.312) (-328.230) [-331.444] (-332.892) -- 0:00:53
197000 -- (-329.016) (-331.694) (-328.825) [-328.704] * [-329.496] (-332.342) (-332.936) (-329.696) -- 0:00:57
197500 -- (-329.241) [-329.713] (-329.456) (-328.851) * (-330.046) (-329.848) (-329.055) [-330.344] -- 0:00:56
198000 -- (-332.498) (-329.703) [-329.340] (-329.655) * (-328.859) (-337.026) [-329.920] (-331.481) -- 0:00:56
198500 -- (-331.716) (-328.816) [-329.322] (-329.063) * (-329.023) (-329.319) (-330.907) [-331.944] -- 0:00:56
199000 -- (-329.640) (-331.840) (-329.514) [-332.067] * [-328.177] (-331.899) (-330.733) (-329.900) -- 0:00:56
199500 -- (-327.722) (-327.621) (-331.697) [-328.052] * (-328.385) (-328.898) (-330.952) [-331.903] -- 0:00:56
200000 -- (-327.931) (-329.030) [-329.123] (-329.623) * (-329.188) (-331.286) (-328.126) [-331.547] -- 0:00:55
Average standard deviation of split frequencies: 0.014226
200500 -- [-328.394] (-330.179) (-331.055) (-329.982) * (-332.800) [-328.111] (-329.639) (-336.700) -- 0:00:55
201000 -- (-328.287) (-329.768) (-328.972) [-331.218] * [-329.387] (-328.836) (-330.993) (-331.004) -- 0:00:55
201500 -- (-329.105) (-335.856) [-332.339] (-328.598) * (-332.211) (-329.425) [-331.779] (-331.458) -- 0:00:55
202000 -- (-331.540) [-331.213] (-328.314) (-332.516) * (-328.669) (-331.265) (-332.859) [-328.606] -- 0:00:55
202500 -- (-331.340) (-328.974) [-331.170] (-329.319) * (-332.612) (-330.949) [-328.267] (-330.903) -- 0:00:55
203000 -- [-330.552] (-329.840) (-332.345) (-331.363) * (-333.458) (-328.569) (-330.621) [-327.333] -- 0:00:54
203500 -- (-328.846) (-330.677) (-331.403) [-332.191] * (-328.506) (-327.438) [-328.990] (-330.643) -- 0:00:54
204000 -- (-330.487) (-328.657) (-330.522) [-330.499] * (-328.411) [-329.032] (-329.445) (-331.130) -- 0:00:54
204500 -- (-331.824) [-329.953] (-330.005) (-330.074) * [-329.567] (-334.348) (-329.498) (-334.448) -- 0:00:54
205000 -- (-330.874) [-331.054] (-328.397) (-329.615) * (-327.947) (-338.395) (-327.686) [-330.597] -- 0:00:54
Average standard deviation of split frequencies: 0.015256
205500 -- (-330.335) [-331.472] (-329.226) (-327.739) * (-330.203) (-337.201) (-329.006) [-328.611] -- 0:00:54
206000 -- (-332.041) [-328.141] (-331.047) (-327.890) * (-332.421) (-330.881) (-329.967) [-329.057] -- 0:00:53
206500 -- (-332.207) (-329.167) (-328.626) [-328.947] * (-328.247) [-328.054] (-330.768) (-329.855) -- 0:00:53
207000 -- (-333.011) (-328.924) [-328.745] (-328.908) * (-329.340) (-332.157) (-330.839) [-328.823] -- 0:00:53
207500 -- (-332.380) (-331.070) (-329.275) [-329.005] * (-329.603) [-332.432] (-331.198) (-328.038) -- 0:00:53
208000 -- (-333.795) [-328.762] (-329.083) (-330.331) * (-327.762) (-329.712) (-330.150) [-331.489] -- 0:00:53
208500 -- [-328.572] (-329.304) (-330.495) (-329.487) * (-329.887) (-329.024) [-329.857] (-333.618) -- 0:00:53
209000 -- (-330.401) (-329.406) (-331.790) [-329.442] * (-331.135) (-331.610) [-328.860] (-328.885) -- 0:00:52
209500 -- (-331.245) (-329.643) [-335.634] (-327.393) * (-329.817) (-327.980) [-329.463] (-331.075) -- 0:00:52
210000 -- (-329.526) (-331.429) [-328.640] (-328.039) * (-330.509) [-329.054] (-333.433) (-330.478) -- 0:00:52
Average standard deviation of split frequencies: 0.015291
210500 -- (-329.983) (-329.312) (-328.166) [-330.203] * [-330.543] (-330.106) (-341.042) (-328.437) -- 0:00:52
211000 -- [-330.234] (-328.622) (-330.600) (-330.033) * (-329.155) (-330.094) (-339.813) [-329.079] -- 0:00:52
211500 -- [-332.963] (-333.185) (-333.391) (-335.016) * (-329.328) (-330.743) (-336.678) [-330.683] -- 0:00:55
212000 -- (-328.466) (-328.443) [-329.960] (-333.055) * (-328.622) [-328.158] (-336.817) (-334.323) -- 0:00:55
212500 -- (-330.512) (-328.577) (-328.478) [-331.493] * (-335.765) (-329.616) (-336.367) [-329.755] -- 0:00:55
213000 -- [-329.921] (-328.642) (-330.832) (-331.440) * (-330.081) (-328.284) [-327.944] (-328.928) -- 0:00:55
213500 -- (-330.164) (-330.755) [-330.700] (-331.200) * (-331.502) (-329.713) [-327.504] (-330.527) -- 0:00:55
214000 -- (-330.145) (-330.112) [-329.445] (-328.821) * [-328.613] (-328.677) (-332.285) (-328.857) -- 0:00:55
214500 -- (-328.295) (-335.462) (-328.192) [-327.953] * [-328.364] (-330.620) (-328.243) (-331.079) -- 0:00:54
215000 -- (-331.817) [-330.741] (-330.068) (-329.164) * (-330.412) [-333.697] (-327.683) (-328.444) -- 0:00:54
Average standard deviation of split frequencies: 0.014913
215500 -- (-329.375) (-329.981) [-329.085] (-330.064) * [-331.108] (-329.119) (-329.878) (-328.442) -- 0:00:54
216000 -- [-330.281] (-331.042) (-329.467) (-329.901) * (-328.605) [-331.972] (-330.101) (-333.304) -- 0:00:54
216500 -- (-327.824) [-329.523] (-329.309) (-335.697) * (-332.616) [-328.615] (-328.370) (-332.320) -- 0:00:54
217000 -- (-330.852) (-329.795) (-330.586) [-332.739] * [-329.802] (-329.910) (-329.991) (-330.684) -- 0:00:54
217500 -- [-334.480] (-328.280) (-330.167) (-329.761) * [-329.547] (-330.887) (-329.166) (-331.541) -- 0:00:53
218000 -- (-330.626) [-328.117] (-332.894) (-328.722) * (-329.395) [-330.398] (-328.680) (-329.816) -- 0:00:53
218500 -- (-328.633) (-329.545) [-330.024] (-329.134) * [-330.559] (-327.819) (-330.020) (-329.391) -- 0:00:53
219000 -- (-336.361) (-331.453) (-330.968) [-333.178] * [-327.667] (-330.771) (-329.133) (-328.824) -- 0:00:53
219500 -- (-332.274) [-328.827] (-328.992) (-329.667) * (-329.255) (-330.011) (-329.876) [-328.600] -- 0:00:53
220000 -- (-331.906) (-330.822) [-330.282] (-333.278) * (-329.025) (-329.320) (-335.116) [-327.712] -- 0:00:53
Average standard deviation of split frequencies: 0.013767
220500 -- (-328.928) (-334.458) (-330.409) [-329.620] * (-328.789) (-331.012) [-329.138] (-332.014) -- 0:00:53
221000 -- (-328.709) (-336.020) (-331.317) [-329.562] * [-329.049] (-330.890) (-330.363) (-331.451) -- 0:00:52
221500 -- (-328.017) (-334.509) (-331.305) [-330.128] * (-331.414) (-332.469) [-329.210] (-331.672) -- 0:00:52
222000 -- [-332.052] (-330.343) (-328.513) (-331.371) * (-327.973) [-329.406] (-329.154) (-330.314) -- 0:00:52
222500 -- (-331.272) [-328.840] (-329.964) (-328.258) * (-329.665) (-331.745) (-329.459) [-329.518] -- 0:00:52
223000 -- (-328.563) (-329.431) (-328.588) [-328.758] * (-331.780) [-335.525] (-329.969) (-328.016) -- 0:00:52
223500 -- [-328.569] (-328.515) (-330.169) (-329.284) * [-330.033] (-334.282) (-329.208) (-327.775) -- 0:00:52
224000 -- (-332.055) (-331.172) (-329.504) [-329.467] * (-330.146) (-337.272) (-328.497) [-328.549] -- 0:00:51
224500 -- [-327.850] (-328.675) (-330.104) (-329.938) * (-328.403) [-333.518] (-331.825) (-327.884) -- 0:00:51
225000 -- (-331.279) (-328.864) (-329.514) [-332.298] * (-328.783) [-327.610] (-330.697) (-329.921) -- 0:00:51
Average standard deviation of split frequencies: 0.013064
225500 -- (-333.717) (-329.642) [-328.754] (-328.993) * (-328.457) (-330.699) (-327.801) [-330.188] -- 0:00:51
226000 -- (-331.023) (-331.623) (-329.831) [-330.014] * (-331.344) (-334.007) [-328.838] (-327.496) -- 0:00:54
226500 -- (-327.800) (-336.351) (-327.837) [-330.383] * [-335.222] (-333.091) (-328.666) (-329.900) -- 0:00:54
227000 -- (-332.232) [-333.442] (-328.873) (-332.405) * (-331.260) [-329.085] (-329.991) (-329.375) -- 0:00:54
227500 -- (-329.863) (-330.159) (-329.066) [-328.117] * (-329.403) (-330.764) (-329.592) [-331.665] -- 0:00:54
228000 -- (-331.309) (-329.335) [-329.459] (-329.461) * [-327.810] (-329.191) (-331.117) (-328.685) -- 0:00:54
228500 -- (-328.882) (-327.557) (-328.919) [-329.165] * (-329.446) (-332.495) (-331.251) [-332.664] -- 0:00:54
229000 -- (-337.883) [-331.852] (-332.360) (-328.632) * (-329.991) (-331.486) [-328.724] (-328.201) -- 0:00:53
229500 -- [-331.754] (-330.574) (-329.746) (-331.533) * [-331.971] (-332.334) (-328.438) (-327.615) -- 0:00:53
230000 -- (-329.079) [-330.536] (-334.105) (-329.287) * (-328.495) (-328.138) (-328.375) [-328.822] -- 0:00:53
Average standard deviation of split frequencies: 0.011240
230500 -- [-328.292] (-329.140) (-330.864) (-330.806) * (-328.679) [-328.891] (-328.215) (-327.649) -- 0:00:53
231000 -- (-331.503) (-332.902) (-329.470) [-328.396] * (-329.378) [-329.665] (-328.154) (-332.217) -- 0:00:53
231500 -- (-328.897) (-331.641) (-328.840) [-328.631] * (-334.226) [-328.849] (-334.848) (-332.674) -- 0:00:53
232000 -- (-331.420) [-327.681] (-329.373) (-328.896) * (-330.098) (-329.232) [-332.053] (-328.248) -- 0:00:52
232500 -- (-328.672) (-332.522) [-329.989] (-329.933) * (-327.667) (-328.343) [-328.701] (-329.105) -- 0:00:52
233000 -- (-328.691) (-328.513) (-330.917) [-331.454] * [-332.716] (-329.798) (-329.083) (-328.536) -- 0:00:52
233500 -- (-329.035) (-328.289) [-328.819] (-332.099) * (-331.438) [-329.550] (-328.125) (-328.672) -- 0:00:52
234000 -- (-328.865) (-330.131) [-329.364] (-334.778) * (-331.635) (-329.817) (-329.476) [-330.038] -- 0:00:52
234500 -- (-332.289) (-327.420) (-328.501) [-328.186] * (-331.004) (-336.459) (-329.343) [-327.648] -- 0:00:52
235000 -- (-330.621) [-329.662] (-329.882) (-327.808) * (-333.936) [-329.767] (-330.072) (-329.148) -- 0:00:52
Average standard deviation of split frequencies: 0.011564
235500 -- (-328.906) (-330.913) (-329.248) [-331.532] * (-338.143) (-329.106) [-330.427] (-331.019) -- 0:00:51
236000 -- (-330.686) [-330.193] (-329.696) (-330.578) * (-335.435) (-330.498) (-334.080) [-331.190] -- 0:00:51
236500 -- (-328.760) (-328.038) [-327.433] (-329.909) * (-329.911) (-328.392) (-329.942) [-328.767] -- 0:00:51
237000 -- (-331.343) [-328.206] (-330.031) (-327.684) * [-330.078] (-328.862) (-333.628) (-328.964) -- 0:00:51
237500 -- (-331.337) (-330.058) (-328.775) [-328.885] * (-330.730) (-332.806) (-336.789) [-330.650] -- 0:00:51
238000 -- (-331.301) (-333.036) (-329.126) [-330.423] * (-329.727) [-328.880] (-334.182) (-329.117) -- 0:00:51
238500 -- (-330.299) [-328.650] (-330.423) (-327.934) * (-329.410) [-330.747] (-333.563) (-329.683) -- 0:00:51
239000 -- [-330.465] (-328.899) (-328.752) (-329.200) * (-330.669) [-328.085] (-331.308) (-330.769) -- 0:00:50
239500 -- (-330.697) (-334.850) [-328.459] (-328.469) * [-328.635] (-327.746) (-332.945) (-331.060) -- 0:00:50
240000 -- (-331.189) (-330.797) (-330.255) [-332.069] * [-329.357] (-332.489) (-335.434) (-331.606) -- 0:00:50
Average standard deviation of split frequencies: 0.011140
240500 -- (-331.834) (-330.555) (-331.736) [-329.461] * (-328.510) [-329.922] (-330.106) (-331.162) -- 0:00:50
241000 -- (-330.677) (-328.618) [-334.395] (-332.401) * (-332.884) (-329.961) [-328.284] (-331.927) -- 0:00:53
241500 -- (-329.300) [-330.926] (-333.886) (-328.719) * [-329.336] (-328.419) (-329.346) (-330.855) -- 0:00:53
242000 -- (-330.034) (-331.419) [-331.580] (-329.369) * (-328.562) (-329.472) (-331.147) [-329.397] -- 0:00:53
242500 -- (-330.656) (-330.110) (-328.239) [-329.696] * [-328.937] (-331.007) (-331.463) (-332.995) -- 0:00:53
243000 -- (-328.530) (-327.908) [-329.195] (-328.668) * [-329.058] (-334.891) (-328.770) (-328.128) -- 0:00:52
243500 -- (-329.044) [-331.528] (-331.467) (-329.086) * (-328.176) [-328.839] (-330.603) (-328.635) -- 0:00:52
244000 -- [-328.926] (-335.510) (-330.489) (-328.655) * (-330.250) (-334.944) (-328.537) [-327.714] -- 0:00:52
244500 -- (-330.270) (-330.533) [-330.205] (-328.237) * [-328.918] (-335.356) (-330.465) (-328.352) -- 0:00:52
245000 -- (-329.787) (-332.613) (-335.404) [-329.449] * (-330.388) (-333.777) (-328.628) [-334.548] -- 0:00:52
Average standard deviation of split frequencies: 0.012405
245500 -- [-330.263] (-332.571) (-328.016) (-330.135) * (-327.772) (-333.880) (-332.330) [-328.763] -- 0:00:52
246000 -- (-328.584) [-330.292] (-329.393) (-328.701) * (-329.833) (-330.025) [-329.959] (-329.795) -- 0:00:52
246500 -- (-330.480) [-327.837] (-332.604) (-329.649) * (-330.668) (-328.127) [-330.164] (-333.335) -- 0:00:51
247000 -- (-329.354) (-330.705) [-330.794] (-328.929) * (-328.945) (-328.343) (-329.359) [-328.368] -- 0:00:51
247500 -- (-329.766) (-328.850) [-329.008] (-331.330) * (-330.095) [-327.803] (-329.250) (-329.770) -- 0:00:51
248000 -- (-329.457) [-328.436] (-328.100) (-329.676) * (-329.603) [-331.354] (-328.363) (-330.070) -- 0:00:51
248500 -- (-330.104) (-328.801) [-329.486] (-330.320) * (-329.241) [-333.520] (-334.429) (-332.630) -- 0:00:51
249000 -- (-328.754) [-329.269] (-330.143) (-329.865) * [-330.010] (-329.764) (-330.399) (-332.583) -- 0:00:51
249500 -- (-328.787) (-331.088) (-329.895) [-328.216] * (-329.745) (-330.488) [-328.835] (-330.838) -- 0:00:51
250000 -- (-328.683) (-328.547) [-330.098] (-327.942) * [-329.927] (-331.266) (-328.425) (-329.634) -- 0:00:51
Average standard deviation of split frequencies: 0.010509
250500 -- (-328.836) (-330.673) [-332.131] (-330.091) * (-334.123) [-329.980] (-328.944) (-330.910) -- 0:00:50
251000 -- (-330.018) (-329.910) (-332.767) [-328.225] * (-329.431) (-330.811) (-328.468) [-329.538] -- 0:00:50
251500 -- [-330.554] (-332.950) (-332.546) (-330.201) * (-332.084) (-328.700) [-327.765] (-331.721) -- 0:00:50
252000 -- (-333.187) (-331.983) [-333.180] (-330.700) * [-329.029] (-329.080) (-329.875) (-330.035) -- 0:00:50
252500 -- (-329.925) (-330.192) (-334.305) [-329.099] * [-328.459] (-331.190) (-329.189) (-332.082) -- 0:00:50
253000 -- (-331.138) [-328.690] (-333.683) (-328.619) * [-330.154] (-329.540) (-330.818) (-330.165) -- 0:00:50
253500 -- (-330.726) (-331.826) [-329.271] (-330.818) * (-331.546) (-328.442) [-330.769] (-331.321) -- 0:00:50
254000 -- [-328.903] (-333.841) (-331.130) (-331.999) * (-328.097) (-330.915) (-328.097) [-329.451] -- 0:00:49
254500 -- (-331.770) (-331.433) (-331.028) [-331.064] * [-327.866] (-328.531) (-329.480) (-331.167) -- 0:00:49
255000 -- (-331.596) (-329.203) [-328.811] (-330.723) * (-328.315) (-328.211) (-333.077) [-329.269] -- 0:00:49
Average standard deviation of split frequencies: 0.011049
255500 -- (-328.353) (-335.133) [-328.569] (-333.011) * (-328.718) (-327.865) (-335.220) [-328.737] -- 0:00:52
256000 -- (-334.188) (-331.814) (-328.476) [-331.300] * (-337.692) [-329.350] (-331.641) (-331.684) -- 0:00:52
256500 -- [-328.992] (-331.103) (-333.943) (-329.926) * (-329.109) [-331.399] (-332.274) (-329.359) -- 0:00:52
257000 -- (-328.913) [-329.384] (-331.809) (-330.793) * (-327.793) (-336.308) (-331.988) [-329.013] -- 0:00:52
257500 -- (-329.521) [-329.612] (-331.834) (-331.865) * (-333.507) [-329.527] (-330.868) (-331.267) -- 0:00:51
258000 -- (-330.569) (-329.169) [-329.501] (-328.000) * (-331.109) (-329.167) [-331.630] (-329.683) -- 0:00:51
258500 -- (-335.825) (-328.768) [-329.189] (-328.989) * (-331.295) [-329.327] (-330.241) (-329.688) -- 0:00:51
259000 -- [-328.626] (-328.496) (-331.172) (-328.936) * (-329.019) (-331.335) [-327.662] (-329.396) -- 0:00:51
259500 -- (-330.612) [-328.008] (-331.745) (-327.500) * [-331.292] (-331.597) (-331.572) (-330.283) -- 0:00:51
260000 -- (-328.365) [-327.737] (-331.067) (-329.867) * (-328.908) (-331.202) [-331.571] (-331.650) -- 0:00:51
Average standard deviation of split frequencies: 0.013111
260500 -- [-329.338] (-329.574) (-328.094) (-330.263) * (-329.345) [-328.275] (-330.252) (-328.699) -- 0:00:51
261000 -- [-331.830] (-329.825) (-330.454) (-329.108) * (-327.852) (-329.765) [-328.510] (-328.336) -- 0:00:50
261500 -- (-328.710) (-328.196) (-331.510) [-329.568] * [-328.885] (-328.730) (-328.394) (-329.648) -- 0:00:50
262000 -- (-328.204) (-332.725) (-330.151) [-327.788] * (-328.788) (-329.372) (-328.944) [-328.950] -- 0:00:50
262500 -- (-329.967) [-330.817] (-332.671) (-328.609) * (-329.442) (-328.161) (-329.034) [-328.293] -- 0:00:50
263000 -- [-329.934] (-336.668) (-329.483) (-327.624) * (-328.481) [-332.821] (-328.320) (-327.895) -- 0:00:50
263500 -- [-328.094] (-331.306) (-328.202) (-327.900) * (-328.341) (-329.338) [-328.293] (-328.063) -- 0:00:50
264000 -- (-328.899) (-329.027) (-330.043) [-328.022] * [-329.440] (-328.686) (-330.116) (-332.398) -- 0:00:50
264500 -- (-331.996) (-329.130) [-332.586] (-331.035) * (-328.883) [-328.302] (-328.649) (-329.366) -- 0:00:50
265000 -- (-328.898) [-328.676] (-334.547) (-332.577) * (-330.420) [-328.965] (-328.677) (-329.972) -- 0:00:49
Average standard deviation of split frequencies: 0.013587
265500 -- (-329.191) [-329.421] (-330.577) (-332.020) * (-328.037) (-329.390) (-329.039) [-329.396] -- 0:00:49
266000 -- [-328.899] (-328.126) (-331.239) (-330.360) * [-328.632] (-329.081) (-329.475) (-328.386) -- 0:00:49
266500 -- (-328.830) [-328.760] (-332.928) (-331.659) * (-333.700) (-328.011) [-328.616] (-327.848) -- 0:00:49
267000 -- (-330.505) (-328.220) (-329.813) [-330.961] * (-329.335) (-327.745) [-330.909] (-330.930) -- 0:00:49
267500 -- (-329.558) (-329.543) (-336.140) [-329.280] * (-329.029) (-332.897) (-330.453) [-329.463] -- 0:00:49
268000 -- (-330.970) (-332.608) (-331.386) [-329.288] * (-329.015) (-332.997) [-333.359] (-328.141) -- 0:00:49
268500 -- (-329.022) (-329.714) [-330.250] (-328.206) * [-330.276] (-329.701) (-330.465) (-329.654) -- 0:00:49
269000 -- [-331.479] (-331.393) (-329.277) (-331.316) * [-330.503] (-329.004) (-330.476) (-328.167) -- 0:00:48
269500 -- [-328.299] (-328.653) (-331.226) (-331.685) * (-331.486) (-331.599) [-328.338] (-327.867) -- 0:00:48
270000 -- [-333.475] (-329.412) (-327.745) (-331.977) * [-330.400] (-330.416) (-331.250) (-330.584) -- 0:00:48
Average standard deviation of split frequencies: 0.013114
270500 -- (-330.404) (-332.974) [-329.494] (-329.369) * (-329.073) (-330.999) (-332.571) [-328.322] -- 0:00:51
271000 -- [-331.020] (-329.742) (-332.240) (-328.180) * (-333.270) (-329.011) (-329.316) [-329.328] -- 0:00:51
271500 -- [-330.392] (-330.947) (-331.458) (-329.141) * (-330.872) (-328.181) (-329.871) [-331.262] -- 0:00:50
272000 -- (-333.041) [-328.965] (-328.726) (-330.325) * (-334.200) (-332.046) [-330.274] (-330.558) -- 0:00:50
272500 -- (-330.483) [-328.980] (-331.601) (-328.904) * (-331.556) (-328.603) (-329.037) [-333.063] -- 0:00:50
273000 -- [-327.686] (-332.443) (-328.632) (-328.057) * (-334.060) (-330.139) [-328.644] (-331.780) -- 0:00:50
273500 -- (-328.431) [-330.581] (-327.993) (-329.846) * (-328.330) [-333.762] (-327.683) (-333.474) -- 0:00:50
274000 -- [-327.680] (-331.076) (-329.204) (-332.631) * (-330.422) (-331.826) [-327.972] (-329.024) -- 0:00:50
274500 -- (-330.038) (-330.385) (-328.040) [-328.285] * (-332.307) (-328.789) [-328.723] (-329.182) -- 0:00:50
275000 -- (-329.490) [-327.651] (-330.236) (-331.781) * (-333.510) (-328.116) [-330.185] (-331.044) -- 0:00:50
Average standard deviation of split frequencies: 0.013463
275500 -- (-329.948) [-330.149] (-334.538) (-329.154) * [-331.225] (-330.398) (-330.606) (-331.188) -- 0:00:49
276000 -- (-330.643) (-327.931) [-329.494] (-331.461) * [-332.123] (-330.941) (-332.170) (-332.122) -- 0:00:49
276500 -- (-328.860) [-328.112] (-332.116) (-332.370) * (-329.551) [-332.919] (-329.195) (-331.022) -- 0:00:49
277000 -- [-329.593] (-328.724) (-329.271) (-328.934) * (-330.502) (-328.926) [-329.156] (-328.323) -- 0:00:49
277500 -- (-330.430) (-328.415) [-330.552] (-329.719) * (-332.268) (-327.992) [-327.671] (-328.263) -- 0:00:49
278000 -- [-328.424] (-330.470) (-331.797) (-331.047) * (-335.609) [-332.549] (-333.192) (-328.386) -- 0:00:49
278500 -- (-329.778) [-331.090] (-329.406) (-334.002) * (-337.054) (-332.398) [-330.501] (-328.054) -- 0:00:49
279000 -- (-329.434) (-331.649) (-328.825) [-329.291] * (-330.815) (-329.560) (-327.943) [-329.216] -- 0:00:49
279500 -- (-328.384) (-329.574) [-329.262] (-328.351) * [-329.209] (-328.520) (-330.819) (-328.591) -- 0:00:48
280000 -- (-334.418) [-331.193] (-329.030) (-330.932) * [-330.549] (-332.801) (-332.906) (-330.357) -- 0:00:48
Average standard deviation of split frequencies: 0.013338
280500 -- [-330.947] (-329.235) (-330.222) (-330.843) * (-330.027) [-331.209] (-328.732) (-335.057) -- 0:00:48
281000 -- (-331.623) (-328.938) (-328.217) [-329.009] * (-331.456) (-329.812) (-328.712) [-328.465] -- 0:00:48
281500 -- (-327.865) [-330.414] (-329.555) (-329.324) * (-328.302) (-327.755) (-332.152) [-328.930] -- 0:00:48
282000 -- (-328.520) (-330.508) [-330.954] (-330.958) * (-330.383) [-329.904] (-330.387) (-332.091) -- 0:00:48
282500 -- [-329.517] (-329.646) (-328.744) (-330.477) * (-329.216) [-328.986] (-332.686) (-338.355) -- 0:00:48
283000 -- (-333.524) (-330.327) (-330.157) [-328.497] * (-329.677) (-330.647) (-329.678) [-329.148] -- 0:00:48
283500 -- (-334.200) (-331.513) (-331.386) [-329.024] * [-329.433] (-332.414) (-329.628) (-333.044) -- 0:00:48
284000 -- (-330.826) (-331.011) [-332.947] (-329.101) * (-329.205) (-332.682) [-329.470] (-330.812) -- 0:00:47
284500 -- (-328.816) (-329.676) (-341.917) [-329.147] * (-329.117) (-329.216) [-328.702] (-328.722) -- 0:00:47
285000 -- (-328.502) [-329.508] (-337.322) (-328.973) * [-329.624] (-329.851) (-328.055) (-330.267) -- 0:00:50
Average standard deviation of split frequencies: 0.012120
285500 -- (-330.545) [-330.882] (-330.603) (-330.463) * (-331.001) (-330.142) (-328.728) [-327.928] -- 0:00:50
286000 -- (-332.094) (-331.437) (-332.275) [-330.174] * (-328.362) (-331.880) [-329.111] (-330.131) -- 0:00:49
286500 -- (-329.806) [-329.868] (-331.693) (-328.384) * [-327.483] (-329.063) (-329.261) (-330.630) -- 0:00:49
287000 -- (-330.730) [-328.566] (-329.259) (-328.690) * (-328.024) (-330.126) [-328.770] (-331.738) -- 0:00:49
287500 -- (-328.825) (-332.385) (-329.062) [-327.702] * (-330.414) [-331.347] (-331.871) (-330.119) -- 0:00:49
288000 -- [-329.760] (-329.871) (-328.805) (-334.202) * (-334.282) (-330.332) (-331.315) [-331.839] -- 0:00:49
288500 -- (-331.375) [-329.292] (-329.246) (-334.321) * (-331.534) (-330.709) (-328.891) [-330.775] -- 0:00:49
289000 -- (-329.542) (-333.498) [-329.111] (-330.949) * (-330.460) [-329.411] (-329.771) (-328.984) -- 0:00:49
289500 -- (-333.201) [-330.153] (-330.003) (-333.858) * (-331.719) (-331.576) [-332.439] (-327.671) -- 0:00:49
290000 -- (-329.037) (-332.234) [-328.573] (-333.659) * (-328.981) [-328.715] (-340.947) (-327.786) -- 0:00:48
Average standard deviation of split frequencies: 0.012073
290500 -- [-329.525] (-339.086) (-333.686) (-327.779) * (-335.542) (-328.800) (-331.210) [-328.225] -- 0:00:48
291000 -- [-330.013] (-329.338) (-331.606) (-328.736) * (-332.025) [-331.139] (-330.537) (-328.035) -- 0:00:48
291500 -- [-331.054] (-328.819) (-334.444) (-329.854) * (-328.891) (-330.165) (-328.244) [-327.872] -- 0:00:48
292000 -- (-331.227) [-328.072] (-328.788) (-329.532) * (-328.032) (-332.136) [-332.689] (-328.211) -- 0:00:48
292500 -- (-332.361) [-332.525] (-330.333) (-328.066) * (-333.410) (-327.849) [-329.600] (-330.312) -- 0:00:48
293000 -- (-330.478) [-328.727] (-332.257) (-330.724) * (-333.541) [-328.737] (-329.523) (-327.977) -- 0:00:48
293500 -- (-331.250) [-329.092] (-328.832) (-330.657) * (-329.945) (-329.786) (-328.994) [-328.922] -- 0:00:48
294000 -- [-330.555] (-333.941) (-329.780) (-328.718) * (-330.362) (-335.087) (-329.240) [-329.503] -- 0:00:48
294500 -- [-328.091] (-333.227) (-330.004) (-331.065) * (-328.732) (-328.002) (-331.556) [-328.603] -- 0:00:47
295000 -- (-330.579) [-330.746] (-329.290) (-334.735) * [-328.218] (-329.022) (-328.817) (-330.182) -- 0:00:47
Average standard deviation of split frequencies: 0.013006
295500 -- (-334.415) (-327.947) [-328.215] (-331.086) * (-328.342) [-329.934] (-328.904) (-332.983) -- 0:00:47
296000 -- (-336.341) (-330.585) (-328.381) [-327.939] * (-331.305) (-329.434) (-330.075) [-329.404] -- 0:00:47
296500 -- (-329.996) (-328.787) [-328.266] (-329.981) * (-331.118) (-328.766) [-330.119] (-328.891) -- 0:00:47
297000 -- (-336.271) (-328.081) [-329.853] (-329.239) * [-331.254] (-328.567) (-329.698) (-327.590) -- 0:00:47
297500 -- [-329.041] (-329.242) (-331.808) (-330.029) * [-329.593] (-331.063) (-327.677) (-329.234) -- 0:00:47
298000 -- [-330.421] (-331.576) (-330.215) (-330.080) * (-331.321) [-331.772] (-327.952) (-330.173) -- 0:00:47
298500 -- (-331.768) (-332.616) (-327.527) [-328.700] * [-330.522] (-331.858) (-329.090) (-333.707) -- 0:00:47
299000 -- [-328.810] (-331.404) (-328.217) (-329.151) * (-330.733) [-336.609] (-329.484) (-330.698) -- 0:00:46
299500 -- [-329.899] (-329.700) (-328.931) (-333.174) * (-330.959) (-330.602) (-333.445) [-328.812] -- 0:00:49
300000 -- (-338.956) (-327.461) [-329.420] (-328.937) * (-332.646) (-331.303) [-329.490] (-332.799) -- 0:00:48
Average standard deviation of split frequencies: 0.012717
300500 -- (-331.866) [-328.621] (-331.183) (-331.174) * [-330.614] (-333.658) (-331.382) (-328.209) -- 0:00:48
301000 -- [-328.404] (-335.516) (-332.217) (-334.269) * (-331.394) (-335.684) (-328.915) [-330.718] -- 0:00:48
301500 -- (-327.976) (-334.052) [-332.949] (-329.763) * (-330.278) [-331.631] (-328.088) (-330.207) -- 0:00:48
302000 -- [-327.684] (-330.341) (-329.624) (-327.820) * (-329.663) (-328.336) [-329.659] (-331.951) -- 0:00:48
302500 -- [-328.799] (-333.346) (-329.718) (-329.582) * [-329.084] (-327.573) (-330.565) (-332.519) -- 0:00:48
303000 -- [-329.475] (-335.490) (-329.696) (-332.415) * [-329.750] (-329.886) (-329.037) (-329.877) -- 0:00:48
303500 -- (-330.309) [-331.060] (-329.721) (-328.780) * (-327.680) (-329.385) (-328.695) [-330.291] -- 0:00:48
304000 -- (-331.645) [-330.030] (-331.240) (-331.390) * [-328.991] (-329.103) (-331.376) (-329.035) -- 0:00:48
304500 -- [-331.233] (-330.317) (-327.400) (-330.203) * (-328.938) [-327.664] (-328.587) (-328.373) -- 0:00:47
305000 -- (-330.511) (-328.371) (-330.127) [-328.284] * (-328.329) (-328.792) (-331.923) [-329.355] -- 0:00:47
Average standard deviation of split frequencies: 0.012068
305500 -- [-332.551] (-329.829) (-330.032) (-330.521) * (-331.859) (-329.859) (-328.305) [-332.086] -- 0:00:47
306000 -- (-331.304) [-329.036] (-328.245) (-329.926) * (-329.557) (-332.366) (-331.369) [-329.250] -- 0:00:47
306500 -- (-329.154) [-328.735] (-332.413) (-327.936) * (-328.829) (-328.940) [-330.878] (-331.509) -- 0:00:47
307000 -- (-330.386) (-328.641) (-329.371) [-328.770] * (-331.142) (-329.261) (-328.382) [-330.825] -- 0:00:47
307500 -- (-329.972) (-327.899) (-331.432) [-330.577] * (-330.625) [-328.408] (-328.180) (-332.677) -- 0:00:47
308000 -- (-331.858) [-328.833] (-330.858) (-330.720) * (-329.893) [-328.240] (-331.393) (-334.204) -- 0:00:47
308500 -- (-330.802) (-329.164) [-330.514] (-330.837) * (-328.277) [-329.727] (-330.290) (-331.565) -- 0:00:47
309000 -- (-330.137) [-331.695] (-332.148) (-331.043) * (-330.591) [-332.392] (-329.653) (-330.909) -- 0:00:46
309500 -- (-329.180) (-333.764) [-330.659] (-329.903) * (-330.290) (-329.697) [-328.294] (-330.050) -- 0:00:46
310000 -- (-332.615) [-330.938] (-329.491) (-329.617) * (-328.122) (-331.192) [-328.575] (-331.016) -- 0:00:46
Average standard deviation of split frequencies: 0.011633
310500 -- (-329.141) (-331.852) [-328.890] (-328.061) * [-329.966] (-327.609) (-330.595) (-330.228) -- 0:00:46
311000 -- (-329.855) (-330.456) [-328.337] (-328.749) * (-329.036) (-327.687) (-330.765) [-332.865] -- 0:00:46
311500 -- (-329.095) (-329.249) [-329.165] (-329.121) * (-330.154) [-327.482] (-328.883) (-331.442) -- 0:00:46
312000 -- (-330.343) [-329.786] (-330.747) (-327.803) * [-330.083] (-329.490) (-328.988) (-328.410) -- 0:00:46
312500 -- (-330.607) (-330.933) (-332.525) [-327.767] * [-330.541] (-330.674) (-330.801) (-329.673) -- 0:00:46
313000 -- (-330.256) [-331.349] (-332.013) (-329.126) * (-330.821) (-327.973) [-328.764] (-328.591) -- 0:00:46
313500 -- (-330.575) [-331.189] (-329.042) (-330.939) * (-330.078) (-328.307) (-328.820) [-328.516] -- 0:00:45
314000 -- (-328.834) (-328.781) [-328.826] (-329.752) * (-330.508) (-328.378) (-331.987) [-328.516] -- 0:00:48
314500 -- (-330.000) (-327.849) (-330.491) [-328.015] * (-328.971) [-328.744] (-330.885) (-329.310) -- 0:00:47
315000 -- (-328.633) [-329.946] (-329.701) (-329.137) * (-329.166) (-331.339) [-329.887] (-329.663) -- 0:00:47
Average standard deviation of split frequencies: 0.011603
315500 -- (-330.601) (-328.757) [-329.709] (-329.279) * (-330.617) [-328.425] (-331.197) (-329.082) -- 0:00:47
316000 -- (-330.021) [-328.901] (-331.331) (-329.646) * [-328.279] (-331.346) (-331.339) (-328.299) -- 0:00:47
316500 -- [-328.381] (-328.411) (-330.820) (-331.470) * [-327.977] (-330.744) (-329.980) (-329.557) -- 0:00:47
317000 -- (-328.092) (-331.785) (-328.884) [-328.768] * (-327.938) [-331.137] (-327.943) (-328.905) -- 0:00:47
317500 -- (-328.728) (-332.538) (-328.465) [-329.141] * [-328.584] (-330.370) (-330.494) (-329.679) -- 0:00:47
318000 -- (-333.624) [-329.966] (-328.270) (-331.517) * (-330.010) (-330.385) [-332.082] (-331.123) -- 0:00:47
318500 -- (-329.701) (-330.040) [-329.666] (-327.997) * [-329.621] (-331.662) (-328.234) (-333.774) -- 0:00:47
319000 -- [-330.676] (-331.116) (-329.632) (-327.913) * (-330.230) [-329.209] (-329.213) (-328.170) -- 0:00:46
319500 -- (-333.328) (-328.599) (-329.574) [-328.822] * (-330.201) [-329.349] (-328.946) (-328.405) -- 0:00:46
320000 -- (-331.886) [-329.266] (-327.831) (-328.786) * [-328.800] (-330.153) (-328.347) (-330.491) -- 0:00:46
Average standard deviation of split frequencies: 0.012036
320500 -- (-331.809) (-330.224) [-328.083] (-331.750) * (-330.164) [-328.952] (-329.037) (-333.193) -- 0:00:46
321000 -- [-333.789] (-328.263) (-328.206) (-329.930) * (-327.963) (-330.504) (-329.040) [-328.441] -- 0:00:46
321500 -- (-332.438) (-329.222) [-329.254] (-328.475) * (-330.993) (-330.544) (-330.370) [-328.731] -- 0:00:46
322000 -- (-329.425) [-329.061] (-331.032) (-328.774) * (-327.753) (-327.874) [-331.956] (-333.368) -- 0:00:46
322500 -- (-331.624) (-329.724) [-329.014] (-328.526) * (-328.123) [-328.225] (-330.129) (-334.271) -- 0:00:46
323000 -- (-328.174) [-329.539] (-328.550) (-331.422) * (-329.041) (-329.166) (-332.298) [-328.494] -- 0:00:46
323500 -- (-331.683) [-329.958] (-328.335) (-329.649) * [-331.222] (-328.343) (-328.839) (-328.114) -- 0:00:46
324000 -- (-330.469) (-331.337) [-328.527] (-329.531) * [-328.532] (-329.359) (-328.651) (-331.050) -- 0:00:45
324500 -- (-328.319) (-329.485) [-329.578] (-332.113) * (-328.192) (-329.007) [-331.581] (-327.775) -- 0:00:45
325000 -- (-328.536) (-330.844) (-331.712) [-328.436] * [-330.287] (-330.264) (-332.115) (-329.495) -- 0:00:45
Average standard deviation of split frequencies: 0.011653
325500 -- (-329.179) [-330.435] (-330.310) (-328.046) * (-329.733) [-327.982] (-330.312) (-330.670) -- 0:00:45
326000 -- (-331.517) (-329.494) [-328.185] (-330.355) * [-332.962] (-328.693) (-332.066) (-329.612) -- 0:00:45
326500 -- (-331.888) (-329.307) [-328.886] (-328.466) * (-328.994) [-328.352] (-329.005) (-331.791) -- 0:00:45
327000 -- (-329.739) [-330.217] (-328.022) (-329.008) * [-327.821] (-329.670) (-328.051) (-330.193) -- 0:00:45
327500 -- (-333.580) (-328.985) (-329.712) [-329.581] * (-330.785) (-328.609) [-328.759] (-331.511) -- 0:00:45
328000 -- [-329.873] (-332.328) (-328.399) (-330.694) * (-336.690) (-328.136) (-331.206) [-330.475] -- 0:00:45
328500 -- (-329.639) (-331.456) [-333.154] (-332.011) * (-329.523) [-327.483] (-330.886) (-329.480) -- 0:00:47
329000 -- (-329.166) (-335.549) [-330.810] (-331.147) * (-331.213) [-330.418] (-335.646) (-331.198) -- 0:00:46
329500 -- (-332.516) [-331.641] (-328.137) (-329.283) * [-329.213] (-331.140) (-335.638) (-331.676) -- 0:00:46
330000 -- (-334.288) [-330.020] (-328.580) (-330.393) * [-329.644] (-328.115) (-330.056) (-333.403) -- 0:00:46
Average standard deviation of split frequencies: 0.011227
330500 -- (-329.130) [-331.264] (-338.131) (-329.604) * [-328.994] (-336.149) (-330.217) (-333.144) -- 0:00:46
331000 -- [-330.982] (-329.204) (-336.248) (-332.109) * (-329.699) (-329.476) [-330.221] (-332.123) -- 0:00:46
331500 -- [-329.391] (-328.087) (-328.992) (-331.319) * (-330.224) (-329.033) [-330.353] (-327.532) -- 0:00:46
332000 -- (-329.682) [-328.798] (-334.087) (-332.048) * (-328.667) (-330.175) [-328.884] (-330.349) -- 0:00:46
332500 -- [-328.409] (-330.217) (-330.687) (-329.812) * (-329.025) [-329.452] (-330.863) (-330.822) -- 0:00:46
333000 -- [-328.212] (-328.866) (-328.219) (-330.961) * (-330.057) [-330.561] (-332.796) (-331.771) -- 0:00:46
333500 -- [-329.235] (-329.669) (-330.798) (-328.463) * (-328.178) [-330.108] (-333.261) (-333.497) -- 0:00:45
334000 -- (-329.848) (-331.780) [-328.540] (-328.913) * [-328.376] (-329.081) (-331.948) (-331.630) -- 0:00:45
334500 -- [-332.325] (-329.174) (-327.690) (-333.134) * (-330.512) [-330.046] (-332.993) (-331.627) -- 0:00:45
335000 -- (-329.052) (-329.853) [-332.233] (-336.714) * (-327.876) [-328.690] (-330.900) (-330.655) -- 0:00:45
Average standard deviation of split frequencies: 0.010785
335500 -- (-335.178) [-331.378] (-330.070) (-331.772) * (-329.946) (-328.144) [-329.062] (-331.385) -- 0:00:45
336000 -- (-332.395) (-331.628) [-328.944] (-329.024) * (-333.430) (-329.824) (-328.701) [-327.871] -- 0:00:45
336500 -- (-335.527) [-328.861] (-329.924) (-333.237) * (-329.569) (-331.157) (-328.100) [-332.435] -- 0:00:45
337000 -- (-330.157) (-328.776) (-329.646) [-329.267] * [-328.838] (-328.707) (-327.696) (-330.841) -- 0:00:45
337500 -- (-330.445) (-329.487) [-334.023] (-328.789) * (-330.149) [-327.638] (-328.930) (-329.171) -- 0:00:45
338000 -- [-328.901] (-330.796) (-330.818) (-331.985) * (-332.420) (-327.965) [-328.748] (-330.288) -- 0:00:45
338500 -- [-328.261] (-330.200) (-330.949) (-330.520) * (-329.954) (-328.844) (-328.484) [-330.009] -- 0:00:44
339000 -- [-328.030] (-331.050) (-330.334) (-329.540) * (-330.830) [-328.337] (-332.038) (-331.440) -- 0:00:44
339500 -- [-327.470] (-328.479) (-332.730) (-328.672) * (-329.237) (-332.755) [-329.608] (-328.918) -- 0:00:44
340000 -- (-331.942) (-333.544) [-330.173] (-333.725) * (-333.055) (-329.536) [-328.849] (-330.967) -- 0:00:44
Average standard deviation of split frequencies: 0.010984
340500 -- [-330.432] (-328.961) (-331.267) (-331.912) * (-328.322) (-328.444) [-328.261] (-328.519) -- 0:00:44
341000 -- (-328.939) [-328.369] (-328.814) (-329.959) * (-331.768) (-329.438) [-328.060] (-328.434) -- 0:00:44
341500 -- [-330.384] (-328.857) (-327.718) (-332.343) * (-331.115) (-329.471) (-330.017) [-330.216] -- 0:00:44
342000 -- (-329.614) [-330.578] (-329.122) (-338.449) * (-330.934) (-329.300) [-330.510] (-331.553) -- 0:00:44
342500 -- (-328.187) (-329.895) (-331.594) [-332.520] * (-328.771) (-330.530) (-331.339) [-328.402] -- 0:00:44
343000 -- (-328.607) [-329.626] (-331.250) (-330.138) * (-332.330) (-332.122) (-331.805) [-330.602] -- 0:00:45
343500 -- (-332.359) [-330.480] (-331.831) (-329.122) * [-327.739] (-328.646) (-330.328) (-330.609) -- 0:00:45
344000 -- [-328.139] (-333.101) (-328.194) (-328.282) * (-328.757) (-328.900) [-330.876] (-328.623) -- 0:00:45
344500 -- (-334.849) [-328.669] (-333.587) (-328.258) * [-328.142] (-329.050) (-328.433) (-327.865) -- 0:00:45
345000 -- (-329.666) (-330.050) (-330.261) [-331.277] * (-328.926) (-327.874) (-329.421) [-328.111] -- 0:00:45
Average standard deviation of split frequencies: 0.010499
345500 -- (-329.251) (-329.248) [-330.020] (-331.217) * [-329.546] (-331.498) (-331.854) (-329.965) -- 0:00:45
346000 -- (-328.439) (-329.198) [-334.088] (-328.725) * (-329.163) (-329.472) [-328.980] (-330.565) -- 0:00:45
346500 -- (-329.752) (-332.067) [-329.258] (-329.736) * [-329.005] (-327.627) (-328.590) (-328.816) -- 0:00:45
347000 -- (-328.757) (-329.452) [-329.270] (-331.731) * (-330.140) [-327.893] (-333.170) (-332.037) -- 0:00:45
347500 -- (-330.156) (-332.478) [-330.161] (-329.236) * (-332.688) [-331.260] (-329.559) (-330.576) -- 0:00:45
348000 -- (-329.226) (-332.243) [-332.796] (-329.180) * (-330.809) [-331.205] (-327.937) (-329.653) -- 0:00:44
348500 -- (-328.372) (-330.620) [-329.184] (-332.624) * (-328.372) (-329.962) (-332.159) [-331.188] -- 0:00:44
349000 -- [-330.122] (-330.325) (-334.309) (-334.559) * (-329.540) (-328.573) (-332.691) [-330.183] -- 0:00:44
349500 -- (-331.950) (-334.702) (-330.011) [-329.900] * (-331.416) (-328.002) [-327.988] (-331.149) -- 0:00:44
350000 -- (-329.639) [-329.533] (-329.127) (-329.283) * (-330.596) [-329.197] (-329.289) (-329.982) -- 0:00:44
Average standard deviation of split frequencies: 0.010834
350500 -- (-329.956) [-328.457] (-327.611) (-330.150) * [-328.923] (-330.396) (-333.104) (-328.706) -- 0:00:44
351000 -- (-328.560) (-329.818) (-330.980) [-329.687] * (-328.160) (-329.799) (-329.552) [-329.131] -- 0:00:44
351500 -- (-329.343) (-328.100) [-328.027] (-330.208) * [-333.459] (-332.718) (-330.225) (-328.837) -- 0:00:44
352000 -- (-327.751) (-328.610) (-330.512) [-328.764] * [-331.972] (-329.457) (-328.131) (-333.061) -- 0:00:44
352500 -- (-330.762) (-334.680) (-333.049) [-328.245] * (-329.799) (-335.004) (-330.319) [-330.337] -- 0:00:44
353000 -- (-328.276) (-329.681) [-330.433] (-328.524) * (-331.383) (-329.366) [-329.048] (-327.952) -- 0:00:43
353500 -- (-331.275) (-330.466) [-328.459] (-328.643) * [-332.211] (-331.042) (-329.973) (-327.540) -- 0:00:43
354000 -- (-332.389) (-330.702) [-330.613] (-328.779) * (-331.347) (-333.710) (-330.861) [-328.142] -- 0:00:43
354500 -- (-331.601) (-334.413) [-327.710] (-330.950) * (-328.426) (-331.344) (-330.760) [-328.341] -- 0:00:43
355000 -- (-333.821) [-328.355] (-329.627) (-329.547) * [-329.315] (-331.472) (-332.776) (-327.689) -- 0:00:43
Average standard deviation of split frequencies: 0.010180
355500 -- [-333.379] (-330.339) (-330.470) (-330.749) * [-328.433] (-329.788) (-330.989) (-330.531) -- 0:00:43
356000 -- (-331.925) [-330.030] (-330.703) (-328.927) * (-332.096) (-334.531) [-327.709] (-331.631) -- 0:00:43
356500 -- (-329.535) [-330.458] (-329.650) (-332.827) * (-328.002) [-330.313] (-333.489) (-334.627) -- 0:00:43
357000 -- (-328.196) (-330.848) [-336.416] (-331.356) * (-331.934) [-329.542] (-335.370) (-331.342) -- 0:00:43
357500 -- (-333.154) (-328.202) (-331.298) [-329.200] * [-329.766] (-328.631) (-330.205) (-335.644) -- 0:00:44
358000 -- [-330.759] (-328.596) (-332.934) (-328.747) * (-330.272) (-328.080) (-330.275) [-328.156] -- 0:00:44
358500 -- [-331.234] (-330.363) (-332.078) (-327.607) * (-332.820) [-328.035] (-333.674) (-330.617) -- 0:00:44
359000 -- (-328.830) (-331.293) (-330.574) [-330.559] * (-331.973) (-328.781) (-328.271) [-329.964] -- 0:00:44
359500 -- (-330.577) (-327.959) (-333.264) [-329.019] * (-330.162) (-327.608) [-329.614] (-328.229) -- 0:00:44
360000 -- (-330.526) (-329.397) (-333.462) [-330.827] * (-328.904) [-327.657] (-329.900) (-330.660) -- 0:00:44
Average standard deviation of split frequencies: 0.009721
360500 -- (-331.226) (-333.023) [-331.949] (-329.814) * [-328.571] (-329.121) (-328.892) (-330.889) -- 0:00:44
361000 -- (-328.118) [-328.873] (-328.961) (-330.498) * (-330.319) (-329.926) [-328.603] (-330.249) -- 0:00:44
361500 -- (-328.783) (-330.753) [-328.263] (-328.875) * (-330.981) (-329.303) [-329.036] (-329.225) -- 0:00:44
362000 -- [-328.072] (-336.191) (-330.307) (-330.182) * (-329.491) [-328.526] (-329.236) (-331.466) -- 0:00:44
362500 -- (-332.840) (-334.043) [-329.976] (-328.801) * (-330.457) [-328.868] (-332.439) (-331.422) -- 0:00:43
363000 -- (-329.299) (-330.445) (-333.975) [-331.753] * (-327.764) [-330.858] (-329.865) (-329.100) -- 0:00:43
363500 -- (-331.427) (-329.584) [-328.603] (-329.493) * (-329.177) (-331.292) [-329.210] (-332.348) -- 0:00:43
364000 -- [-329.250] (-336.406) (-329.163) (-328.413) * (-328.332) (-334.019) (-328.006) [-329.792] -- 0:00:43
364500 -- (-328.424) (-329.399) [-330.434] (-329.462) * (-327.844) [-331.575] (-332.136) (-328.199) -- 0:00:43
365000 -- (-328.914) (-328.536) [-330.985] (-330.260) * [-328.530] (-329.351) (-331.737) (-328.792) -- 0:00:43
Average standard deviation of split frequencies: 0.009901
365500 -- (-327.778) (-330.341) (-328.307) [-334.241] * (-328.662) (-330.074) (-329.271) [-327.960] -- 0:00:43
366000 -- [-328.605] (-329.280) (-329.393) (-336.843) * (-328.849) (-327.865) (-330.331) [-329.904] -- 0:00:43
366500 -- (-327.772) (-330.169) [-330.572] (-331.963) * (-328.011) (-329.849) (-328.351) [-329.189] -- 0:00:43
367000 -- (-328.838) (-328.330) [-331.353] (-328.032) * (-328.865) (-328.406) [-328.643] (-329.246) -- 0:00:43
367500 -- (-330.918) [-332.683] (-332.307) (-329.912) * (-329.115) (-330.533) [-330.153] (-329.443) -- 0:00:43
368000 -- (-332.389) [-331.623] (-333.857) (-329.155) * (-327.866) [-329.836] (-328.815) (-331.780) -- 0:00:42
368500 -- (-334.684) (-331.209) (-329.933) [-331.332] * (-329.006) [-330.778] (-328.644) (-329.071) -- 0:00:42
369000 -- (-333.431) (-329.292) [-328.563] (-330.233) * (-329.785) (-328.975) (-329.815) [-327.892] -- 0:00:42
369500 -- (-329.188) (-332.633) (-330.345) [-329.246] * (-331.300) [-330.921] (-335.939) (-327.437) -- 0:00:42
370000 -- [-330.084] (-329.620) (-330.168) (-329.642) * (-329.145) (-328.208) (-332.558) [-328.342] -- 0:00:42
Average standard deviation of split frequencies: 0.009697
370500 -- [-329.285] (-330.614) (-328.279) (-328.630) * (-334.513) [-328.480] (-328.308) (-328.031) -- 0:00:42
371000 -- (-330.129) (-328.287) [-328.997] (-328.663) * [-331.542] (-329.675) (-329.386) (-328.256) -- 0:00:42
371500 -- (-328.948) [-328.894] (-328.251) (-330.354) * (-329.463) [-329.287] (-330.205) (-330.065) -- 0:00:42
372000 -- (-334.075) [-329.348] (-330.211) (-329.017) * (-331.794) [-330.255] (-335.605) (-329.233) -- 0:00:43
372500 -- [-330.232] (-330.346) (-329.277) (-328.654) * (-330.076) [-329.971] (-331.055) (-329.678) -- 0:00:43
373000 -- [-328.321] (-330.897) (-329.858) (-328.535) * (-330.336) (-330.861) [-330.355] (-333.249) -- 0:00:43
373500 -- (-328.744) (-329.238) [-329.676] (-330.427) * [-328.705] (-331.909) (-331.813) (-328.986) -- 0:00:43
374000 -- (-330.011) (-328.970) [-329.573] (-334.846) * (-329.096) (-329.631) (-330.929) [-328.498] -- 0:00:43
374500 -- (-332.997) (-332.584) (-327.894) [-331.705] * [-330.555] (-329.488) (-327.716) (-329.213) -- 0:00:43
375000 -- [-330.398] (-330.443) (-331.711) (-330.569) * (-328.768) (-329.213) [-327.704] (-330.643) -- 0:00:43
Average standard deviation of split frequencies: 0.009011
375500 -- (-331.813) [-328.799] (-330.557) (-332.117) * (-329.285) (-329.779) [-331.722] (-328.539) -- 0:00:43
376000 -- (-331.250) [-330.764] (-330.978) (-330.229) * [-330.568] (-328.366) (-333.878) (-328.672) -- 0:00:43
376500 -- (-330.107) [-332.544] (-328.694) (-329.181) * (-329.255) (-328.777) (-329.124) [-331.218] -- 0:00:43
377000 -- (-327.697) (-331.162) [-328.717] (-328.593) * (-328.422) [-329.043] (-330.685) (-331.493) -- 0:00:42
377500 -- (-329.487) [-330.103] (-328.642) (-330.061) * [-330.723] (-328.779) (-332.348) (-329.098) -- 0:00:42
378000 -- [-328.054] (-328.038) (-330.656) (-328.592) * (-328.159) [-328.983] (-328.825) (-328.760) -- 0:00:42
378500 -- [-328.954] (-330.418) (-329.991) (-329.190) * [-328.427] (-330.367) (-330.256) (-330.799) -- 0:00:42
379000 -- (-331.319) (-328.064) [-328.812] (-334.649) * [-329.769] (-329.968) (-333.917) (-330.634) -- 0:00:42
379500 -- (-329.984) (-330.321) (-327.896) [-327.943] * (-328.117) (-330.466) (-332.422) [-328.481] -- 0:00:42
380000 -- (-333.875) (-332.447) (-331.621) [-328.732] * [-329.241] (-328.403) (-330.759) (-329.549) -- 0:00:42
Average standard deviation of split frequencies: 0.010139
380500 -- [-332.836] (-329.423) (-331.469) (-330.974) * (-329.284) [-329.786] (-328.687) (-328.247) -- 0:00:42
381000 -- (-329.763) [-330.458] (-328.993) (-327.689) * (-331.578) (-329.668) [-330.468] (-328.974) -- 0:00:42
381500 -- (-328.832) (-330.590) (-331.126) [-330.612] * (-329.543) [-329.487] (-327.819) (-328.993) -- 0:00:42
382000 -- (-328.953) (-330.617) (-329.051) [-328.897] * (-329.770) (-330.943) (-329.777) [-330.700] -- 0:00:42
382500 -- (-327.496) [-329.346] (-328.310) (-328.773) * (-328.542) [-330.451] (-336.532) (-333.680) -- 0:00:41
383000 -- (-330.349) (-331.662) (-331.379) [-329.364] * (-332.464) (-331.240) (-331.379) [-332.732] -- 0:00:41
383500 -- (-330.452) [-332.764] (-329.171) (-330.043) * (-330.965) (-329.670) [-329.462] (-332.723) -- 0:00:41
384000 -- [-328.455] (-329.704) (-329.567) (-333.395) * [-328.859] (-331.971) (-329.307) (-333.507) -- 0:00:41
384500 -- (-329.680) (-330.035) [-328.780] (-331.195) * (-330.325) [-329.628] (-329.953) (-330.850) -- 0:00:41
385000 -- (-331.012) [-327.919] (-330.781) (-331.606) * (-329.573) (-329.246) [-328.711] (-331.304) -- 0:00:41
Average standard deviation of split frequencies: 0.010228
385500 -- (-328.242) (-329.956) (-330.623) [-331.961] * (-330.031) (-330.122) [-328.520] (-331.473) -- 0:00:41
386000 -- (-328.293) (-331.340) [-328.390] (-328.396) * (-330.807) (-328.730) (-328.176) [-328.376] -- 0:00:41
386500 -- (-330.044) (-331.984) (-329.130) [-328.309] * (-329.440) (-332.452) [-332.367] (-329.798) -- 0:00:42
387000 -- (-328.697) (-328.843) [-329.799] (-328.629) * [-328.190] (-331.035) (-333.069) (-330.357) -- 0:00:42
387500 -- (-332.602) (-330.651) (-329.371) [-329.621] * [-330.719] (-332.744) (-333.364) (-329.285) -- 0:00:42
388000 -- (-330.078) (-330.587) (-329.249) [-328.044] * [-329.886] (-330.169) (-331.720) (-328.044) -- 0:00:42
388500 -- (-331.223) (-329.051) (-328.616) [-327.550] * [-329.511] (-332.071) (-328.702) (-328.308) -- 0:00:42
389000 -- (-329.971) (-328.021) (-333.526) [-329.601] * (-329.332) (-330.816) [-327.986] (-329.650) -- 0:00:42
389500 -- (-332.228) [-328.039] (-331.233) (-328.731) * (-331.151) (-328.583) (-331.147) [-332.592] -- 0:00:42
390000 -- (-330.257) [-327.792] (-329.656) (-329.840) * (-330.216) (-328.206) [-330.396] (-332.340) -- 0:00:42
Average standard deviation of split frequencies: 0.010408
390500 -- (-330.709) (-330.675) (-328.111) [-330.877] * (-331.750) (-327.925) [-329.548] (-336.879) -- 0:00:42
391000 -- [-328.354] (-329.751) (-328.787) (-328.930) * (-333.620) (-327.432) (-328.311) [-327.997] -- 0:00:42
391500 -- (-329.356) (-333.401) [-327.805] (-330.377) * (-331.376) (-331.087) [-328.571] (-329.469) -- 0:00:41
392000 -- (-328.770) [-328.807] (-330.707) (-329.849) * (-328.043) (-327.600) (-332.792) [-328.419] -- 0:00:41
392500 -- [-329.247] (-328.532) (-335.938) (-330.804) * (-329.587) (-328.001) [-328.004] (-333.956) -- 0:00:41
393000 -- (-331.559) (-330.007) (-329.647) [-328.317] * (-331.694) (-330.658) [-329.747] (-328.956) -- 0:00:41
393500 -- (-332.262) (-329.072) [-329.177] (-331.433) * (-330.785) (-334.840) (-329.013) [-328.817] -- 0:00:41
394000 -- (-330.672) (-330.296) [-331.741] (-330.824) * [-330.402] (-336.141) (-329.829) (-328.472) -- 0:00:41
394500 -- (-327.892) [-328.176] (-330.413) (-330.330) * (-333.954) (-330.028) (-329.122) [-331.354] -- 0:00:41
395000 -- (-330.066) [-328.401] (-330.329) (-328.189) * (-333.212) (-329.593) (-331.351) [-331.653] -- 0:00:41
Average standard deviation of split frequencies: 0.010491
395500 -- (-328.882) (-334.961) [-328.157] (-333.057) * (-333.464) (-334.168) (-330.915) [-328.855] -- 0:00:41
396000 -- (-329.782) (-329.357) (-330.757) [-331.162] * (-335.593) [-329.457] (-331.403) (-328.656) -- 0:00:41
396500 -- [-334.867] (-329.626) (-328.905) (-329.723) * [-331.703] (-329.476) (-331.707) (-328.299) -- 0:00:41
397000 -- (-330.523) [-327.805] (-331.031) (-331.187) * (-332.911) [-328.533] (-331.248) (-329.249) -- 0:00:41
397500 -- (-331.819) (-327.978) (-331.581) [-328.202] * (-332.123) [-332.659] (-329.015) (-327.698) -- 0:00:40
398000 -- (-331.708) [-328.345] (-329.439) (-329.710) * (-331.861) [-332.302] (-331.083) (-328.121) -- 0:00:40
398500 -- (-330.588) (-329.781) [-330.580] (-329.289) * (-329.925) (-332.022) [-332.361] (-333.785) -- 0:00:40
399000 -- [-329.004] (-329.338) (-330.303) (-329.155) * [-330.776] (-330.048) (-329.799) (-328.811) -- 0:00:40
399500 -- [-328.686] (-334.854) (-329.235) (-329.320) * [-329.376] (-327.704) (-328.273) (-332.408) -- 0:00:40
400000 -- (-333.399) (-336.819) (-333.176) [-328.265] * (-332.325) (-330.218) [-329.591] (-330.697) -- 0:00:40
Average standard deviation of split frequencies: 0.010736
400500 -- (-329.159) (-336.187) (-329.774) [-329.999] * (-333.510) (-339.917) (-333.003) [-333.274] -- 0:00:40
401000 -- [-328.484] (-330.641) (-331.098) (-329.854) * (-335.212) [-335.110] (-335.362) (-328.736) -- 0:00:41
401500 -- (-330.788) (-328.757) [-330.088] (-328.174) * [-329.949] (-331.445) (-332.757) (-330.141) -- 0:00:41
402000 -- [-328.391] (-327.939) (-329.752) (-328.757) * (-329.970) (-330.232) (-335.364) [-329.684] -- 0:00:41
402500 -- (-328.792) [-329.756] (-331.210) (-327.808) * (-331.894) [-330.723] (-329.075) (-328.932) -- 0:00:41
403000 -- (-329.147) (-329.946) (-328.537) [-329.918] * (-333.164) [-328.805] (-328.424) (-330.369) -- 0:00:41
403500 -- (-332.482) [-327.631] (-329.931) (-329.924) * (-329.153) [-329.724] (-328.883) (-330.114) -- 0:00:41
404000 -- (-330.072) [-330.669] (-327.457) (-330.073) * (-331.566) [-332.467] (-328.274) (-329.033) -- 0:00:41
404500 -- (-329.087) [-329.723] (-328.424) (-330.571) * (-331.088) (-327.999) (-329.855) [-327.471] -- 0:00:41
405000 -- (-327.497) (-330.531) [-328.454] (-332.900) * (-332.495) (-330.442) (-329.602) [-328.098] -- 0:00:41
Average standard deviation of split frequencies: 0.010668
405500 -- (-331.961) (-329.137) [-331.933] (-330.807) * (-329.837) (-329.706) (-330.002) [-328.749] -- 0:00:41
406000 -- (-330.965) [-329.732] (-329.557) (-328.700) * (-328.251) (-331.146) (-328.988) [-327.612] -- 0:00:40
406500 -- (-328.060) (-328.199) [-328.167] (-332.287) * (-329.340) (-333.876) (-329.022) [-328.725] -- 0:00:40
407000 -- (-329.847) [-328.054] (-330.412) (-332.077) * (-330.336) [-330.007] (-330.263) (-331.887) -- 0:00:40
407500 -- (-330.485) [-328.109] (-328.238) (-330.138) * (-330.463) (-328.893) (-332.807) [-328.125] -- 0:00:40
408000 -- (-333.031) [-328.598] (-328.258) (-329.882) * [-331.195] (-330.749) (-329.121) (-330.635) -- 0:00:40
408500 -- [-328.598] (-328.166) (-328.310) (-328.555) * (-329.186) (-333.455) [-329.564] (-328.733) -- 0:00:40
409000 -- (-327.475) [-335.759] (-329.292) (-333.399) * (-331.038) (-334.342) [-331.360] (-328.267) -- 0:00:40
409500 -- (-331.001) (-329.250) [-329.795] (-333.991) * (-331.991) (-331.479) (-328.646) [-331.902] -- 0:00:40
410000 -- (-331.687) (-330.768) (-328.303) [-330.548] * (-328.567) (-327.855) (-328.238) [-331.517] -- 0:00:40
Average standard deviation of split frequencies: 0.010188
410500 -- (-328.616) [-330.511] (-329.076) (-329.127) * [-330.692] (-328.687) (-334.907) (-333.624) -- 0:00:40
411000 -- (-333.950) [-330.351] (-328.029) (-328.157) * [-328.621] (-328.353) (-334.014) (-330.738) -- 0:00:40
411500 -- (-335.737) [-328.904] (-330.048) (-328.526) * (-329.966) (-328.843) [-332.324] (-331.084) -- 0:00:40
412000 -- (-328.871) (-328.639) (-330.787) [-328.715] * (-331.015) (-327.897) [-332.070] (-329.917) -- 0:00:39
412500 -- (-328.229) [-327.867] (-327.927) (-328.191) * (-329.431) (-329.946) (-332.190) [-327.883] -- 0:00:39
413000 -- [-328.855] (-332.200) (-332.672) (-330.457) * (-328.402) (-328.208) (-331.374) [-328.589] -- 0:00:39
413500 -- (-329.316) [-328.729] (-333.190) (-329.540) * [-328.308] (-329.293) (-331.013) (-329.270) -- 0:00:39
414000 -- (-330.729) (-330.221) (-328.525) [-329.480] * [-329.959] (-331.218) (-330.355) (-330.785) -- 0:00:39
414500 -- (-332.895) (-331.421) (-330.265) [-328.611] * (-328.552) (-330.206) (-327.388) [-329.336] -- 0:00:39
415000 -- [-330.447] (-330.872) (-330.642) (-329.326) * (-327.959) (-328.968) (-329.825) [-329.220] -- 0:00:39
Average standard deviation of split frequencies: 0.010057
415500 -- (-328.424) [-331.218] (-331.586) (-335.723) * (-329.706) [-329.206] (-329.398) (-330.730) -- 0:00:40
416000 -- [-327.810] (-329.724) (-329.437) (-333.282) * (-332.232) [-330.398] (-329.211) (-328.471) -- 0:00:40
416500 -- (-329.611) (-328.513) [-331.095] (-327.953) * (-329.472) (-330.347) (-330.282) [-328.015] -- 0:00:40
417000 -- (-329.991) [-330.233] (-334.500) (-329.134) * (-330.108) [-329.965] (-328.624) (-328.640) -- 0:00:40
417500 -- (-330.932) (-333.193) (-329.525) [-327.974] * (-332.127) [-329.787] (-329.307) (-331.455) -- 0:00:40
418000 -- (-330.929) (-329.488) [-330.460] (-328.062) * [-328.192] (-327.921) (-330.466) (-333.315) -- 0:00:40
418500 -- (-328.119) (-331.521) [-329.595] (-329.421) * (-327.694) [-330.005] (-329.994) (-329.828) -- 0:00:40
419000 -- (-328.721) [-328.686] (-333.072) (-329.186) * (-332.875) [-329.584] (-329.603) (-332.861) -- 0:00:40
419500 -- (-333.838) [-328.388] (-328.595) (-334.062) * (-331.817) [-330.931] (-334.472) (-330.888) -- 0:00:40
420000 -- (-330.314) (-328.165) [-329.044] (-329.811) * [-328.233] (-333.284) (-327.528) (-329.949) -- 0:00:40
Average standard deviation of split frequencies: 0.009595
420500 -- [-334.273] (-330.262) (-332.214) (-328.779) * (-331.662) [-332.001] (-329.946) (-328.471) -- 0:00:39
421000 -- [-330.197] (-331.477) (-332.246) (-329.736) * [-331.158] (-328.999) (-330.721) (-329.561) -- 0:00:39
421500 -- (-338.072) (-329.838) [-330.432] (-328.917) * (-330.306) [-329.297] (-328.761) (-330.764) -- 0:00:39
422000 -- (-334.312) (-328.693) (-330.287) [-329.442] * (-327.910) (-328.844) (-329.169) [-328.300] -- 0:00:39
422500 -- (-329.026) (-329.700) [-329.003] (-330.858) * (-328.821) [-327.770] (-329.135) (-331.887) -- 0:00:39
423000 -- (-330.126) [-328.669] (-328.803) (-331.231) * [-328.452] (-328.085) (-329.975) (-329.960) -- 0:00:39
423500 -- [-330.149] (-327.759) (-331.998) (-329.718) * (-328.667) (-329.271) (-328.366) [-330.039] -- 0:00:39
424000 -- (-332.216) (-327.917) (-330.135) [-328.283] * (-328.249) (-331.063) [-329.052] (-328.180) -- 0:00:39
424500 -- (-328.510) [-329.829] (-331.171) (-328.867) * [-330.315] (-329.820) (-328.341) (-331.187) -- 0:00:39
425000 -- (-328.364) [-328.798] (-330.492) (-331.342) * (-330.140) (-328.740) [-329.163] (-329.586) -- 0:00:39
Average standard deviation of split frequencies: 0.010028
425500 -- [-329.753] (-328.469) (-330.352) (-329.541) * (-332.399) (-332.880) (-327.500) [-328.130] -- 0:00:39
426000 -- [-330.916] (-328.994) (-330.163) (-335.443) * (-331.999) (-329.396) [-330.426] (-331.019) -- 0:00:39
426500 -- (-329.503) (-328.886) (-329.432) [-331.614] * (-335.326) (-329.968) (-333.977) [-332.176] -- 0:00:38
427000 -- (-328.258) [-329.723] (-329.343) (-331.641) * [-329.713] (-328.555) (-328.390) (-330.257) -- 0:00:38
427500 -- (-329.647) [-328.236] (-331.297) (-329.880) * (-332.610) [-329.282] (-327.563) (-330.637) -- 0:00:38
428000 -- (-329.957) [-328.913] (-328.602) (-328.321) * (-334.283) (-331.925) [-327.935] (-328.704) -- 0:00:38
428500 -- (-328.267) [-328.394] (-329.127) (-331.340) * [-332.814] (-328.255) (-329.322) (-329.107) -- 0:00:38
429000 -- (-329.807) (-328.875) [-329.072] (-328.687) * (-330.263) (-329.911) [-329.273] (-331.972) -- 0:00:38
429500 -- (-328.695) (-327.915) [-328.934] (-330.077) * (-328.028) (-330.687) [-329.394] (-331.009) -- 0:00:38
430000 -- (-329.112) (-328.946) (-328.276) [-330.730] * (-332.379) (-334.557) [-328.667] (-329.730) -- 0:00:39
Average standard deviation of split frequencies: 0.009920
430500 -- (-330.761) (-328.919) [-328.419] (-331.024) * (-330.606) (-329.788) (-331.393) [-329.780] -- 0:00:39
431000 -- (-331.785) (-330.094) [-328.504] (-330.029) * [-330.294] (-328.837) (-329.995) (-329.538) -- 0:00:39
431500 -- (-336.123) (-328.417) (-330.073) [-328.704] * (-329.108) (-328.847) [-329.007] (-328.829) -- 0:00:39
432000 -- (-330.538) (-330.575) (-331.504) [-330.918] * (-328.396) [-328.786] (-328.580) (-329.272) -- 0:00:39
432500 -- [-327.915] (-328.329) (-329.127) (-330.927) * (-330.762) (-329.480) [-328.328] (-327.753) -- 0:00:39
433000 -- [-329.959] (-329.643) (-330.538) (-330.482) * (-330.503) [-328.445] (-327.698) (-331.572) -- 0:00:39
433500 -- [-329.056] (-331.740) (-330.030) (-330.320) * [-331.307] (-330.579) (-330.637) (-328.747) -- 0:00:39
434000 -- (-328.303) (-332.048) [-329.175] (-329.598) * (-332.334) (-330.876) (-331.396) [-328.428] -- 0:00:39
434500 -- (-332.610) (-328.321) [-332.548] (-329.068) * (-328.578) (-329.960) (-331.231) [-332.219] -- 0:00:39
435000 -- [-334.343] (-330.182) (-329.487) (-330.874) * (-327.596) [-327.910] (-329.391) (-328.709) -- 0:00:38
Average standard deviation of split frequencies: 0.009325
435500 -- (-335.162) (-328.662) [-327.765] (-333.061) * (-328.231) (-334.046) (-328.752) [-329.625] -- 0:00:38
436000 -- [-328.195] (-335.274) (-329.623) (-331.258) * (-329.242) [-332.131] (-330.472) (-329.059) -- 0:00:38
436500 -- [-331.381] (-328.624) (-330.220) (-329.717) * (-332.534) (-328.579) (-329.140) [-330.661] -- 0:00:38
437000 -- [-331.265] (-329.949) (-330.139) (-332.261) * (-331.946) [-331.845] (-328.732) (-333.057) -- 0:00:38
437500 -- (-333.620) [-330.208] (-330.782) (-329.965) * (-329.827) [-331.297] (-328.723) (-329.528) -- 0:00:38
438000 -- (-330.723) [-331.483] (-328.141) (-334.051) * [-331.140] (-331.605) (-330.226) (-333.158) -- 0:00:38
438500 -- (-330.014) [-328.520] (-330.203) (-329.521) * (-331.812) (-327.719) [-329.394] (-334.639) -- 0:00:38
439000 -- (-329.443) [-329.266] (-329.494) (-331.245) * [-331.114] (-328.968) (-328.000) (-329.778) -- 0:00:38
439500 -- (-328.964) (-327.904) [-330.051] (-333.419) * (-328.603) (-329.795) [-328.293] (-333.956) -- 0:00:38
440000 -- (-328.523) (-332.735) [-328.716] (-331.914) * (-332.676) [-328.027] (-329.861) (-329.571) -- 0:00:38
Average standard deviation of split frequencies: 0.009427
440500 -- (-332.836) (-333.297) [-328.165] (-330.474) * [-329.972] (-329.111) (-328.150) (-329.339) -- 0:00:38
441000 -- (-328.323) (-333.513) [-328.372] (-330.816) * (-330.593) [-329.317] (-330.608) (-330.748) -- 0:00:38
441500 -- (-327.789) (-335.822) (-331.270) [-329.086] * (-329.767) (-334.672) (-330.795) [-331.285] -- 0:00:37
442000 -- (-332.354) (-328.931) (-330.544) [-329.341] * (-328.793) (-330.904) (-330.259) [-329.153] -- 0:00:37
442500 -- (-329.910) (-330.137) (-329.752) [-330.103] * (-332.278) (-329.130) [-330.782] (-330.561) -- 0:00:37
443000 -- [-329.558] (-329.630) (-332.897) (-327.487) * (-328.917) [-328.192] (-329.610) (-333.930) -- 0:00:37
443500 -- (-331.835) [-329.315] (-332.708) (-328.768) * (-330.314) (-328.410) (-328.333) [-333.733] -- 0:00:37
444000 -- (-328.570) (-329.726) (-329.052) [-328.036] * (-328.183) [-329.037] (-329.644) (-331.457) -- 0:00:37
444500 -- [-328.364] (-331.990) (-331.497) (-331.295) * (-331.961) [-329.131] (-329.018) (-333.065) -- 0:00:37
445000 -- [-331.585] (-329.690) (-330.196) (-333.426) * [-330.143] (-328.841) (-335.119) (-332.710) -- 0:00:38
Average standard deviation of split frequencies: 0.009050
445500 -- (-338.870) [-328.096] (-329.376) (-328.026) * (-328.975) (-327.991) [-328.245] (-328.249) -- 0:00:38
446000 -- (-336.211) (-328.225) (-330.415) [-330.082] * (-331.111) [-328.594] (-330.002) (-329.362) -- 0:00:38
446500 -- (-331.968) (-328.122) [-328.733] (-328.810) * (-336.357) (-330.080) [-327.947] (-330.731) -- 0:00:38
447000 -- (-330.717) (-328.989) [-329.475] (-329.383) * (-333.993) (-329.108) (-329.717) [-329.590] -- 0:00:38
447500 -- (-332.214) (-330.680) [-330.632] (-329.550) * [-331.350] (-328.745) (-328.455) (-331.753) -- 0:00:38
448000 -- (-328.288) (-329.464) (-327.827) [-330.074] * (-330.719) (-328.803) [-331.708] (-331.096) -- 0:00:38
448500 -- (-330.783) (-330.436) (-329.394) [-328.762] * (-332.935) (-331.094) [-331.142] (-328.050) -- 0:00:38
449000 -- (-328.370) (-330.249) [-328.724] (-330.117) * [-335.587] (-331.305) (-329.073) (-330.095) -- 0:00:38
449500 -- (-328.266) (-330.208) (-328.733) [-328.540] * (-329.740) (-328.944) (-329.778) [-328.728] -- 0:00:37
450000 -- [-329.859] (-332.894) (-331.072) (-331.817) * (-329.375) [-330.410] (-330.035) (-330.254) -- 0:00:37
Average standard deviation of split frequencies: 0.009414
450500 -- [-330.205] (-329.526) (-328.558) (-333.276) * (-328.452) (-331.460) [-328.118] (-330.161) -- 0:00:37
451000 -- [-328.366] (-330.653) (-328.979) (-332.965) * [-328.722] (-330.368) (-329.749) (-329.238) -- 0:00:37
451500 -- [-327.621] (-332.588) (-328.749) (-333.140) * (-328.914) [-328.530] (-332.539) (-328.404) -- 0:00:37
452000 -- (-328.458) (-329.685) [-328.346] (-330.794) * (-328.433) (-330.304) [-327.888] (-328.118) -- 0:00:37
452500 -- [-329.491] (-328.950) (-328.510) (-331.380) * (-329.885) (-332.675) [-328.056] (-328.514) -- 0:00:37
453000 -- [-329.285] (-333.089) (-328.334) (-329.563) * (-331.163) (-328.806) (-328.687) [-329.060] -- 0:00:37
453500 -- (-332.404) [-329.832] (-330.008) (-328.204) * [-327.697] (-330.524) (-332.777) (-329.537) -- 0:00:37
454000 -- [-328.030] (-332.435) (-328.439) (-328.734) * (-331.051) [-335.737] (-329.103) (-332.480) -- 0:00:37
454500 -- (-330.231) (-329.548) [-329.158] (-328.262) * (-329.315) (-338.319) [-329.869] (-329.472) -- 0:00:37
455000 -- (-329.339) (-329.812) [-332.868] (-330.433) * [-328.771] (-330.860) (-328.511) (-329.271) -- 0:00:37
Average standard deviation of split frequencies: 0.009046
455500 -- [-329.228] (-327.719) (-329.121) (-333.963) * (-331.145) (-329.450) (-330.611) [-329.309] -- 0:00:37
456000 -- [-329.292] (-336.628) (-330.276) (-332.458) * (-328.477) [-328.302] (-328.078) (-330.917) -- 0:00:36
456500 -- [-330.104] (-330.981) (-333.196) (-332.845) * (-328.107) [-327.742] (-332.110) (-329.747) -- 0:00:36
457000 -- (-330.095) [-334.637] (-329.040) (-330.636) * [-327.845] (-330.510) (-333.616) (-327.967) -- 0:00:36
457500 -- [-328.389] (-330.090) (-330.584) (-328.913) * (-328.363) (-328.254) (-331.396) [-331.029] -- 0:00:36
458000 -- (-331.032) (-331.780) [-327.998] (-331.084) * (-329.031) (-328.176) (-331.424) [-330.134] -- 0:00:36
458500 -- [-333.315] (-334.542) (-328.026) (-330.040) * (-334.620) (-329.396) [-329.651] (-329.003) -- 0:00:36
459000 -- (-330.128) [-329.674] (-329.130) (-330.426) * (-330.266) (-328.567) (-329.466) [-328.134] -- 0:00:36
459500 -- (-330.707) [-331.263] (-329.412) (-328.814) * [-331.025] (-332.135) (-330.395) (-331.871) -- 0:00:37
460000 -- (-329.393) (-330.459) (-329.445) [-328.256] * (-331.690) [-329.478] (-332.055) (-328.865) -- 0:00:37
Average standard deviation of split frequencies: 0.009402
460500 -- (-328.771) [-329.325] (-329.234) (-329.919) * (-330.342) [-334.835] (-333.921) (-328.651) -- 0:00:37
461000 -- (-328.487) [-329.111] (-328.332) (-333.674) * (-328.193) (-328.766) (-331.431) [-330.450] -- 0:00:37
461500 -- (-331.860) [-327.766] (-328.352) (-328.534) * (-328.998) [-328.857] (-328.202) (-337.944) -- 0:00:37
462000 -- (-330.835) (-331.146) (-327.698) [-328.875] * [-328.567] (-332.315) (-328.202) (-332.694) -- 0:00:37
462500 -- (-331.251) [-330.238] (-328.171) (-328.234) * (-330.139) [-329.558] (-329.101) (-337.700) -- 0:00:37
463000 -- (-331.043) (-329.863) [-330.604] (-328.489) * (-328.977) (-328.048) [-329.084] (-329.265) -- 0:00:37
463500 -- (-330.962) (-329.910) [-333.315] (-327.803) * (-330.265) (-329.297) (-330.429) [-329.498] -- 0:00:37
464000 -- (-328.711) (-328.008) [-329.794] (-327.559) * (-328.672) [-329.250] (-331.842) (-329.007) -- 0:00:36
464500 -- (-328.862) (-330.701) [-330.268] (-328.808) * (-328.769) (-331.426) (-329.020) [-331.394] -- 0:00:36
465000 -- (-329.280) (-330.465) [-328.101] (-328.840) * (-331.167) (-331.142) [-328.025] (-334.955) -- 0:00:36
Average standard deviation of split frequencies: 0.009547
465500 -- (-330.171) (-328.488) (-329.633) [-328.771] * (-330.516) [-328.402] (-329.108) (-328.241) -- 0:00:36
466000 -- (-328.287) [-331.329] (-330.036) (-329.261) * (-329.014) (-331.833) (-330.840) [-329.506] -- 0:00:36
466500 -- (-328.873) (-330.242) [-329.315] (-328.340) * (-333.341) (-328.874) [-329.125] (-338.392) -- 0:00:36
467000 -- [-332.142] (-329.334) (-331.393) (-335.853) * (-334.246) [-331.629] (-328.972) (-332.512) -- 0:00:36
467500 -- [-329.352] (-331.119) (-330.539) (-332.415) * (-330.567) (-331.228) [-329.247] (-330.449) -- 0:00:36
468000 -- [-329.261] (-331.837) (-328.384) (-329.026) * (-328.216) (-331.222) [-329.584] (-333.665) -- 0:00:36
468500 -- [-328.579] (-330.105) (-329.287) (-328.302) * (-331.242) (-330.757) (-329.303) [-335.093] -- 0:00:36
469000 -- [-329.319] (-328.714) (-329.074) (-328.661) * [-330.957] (-329.448) (-331.302) (-331.012) -- 0:00:36
469500 -- (-330.146) (-329.255) [-328.729] (-328.231) * (-328.643) [-329.568] (-333.523) (-330.848) -- 0:00:36
470000 -- (-328.220) [-329.565] (-329.568) (-330.403) * (-331.761) [-329.446] (-329.216) (-328.756) -- 0:00:36
Average standard deviation of split frequencies: 0.010266
470500 -- [-332.869] (-331.084) (-331.799) (-327.640) * (-340.055) (-328.005) [-328.641] (-331.200) -- 0:00:36
471000 -- [-329.271] (-330.766) (-330.018) (-332.620) * (-332.869) [-327.694] (-328.173) (-327.880) -- 0:00:35
471500 -- [-329.187] (-330.176) (-330.440) (-329.253) * (-328.702) (-332.690) (-331.163) [-327.922] -- 0:00:35
472000 -- (-330.244) [-330.716] (-329.860) (-331.557) * (-328.701) (-330.334) [-328.935] (-331.553) -- 0:00:35
472500 -- (-330.232) [-329.002] (-328.807) (-330.479) * (-329.270) [-329.924] (-333.696) (-331.090) -- 0:00:35
473000 -- (-330.324) [-330.647] (-328.927) (-329.484) * (-332.334) (-331.870) [-331.198] (-330.715) -- 0:00:35
473500 -- [-330.443] (-334.272) (-328.225) (-329.026) * (-331.330) (-329.978) (-331.537) [-328.726] -- 0:00:35
474000 -- (-330.076) (-329.060) (-328.246) [-331.666] * (-330.584) (-328.903) (-331.715) [-329.495] -- 0:00:36
474500 -- (-331.153) (-329.335) [-331.900] (-329.422) * (-335.076) (-328.353) (-329.670) [-328.933] -- 0:00:36
475000 -- [-330.093] (-329.373) (-327.992) (-330.154) * (-330.604) (-331.252) (-329.586) [-333.627] -- 0:00:36
Average standard deviation of split frequencies: 0.011389
475500 -- (-330.031) [-328.502] (-331.527) (-330.664) * (-331.895) (-334.677) [-330.350] (-333.381) -- 0:00:36
476000 -- (-328.601) (-330.757) [-328.913] (-332.969) * [-329.009] (-328.305) (-332.527) (-330.312) -- 0:00:36
476500 -- (-330.467) (-333.066) [-328.943] (-332.288) * [-328.231] (-329.206) (-331.671) (-332.166) -- 0:00:36
477000 -- [-329.499] (-336.464) (-329.642) (-331.460) * (-329.112) [-332.259] (-331.283) (-328.667) -- 0:00:36
477500 -- [-328.441] (-329.042) (-329.549) (-331.217) * [-330.271] (-330.141) (-329.387) (-329.162) -- 0:00:36
478000 -- (-329.405) [-331.550] (-330.900) (-329.844) * (-329.679) [-327.766] (-329.395) (-328.973) -- 0:00:36
478500 -- [-327.494] (-335.312) (-329.847) (-331.453) * (-329.126) (-331.373) [-332.002] (-329.813) -- 0:00:35
479000 -- (-329.134) (-336.070) [-329.380] (-330.819) * (-327.745) (-329.044) (-327.693) [-329.023] -- 0:00:35
479500 -- (-331.124) (-328.017) [-331.812] (-334.975) * (-329.966) (-328.179) (-327.984) [-327.958] -- 0:00:35
480000 -- [-328.928] (-329.349) (-330.555) (-330.058) * (-329.210) (-329.207) [-332.104] (-332.749) -- 0:00:35
Average standard deviation of split frequencies: 0.011033
480500 -- (-329.365) (-329.005) [-329.808] (-329.824) * [-330.342] (-329.558) (-327.875) (-328.938) -- 0:00:35
481000 -- (-328.635) [-330.416] (-328.490) (-328.637) * (-332.497) (-329.135) [-328.055] (-328.646) -- 0:00:35
481500 -- (-331.316) (-332.972) [-329.477] (-329.106) * [-329.774] (-331.173) (-331.961) (-331.078) -- 0:00:35
482000 -- (-331.088) (-332.290) (-330.558) [-329.370] * (-330.971) [-329.454] (-328.557) (-329.335) -- 0:00:35
482500 -- [-328.874] (-329.558) (-333.521) (-330.447) * (-329.222) (-329.124) (-329.141) [-328.346] -- 0:00:35
483000 -- (-330.590) (-330.855) [-332.060] (-330.687) * (-330.032) (-331.168) [-329.603] (-336.919) -- 0:00:35
483500 -- (-328.560) (-334.033) (-329.714) [-329.357] * (-328.472) (-331.600) (-327.853) [-328.906] -- 0:00:35
484000 -- (-332.486) [-328.074] (-329.644) (-329.553) * (-329.823) [-329.312] (-330.340) (-332.916) -- 0:00:35
484500 -- (-332.373) (-330.003) (-328.625) [-333.138] * [-329.367] (-329.332) (-333.789) (-328.483) -- 0:00:35
485000 -- (-328.003) [-327.943] (-330.897) (-330.142) * (-329.413) [-329.873] (-330.288) (-328.255) -- 0:00:35
Average standard deviation of split frequencies: 0.010852
485500 -- [-328.212] (-327.606) (-330.322) (-327.731) * (-328.269) [-328.385] (-334.156) (-335.907) -- 0:00:34
486000 -- [-330.142] (-329.993) (-329.664) (-332.406) * (-329.981) (-328.490) (-329.455) [-334.936] -- 0:00:34
486500 -- [-329.994] (-331.864) (-330.054) (-330.720) * [-329.276] (-328.370) (-328.790) (-335.929) -- 0:00:34
487000 -- [-330.682] (-328.125) (-328.777) (-332.243) * (-332.615) (-328.685) (-330.866) [-331.311] -- 0:00:34
487500 -- (-328.845) [-328.295] (-330.319) (-332.821) * [-334.243] (-328.594) (-327.660) (-328.202) -- 0:00:34
488000 -- [-329.374] (-332.675) (-328.348) (-328.798) * (-328.690) [-327.383] (-327.915) (-329.457) -- 0:00:34
488500 -- (-329.732) (-331.079) (-332.639) [-329.996] * (-328.730) [-329.458] (-330.586) (-331.248) -- 0:00:35
489000 -- (-332.622) [-330.522] (-329.057) (-329.299) * (-330.976) (-330.518) [-329.451] (-330.965) -- 0:00:35
489500 -- (-329.362) [-331.828] (-332.438) (-328.359) * (-333.608) (-328.985) [-329.545] (-329.214) -- 0:00:35
490000 -- (-335.303) (-332.024) [-334.353] (-329.188) * (-329.474) (-330.638) [-334.926] (-330.521) -- 0:00:35
Average standard deviation of split frequencies: 0.011529
490500 -- (-327.755) (-329.194) (-331.382) [-330.825] * (-329.667) (-328.048) [-327.722] (-329.029) -- 0:00:35
491000 -- (-328.698) (-330.203) (-332.043) [-328.807] * (-329.031) (-328.533) [-328.817] (-327.594) -- 0:00:35
491500 -- [-330.485] (-329.858) (-331.960) (-328.094) * (-328.497) [-330.001] (-328.815) (-330.906) -- 0:00:35
492000 -- (-330.047) (-329.776) [-330.738] (-331.335) * (-329.562) (-327.724) [-328.732] (-332.907) -- 0:00:35
492500 -- [-330.735] (-328.995) (-328.416) (-328.836) * (-329.314) [-328.619] (-328.020) (-333.181) -- 0:00:35
493000 -- (-329.469) [-329.938] (-328.709) (-330.246) * (-329.327) (-330.105) [-329.314] (-330.655) -- 0:00:34
493500 -- [-328.924] (-333.968) (-338.546) (-334.267) * (-332.180) (-329.708) [-330.100] (-331.710) -- 0:00:34
494000 -- (-330.545) [-328.927] (-334.133) (-330.385) * [-329.952] (-329.844) (-329.739) (-329.938) -- 0:00:34
494500 -- [-329.600] (-328.105) (-327.843) (-330.211) * (-334.282) [-332.115] (-331.070) (-328.124) -- 0:00:34
495000 -- [-327.496] (-332.703) (-328.740) (-328.435) * [-329.940] (-329.509) (-330.835) (-329.995) -- 0:00:34
Average standard deviation of split frequencies: 0.010989
495500 -- (-329.300) [-327.983] (-329.842) (-328.162) * (-332.136) [-329.094] (-329.172) (-329.647) -- 0:00:34
496000 -- (-329.954) (-328.723) (-332.175) [-328.020] * (-327.725) (-330.424) [-329.037] (-329.770) -- 0:00:34
496500 -- (-329.160) [-329.070] (-330.862) (-327.589) * (-327.877) (-332.214) (-330.651) [-328.173] -- 0:00:34
497000 -- [-328.741] (-331.316) (-330.066) (-328.423) * (-329.458) (-327.384) (-329.679) [-327.599] -- 0:00:34
497500 -- (-329.972) [-329.189] (-329.277) (-329.222) * (-330.129) (-328.282) [-332.418] (-330.204) -- 0:00:34
498000 -- [-330.362] (-328.779) (-333.139) (-333.047) * (-328.752) [-329.554] (-330.322) (-330.044) -- 0:00:34
498500 -- [-329.119] (-329.128) (-332.339) (-333.397) * (-331.403) (-328.164) [-335.782] (-330.097) -- 0:00:34
499000 -- (-328.735) [-330.260] (-331.829) (-329.867) * (-332.222) (-328.292) [-332.351] (-330.302) -- 0:00:34
499500 -- [-331.665] (-336.559) (-328.794) (-330.944) * (-334.465) [-328.097] (-327.588) (-327.879) -- 0:00:34
500000 -- (-330.743) (-332.221) [-328.380] (-330.899) * (-333.650) (-330.167) [-328.898] (-329.097) -- 0:00:34
Average standard deviation of split frequencies: 0.009886
500500 -- (-329.366) [-330.371] (-329.183) (-330.508) * (-333.103) (-330.964) [-329.456] (-328.184) -- 0:00:33
501000 -- (-330.053) (-330.682) (-329.293) [-329.246] * [-329.712] (-334.631) (-330.954) (-329.924) -- 0:00:33
501500 -- (-330.980) (-332.585) [-331.129] (-329.563) * [-330.071] (-329.093) (-332.259) (-328.654) -- 0:00:33
502000 -- (-331.397) [-329.154] (-331.498) (-333.292) * [-329.833] (-327.427) (-330.250) (-329.658) -- 0:00:33
502500 -- [-328.694] (-328.654) (-329.767) (-329.902) * (-328.099) (-330.200) [-328.391] (-328.728) -- 0:00:33
503000 -- (-328.251) [-328.606] (-330.906) (-329.306) * (-334.348) (-329.239) [-329.146] (-330.891) -- 0:00:34
503500 -- [-329.161] (-329.765) (-333.707) (-332.605) * (-330.739) [-330.402] (-327.971) (-339.570) -- 0:00:34
504000 -- [-328.645] (-334.319) (-333.021) (-328.633) * (-332.859) (-329.946) (-328.542) [-333.809] -- 0:00:34
504500 -- [-328.840] (-330.184) (-329.535) (-329.956) * (-329.844) [-327.862] (-329.555) (-327.977) -- 0:00:34
505000 -- (-328.742) (-328.560) (-331.039) [-329.029] * (-328.761) (-329.529) (-333.335) [-327.766] -- 0:00:34
Average standard deviation of split frequencies: 0.009899
505500 -- (-331.194) [-331.268] (-332.185) (-334.884) * (-329.256) [-328.202] (-333.344) (-327.839) -- 0:00:34
506000 -- (-329.580) (-332.118) (-332.618) [-328.064] * [-329.511] (-328.494) (-331.428) (-331.249) -- 0:00:34
506500 -- (-330.457) (-328.605) [-330.565] (-329.964) * [-334.052] (-329.070) (-331.684) (-330.793) -- 0:00:34
507000 -- (-332.666) (-328.680) [-330.901] (-332.088) * (-334.397) (-335.705) [-330.734] (-336.066) -- 0:00:34
507500 -- (-331.746) (-328.824) [-332.028] (-331.005) * (-329.478) [-329.996] (-329.364) (-333.334) -- 0:00:33
508000 -- (-328.799) (-330.026) (-337.670) [-330.132] * (-330.711) [-331.350] (-330.747) (-330.796) -- 0:00:33
508500 -- (-329.041) (-331.101) [-331.018] (-333.794) * [-328.905] (-330.606) (-332.285) (-333.225) -- 0:00:33
509000 -- (-331.883) (-328.904) (-331.997) [-329.058] * (-331.669) (-331.926) (-329.570) [-335.144] -- 0:00:33
509500 -- (-328.660) [-328.425] (-330.427) (-330.204) * (-335.044) (-329.268) (-332.239) [-328.849] -- 0:00:33
510000 -- (-328.842) (-331.141) [-330.685] (-334.879) * (-330.514) (-328.744) (-330.268) [-330.191] -- 0:00:33
Average standard deviation of split frequencies: 0.009520
510500 -- [-330.015] (-327.683) (-330.364) (-333.131) * (-328.300) (-328.048) [-328.647] (-332.199) -- 0:00:33
511000 -- (-328.728) [-332.925] (-328.998) (-331.472) * (-331.202) (-328.414) [-328.623] (-329.022) -- 0:00:33
511500 -- (-329.456) (-330.715) [-327.935] (-328.932) * (-330.255) [-328.773] (-333.507) (-329.915) -- 0:00:33
512000 -- (-328.719) (-332.414) [-328.049] (-330.282) * (-329.506) (-328.762) [-331.240] (-329.237) -- 0:00:33
512500 -- (-329.373) (-329.560) (-330.689) [-329.421] * (-332.889) (-332.766) (-330.885) [-329.748] -- 0:00:33
513000 -- (-334.276) (-332.435) (-329.231) [-329.423] * [-327.728] (-330.232) (-329.575) (-330.351) -- 0:00:33
513500 -- (-329.482) (-331.897) (-330.409) [-329.062] * [-332.871] (-328.197) (-328.382) (-327.997) -- 0:00:33
514000 -- (-331.273) [-328.264] (-333.836) (-329.243) * [-330.344] (-329.603) (-329.103) (-327.821) -- 0:00:33
514500 -- (-329.553) (-332.533) [-328.081] (-332.714) * (-330.462) (-331.359) [-327.584] (-328.400) -- 0:00:33
515000 -- (-327.912) [-328.164] (-329.880) (-330.193) * (-330.312) (-330.424) [-329.483] (-330.865) -- 0:00:32
Average standard deviation of split frequencies: 0.009421
515500 -- (-328.836) (-328.855) [-328.983] (-329.146) * [-334.394] (-332.903) (-328.740) (-336.574) -- 0:00:32
516000 -- [-330.899] (-332.604) (-334.367) (-328.418) * [-330.461] (-333.457) (-328.514) (-339.896) -- 0:00:32
516500 -- [-329.729] (-328.717) (-330.956) (-330.522) * (-329.982) (-328.301) (-335.350) [-333.653] -- 0:00:32
517000 -- [-331.096] (-329.257) (-331.817) (-329.229) * (-328.659) (-336.930) (-329.684) [-330.969] -- 0:00:32
517500 -- (-327.511) (-329.927) (-331.075) [-329.264] * (-328.768) (-328.252) (-329.558) [-330.405] -- 0:00:33
518000 -- [-328.602] (-330.134) (-330.891) (-332.364) * (-330.265) (-329.601) [-328.492] (-332.970) -- 0:00:33
518500 -- (-332.358) [-329.241] (-329.625) (-329.788) * (-331.101) (-329.882) (-328.270) [-329.889] -- 0:00:33
519000 -- (-329.055) (-328.296) [-329.841] (-332.575) * (-333.311) [-327.842] (-329.430) (-329.457) -- 0:00:33
519500 -- [-327.838] (-328.893) (-329.681) (-330.647) * (-329.889) (-329.653) [-331.086] (-329.688) -- 0:00:33
520000 -- (-330.665) (-330.683) [-330.761] (-330.351) * [-334.613] (-329.307) (-329.270) (-332.469) -- 0:00:33
Average standard deviation of split frequencies: 0.009450
520500 -- [-328.320] (-330.994) (-330.187) (-334.639) * [-329.148] (-330.498) (-329.370) (-329.577) -- 0:00:33
521000 -- (-330.130) (-329.578) (-331.395) [-329.405] * (-329.585) [-331.157] (-331.725) (-330.600) -- 0:00:33
521500 -- (-332.236) (-329.614) [-330.014] (-331.297) * (-328.622) (-329.375) (-328.561) [-330.265] -- 0:00:33
522000 -- [-328.402] (-329.604) (-330.134) (-330.930) * (-333.043) (-327.774) (-332.611) [-329.249] -- 0:00:32
522500 -- (-329.457) (-328.511) [-327.857] (-332.687) * (-332.418) [-332.292] (-333.602) (-331.289) -- 0:00:32
523000 -- [-330.081] (-328.940) (-331.735) (-331.384) * (-330.784) (-331.950) (-329.412) [-328.734] -- 0:00:32
523500 -- [-329.781] (-328.695) (-331.601) (-331.188) * [-330.526] (-329.056) (-330.249) (-330.207) -- 0:00:32
524000 -- (-330.931) (-330.166) (-330.155) [-329.182] * [-330.000] (-328.202) (-330.524) (-331.822) -- 0:00:32
524500 -- (-329.322) [-329.562] (-331.476) (-327.745) * (-331.764) (-329.068) (-330.185) [-329.267] -- 0:00:32
525000 -- [-331.516] (-329.288) (-330.286) (-328.895) * (-329.826) (-328.250) [-331.130] (-330.005) -- 0:00:32
Average standard deviation of split frequencies: 0.009410
525500 -- (-332.319) [-333.827] (-332.982) (-329.310) * [-330.231] (-332.633) (-328.814) (-330.307) -- 0:00:32
526000 -- [-330.795] (-332.877) (-331.692) (-328.425) * [-330.544] (-332.873) (-328.472) (-330.247) -- 0:00:32
526500 -- [-328.818] (-332.453) (-331.850) (-331.961) * (-332.696) (-328.586) (-331.458) [-332.039] -- 0:00:32
527000 -- (-328.974) (-329.715) (-331.859) [-329.920] * [-329.358] (-328.058) (-330.061) (-331.310) -- 0:00:32
527500 -- (-329.063) (-329.892) [-330.428] (-329.477) * [-330.473] (-329.532) (-329.034) (-328.383) -- 0:00:32
528000 -- (-327.649) (-327.878) (-330.503) [-330.617] * [-328.368] (-329.647) (-330.359) (-329.517) -- 0:00:32
528500 -- (-329.754) (-328.341) [-331.951] (-328.169) * (-328.132) (-331.460) [-330.197] (-330.557) -- 0:00:32
529000 -- [-329.740] (-329.668) (-332.855) (-327.757) * (-331.809) [-330.896] (-329.003) (-331.152) -- 0:00:32
529500 -- (-328.792) (-331.137) (-330.218) [-329.497] * (-334.147) (-330.211) (-328.417) [-327.853] -- 0:00:31
530000 -- (-328.097) [-327.663] (-334.992) (-331.351) * (-332.082) (-329.439) [-328.035] (-332.832) -- 0:00:31
Average standard deviation of split frequencies: 0.008495
530500 -- (-328.002) (-329.915) (-330.854) [-328.327] * (-328.807) (-334.348) [-329.606] (-329.830) -- 0:00:31
531000 -- (-330.142) [-330.563] (-328.651) (-331.551) * [-328.200] (-328.034) (-331.740) (-330.956) -- 0:00:31
531500 -- (-327.445) (-330.135) (-330.096) [-327.940] * (-327.780) (-330.204) (-331.775) [-331.665] -- 0:00:31
532000 -- (-328.116) (-329.590) (-331.449) [-328.316] * (-332.065) [-328.394] (-329.201) (-332.685) -- 0:00:32
532500 -- (-329.209) (-328.806) (-329.019) [-330.037] * (-330.846) (-328.009) (-329.339) [-328.500] -- 0:00:32
533000 -- (-336.224) (-330.418) [-330.665] (-331.912) * (-330.045) [-329.351] (-327.753) (-330.427) -- 0:00:32
533500 -- [-331.046] (-330.976) (-328.417) (-332.492) * (-336.585) [-328.488] (-328.693) (-336.289) -- 0:00:32
534000 -- (-332.987) [-333.265] (-330.195) (-328.395) * [-329.609] (-328.005) (-328.267) (-328.915) -- 0:00:32
534500 -- [-332.827] (-331.143) (-330.731) (-328.109) * (-332.841) [-329.067] (-329.285) (-331.458) -- 0:00:32
535000 -- (-331.528) (-329.442) (-328.924) [-328.124] * (-331.970) (-330.325) [-328.311] (-330.029) -- 0:00:32
Average standard deviation of split frequencies: 0.008685
535500 -- (-328.703) [-329.587] (-330.432) (-328.209) * (-331.779) (-332.248) [-327.783] (-331.351) -- 0:00:32
536000 -- (-329.320) (-329.408) (-330.711) [-330.562] * [-328.925] (-330.214) (-327.771) (-329.005) -- 0:00:32
536500 -- (-332.436) (-334.779) (-333.631) [-328.535] * [-334.242] (-330.926) (-328.950) (-331.742) -- 0:00:31
537000 -- (-329.781) (-329.010) [-329.773] (-333.277) * [-329.962] (-328.782) (-329.435) (-330.758) -- 0:00:31
537500 -- (-331.792) (-330.981) [-330.528] (-331.897) * (-329.310) (-329.895) [-331.468] (-329.857) -- 0:00:31
538000 -- (-331.878) (-330.801) [-331.437] (-327.836) * (-327.684) (-330.981) [-328.921] (-328.388) -- 0:00:31
538500 -- (-329.985) (-329.310) (-329.062) [-327.470] * (-329.029) (-332.906) (-329.532) [-330.352] -- 0:00:31
539000 -- (-331.958) (-330.179) (-331.280) [-328.208] * (-329.991) (-335.136) [-329.131] (-333.620) -- 0:00:31
539500 -- (-328.164) (-330.197) [-329.223] (-334.282) * (-332.077) (-336.048) [-331.241] (-333.608) -- 0:00:31
540000 -- (-329.734) (-329.447) [-328.545] (-328.187) * (-328.955) (-335.556) (-329.614) [-328.074] -- 0:00:31
Average standard deviation of split frequencies: 0.008446
540500 -- (-332.039) (-331.687) (-329.020) [-329.193] * (-330.712) (-333.274) [-328.379] (-329.403) -- 0:00:31
541000 -- [-330.864] (-330.611) (-331.259) (-329.926) * (-329.648) [-335.189] (-328.913) (-327.751) -- 0:00:31
541500 -- (-331.799) (-330.099) (-332.848) [-332.532] * (-329.646) (-333.158) (-327.767) [-328.674] -- 0:00:31
542000 -- (-332.017) [-332.780] (-335.439) (-329.037) * [-329.694] (-331.386) (-331.624) (-327.882) -- 0:00:31
542500 -- (-330.061) (-331.489) [-328.719] (-329.255) * [-328.742] (-328.106) (-330.105) (-327.889) -- 0:00:31
543000 -- [-330.631] (-328.101) (-328.083) (-331.968) * (-328.643) (-329.051) (-328.682) [-331.306] -- 0:00:31
543500 -- (-333.289) [-333.208] (-328.318) (-330.595) * (-331.397) [-328.829] (-328.873) (-330.769) -- 0:00:31
544000 -- [-332.904] (-331.755) (-331.967) (-329.221) * [-328.779] (-328.433) (-331.121) (-330.485) -- 0:00:31
544500 -- (-331.362) (-330.592) (-330.970) [-329.444] * (-331.114) [-332.328] (-334.719) (-331.934) -- 0:00:30
545000 -- [-330.018] (-327.829) (-330.583) (-330.599) * [-328.825] (-329.464) (-330.505) (-329.866) -- 0:00:30
Average standard deviation of split frequencies: 0.008202
545500 -- (-329.496) (-331.011) (-332.497) [-329.478] * (-330.540) (-330.812) [-329.022] (-329.703) -- 0:00:30
546000 -- [-328.885] (-330.349) (-330.392) (-329.189) * [-329.937] (-329.229) (-332.228) (-331.743) -- 0:00:30
546500 -- (-331.082) (-331.218) (-331.476) [-331.366] * (-330.898) [-328.509] (-328.257) (-330.902) -- 0:00:30
547000 -- (-330.126) (-332.068) (-328.338) [-328.247] * (-332.047) [-329.317] (-328.367) (-329.300) -- 0:00:31
547500 -- [-329.490] (-329.934) (-329.234) (-328.682) * [-330.750] (-330.061) (-329.424) (-329.487) -- 0:00:31
548000 -- (-333.583) [-329.617] (-334.572) (-329.417) * (-334.733) (-330.517) [-328.164] (-328.619) -- 0:00:31
548500 -- (-328.052) [-328.466] (-328.051) (-328.302) * (-327.878) [-331.226] (-329.763) (-329.180) -- 0:00:31
549000 -- [-329.700] (-329.326) (-328.306) (-328.580) * (-332.331) (-330.855) (-329.922) [-329.096] -- 0:00:31
549500 -- (-327.916) [-329.670] (-329.356) (-328.688) * (-330.494) [-333.724] (-330.129) (-328.593) -- 0:00:31
550000 -- (-329.742) [-331.234] (-330.507) (-331.006) * (-329.985) (-329.593) [-330.803] (-329.869) -- 0:00:31
Average standard deviation of split frequencies: 0.008882
550500 -- (-332.661) [-332.004] (-330.977) (-329.062) * (-329.153) (-330.758) (-334.453) [-329.323] -- 0:00:31
551000 -- (-332.957) (-330.195) [-329.048] (-331.581) * (-329.647) (-327.997) (-331.969) [-329.937] -- 0:00:30
551500 -- [-331.389] (-330.370) (-331.129) (-329.279) * (-328.899) [-337.574] (-329.133) (-331.357) -- 0:00:30
552000 -- (-328.495) (-333.832) (-329.680) [-330.052] * (-328.903) (-332.719) (-329.120) [-329.044] -- 0:00:30
552500 -- [-330.814] (-331.075) (-328.979) (-330.771) * [-329.893] (-329.531) (-329.530) (-329.799) -- 0:00:30
553000 -- [-329.601] (-334.922) (-329.864) (-328.989) * (-331.354) (-327.792) (-335.417) [-329.552] -- 0:00:30
553500 -- (-328.949) (-329.937) (-329.488) [-328.187] * (-329.818) (-328.183) (-331.070) [-329.662] -- 0:00:30
554000 -- (-330.270) (-332.658) (-330.155) [-329.263] * (-329.522) [-330.675] (-328.953) (-328.496) -- 0:00:30
554500 -- (-330.245) (-329.474) (-328.174) [-328.171] * (-330.087) (-333.833) [-329.751] (-329.186) -- 0:00:30
555000 -- [-329.356] (-329.097) (-331.788) (-328.837) * (-330.368) [-331.241] (-331.439) (-330.047) -- 0:00:30
Average standard deviation of split frequencies: 0.008955
555500 -- (-328.372) (-327.665) (-330.210) [-332.956] * (-330.022) (-328.434) (-331.945) [-327.731] -- 0:00:30
556000 -- (-329.138) (-327.983) (-327.595) [-328.421] * (-331.951) [-328.088] (-329.617) (-329.460) -- 0:00:30
556500 -- (-330.044) (-330.411) [-330.149] (-328.948) * [-328.564] (-327.684) (-329.484) (-331.861) -- 0:00:30
557000 -- [-327.786] (-329.846) (-331.485) (-330.815) * (-330.912) (-330.359) [-331.500] (-330.130) -- 0:00:30
557500 -- (-329.775) (-330.807) (-331.676) [-331.172] * (-330.087) (-329.064) [-328.498] (-328.585) -- 0:00:30
558000 -- (-332.572) (-329.112) [-333.498] (-330.059) * [-330.373] (-328.613) (-329.787) (-330.138) -- 0:00:30
558500 -- (-334.321) [-329.985] (-332.051) (-332.384) * (-330.373) (-330.001) [-333.741] (-331.255) -- 0:00:30
559000 -- (-328.723) [-329.552] (-334.369) (-333.264) * (-328.020) (-331.147) [-330.311] (-330.423) -- 0:00:29
559500 -- (-328.541) (-329.563) (-331.825) [-331.409] * (-329.511) [-329.588] (-329.845) (-330.006) -- 0:00:29
560000 -- [-331.714] (-332.188) (-332.272) (-333.703) * [-330.735] (-328.608) (-332.146) (-330.327) -- 0:00:29
Average standard deviation of split frequencies: 0.009091
560500 -- [-329.112] (-327.991) (-333.202) (-332.971) * (-328.586) [-329.108] (-329.383) (-331.314) -- 0:00:29
561000 -- (-329.963) [-328.645] (-333.622) (-332.315) * [-329.803] (-327.914) (-330.841) (-331.509) -- 0:00:29
561500 -- (-330.577) (-328.687) (-329.116) [-330.650] * [-328.257] (-330.686) (-328.611) (-330.421) -- 0:00:30
562000 -- (-331.192) (-331.162) (-328.636) [-330.256] * (-330.049) [-329.397] (-329.537) (-332.233) -- 0:00:30
562500 -- (-329.996) (-328.167) (-329.894) [-328.937] * (-328.746) (-330.967) (-328.495) [-328.983] -- 0:00:30
563000 -- (-328.900) [-329.007] (-331.807) (-327.766) * (-329.466) (-329.335) (-328.790) [-329.450] -- 0:00:30
563500 -- (-330.548) (-330.491) (-331.136) [-327.678] * (-327.692) (-334.138) [-330.204] (-333.365) -- 0:00:30
564000 -- (-330.628) [-332.116] (-328.432) (-329.314) * (-329.748) (-328.171) [-330.487] (-332.581) -- 0:00:30
564500 -- (-330.138) (-332.107) (-331.358) [-328.115] * (-329.030) (-328.849) [-329.095] (-330.964) -- 0:00:30
565000 -- (-331.567) (-329.081) (-329.795) [-328.669] * (-330.163) (-329.232) (-328.172) [-329.007] -- 0:00:30
Average standard deviation of split frequencies: 0.009266
565500 -- [-329.367] (-328.094) (-328.230) (-332.336) * (-329.955) (-328.585) (-328.045) [-328.808] -- 0:00:29
566000 -- (-330.654) (-327.851) (-327.554) [-328.982] * (-329.351) (-328.597) (-333.217) [-328.397] -- 0:00:29
566500 -- (-328.952) (-329.107) (-331.580) [-333.709] * [-331.518] (-328.346) (-336.380) (-328.533) -- 0:00:29
567000 -- (-331.944) [-332.933] (-329.846) (-329.783) * [-328.742] (-328.989) (-329.653) (-328.823) -- 0:00:29
567500 -- (-328.900) (-328.178) [-328.325] (-328.840) * (-329.154) [-329.717] (-329.003) (-330.806) -- 0:00:29
568000 -- [-332.218] (-328.392) (-330.033) (-332.670) * [-329.723] (-330.698) (-331.367) (-328.730) -- 0:00:29
568500 -- (-329.780) (-329.881) [-328.689] (-330.813) * [-328.266] (-330.672) (-334.979) (-329.336) -- 0:00:29
569000 -- (-330.816) [-329.917] (-328.560) (-330.007) * (-329.755) (-328.881) (-330.953) [-331.429] -- 0:00:29
569500 -- (-330.311) (-330.471) [-328.346] (-329.754) * (-329.126) (-333.546) [-329.584] (-332.136) -- 0:00:29
570000 -- (-331.617) (-331.401) [-330.799] (-332.369) * (-333.029) (-328.333) (-329.640) [-329.162] -- 0:00:29
Average standard deviation of split frequencies: 0.009809
570500 -- (-331.669) (-330.362) (-330.017) [-329.862] * [-331.341] (-328.908) (-329.581) (-329.400) -- 0:00:29
571000 -- (-330.749) [-329.847] (-327.603) (-331.381) * (-330.836) (-327.489) (-331.363) [-329.038] -- 0:00:29
571500 -- (-327.510) (-329.557) [-329.483] (-330.666) * (-327.962) (-329.812) (-333.082) [-328.115] -- 0:00:29
572000 -- [-332.178] (-332.344) (-335.468) (-331.737) * (-327.694) (-332.587) (-332.220) [-328.428] -- 0:00:29
572500 -- (-332.247) (-328.179) (-331.417) [-328.727] * [-329.577] (-335.166) (-334.084) (-329.187) -- 0:00:29
573000 -- (-330.305) (-329.599) (-330.880) [-328.375] * (-334.058) (-329.527) [-330.896] (-328.162) -- 0:00:29
573500 -- (-328.489) (-332.246) [-328.065] (-330.211) * [-330.720] (-330.543) (-328.965) (-330.440) -- 0:00:29
574000 -- (-329.178) (-329.304) (-329.934) [-327.487] * (-328.106) [-328.725] (-329.981) (-331.580) -- 0:00:28
574500 -- [-331.730] (-328.346) (-331.505) (-332.356) * [-330.210] (-329.570) (-328.480) (-328.705) -- 0:00:28
575000 -- (-329.541) (-331.914) [-328.755] (-331.800) * (-328.957) [-329.105] (-328.074) (-334.045) -- 0:00:28
Average standard deviation of split frequencies: 0.009719
575500 -- (-329.378) [-330.288] (-329.398) (-334.000) * (-328.186) (-331.103) (-329.556) [-331.677] -- 0:00:28
576000 -- [-330.426] (-328.396) (-337.420) (-329.601) * (-328.413) [-331.696] (-329.154) (-327.857) -- 0:00:29
576500 -- [-332.694] (-329.198) (-339.725) (-327.891) * [-328.342] (-330.974) (-329.664) (-333.012) -- 0:00:29
577000 -- (-330.465) (-330.998) [-334.090] (-328.504) * (-330.768) [-328.328] (-330.564) (-333.808) -- 0:00:29
577500 -- (-329.170) (-331.772) [-330.746] (-329.263) * (-328.723) (-329.509) (-331.356) [-329.612] -- 0:00:29
578000 -- [-328.717] (-332.806) (-339.315) (-334.118) * [-328.596] (-333.922) (-330.545) (-330.036) -- 0:00:29
578500 -- (-332.311) [-328.886] (-335.447) (-328.199) * (-328.743) [-327.696] (-329.565) (-329.184) -- 0:00:29
579000 -- [-329.425] (-328.002) (-331.125) (-333.820) * (-331.549) (-328.858) [-329.327] (-332.608) -- 0:00:29
579500 -- (-338.885) [-330.718] (-331.192) (-328.630) * (-330.382) (-331.652) (-328.563) [-329.164] -- 0:00:29
580000 -- (-334.697) (-328.970) [-328.841] (-330.030) * [-330.666] (-332.132) (-330.587) (-328.881) -- 0:00:28
Average standard deviation of split frequencies: 0.009285
580500 -- (-334.500) [-330.124] (-328.784) (-329.679) * (-329.897) [-330.496] (-327.683) (-330.299) -- 0:00:28
581000 -- (-334.810) (-332.765) [-329.689] (-329.803) * [-328.894] (-329.028) (-327.484) (-328.708) -- 0:00:28
581500 -- (-329.470) (-336.410) [-330.661] (-333.283) * (-332.035) [-328.912] (-327.835) (-329.416) -- 0:00:28
582000 -- (-331.597) (-332.177) [-331.441] (-329.284) * [-330.075] (-329.877) (-330.590) (-330.658) -- 0:00:28
582500 -- (-330.409) [-328.797] (-330.744) (-328.726) * [-328.481] (-331.128) (-329.109) (-330.390) -- 0:00:28
583000 -- (-334.191) (-329.764) (-329.618) [-334.617] * (-330.557) (-332.288) (-329.407) [-328.493] -- 0:00:28
583500 -- (-330.110) [-328.371] (-329.659) (-335.240) * (-331.191) (-331.253) (-328.651) [-329.096] -- 0:00:28
584000 -- (-329.070) [-329.569] (-332.569) (-329.305) * (-329.889) (-329.404) (-329.154) [-328.412] -- 0:00:28
584500 -- (-329.955) (-330.048) (-331.763) [-328.049] * (-332.573) (-331.212) (-329.036) [-327.892] -- 0:00:28
585000 -- (-329.121) (-330.279) (-328.911) [-329.837] * [-329.750] (-329.808) (-328.745) (-330.345) -- 0:00:28
Average standard deviation of split frequencies: 0.009603
585500 -- (-330.558) [-332.339] (-329.262) (-331.315) * (-329.853) (-328.886) [-330.065] (-328.538) -- 0:00:28
586000 -- (-332.237) (-329.710) (-328.925) [-329.649] * (-331.337) (-330.875) (-328.946) [-327.767] -- 0:00:28
586500 -- (-332.151) [-331.940] (-329.265) (-328.412) * (-329.217) (-328.314) [-330.261] (-327.715) -- 0:00:28
587000 -- (-330.113) [-328.425] (-330.872) (-329.896) * [-331.226] (-329.669) (-332.072) (-329.066) -- 0:00:28
587500 -- (-327.868) (-328.267) [-330.092] (-329.615) * (-328.335) [-329.135] (-327.598) (-331.468) -- 0:00:28
588000 -- (-328.046) [-328.471] (-333.773) (-331.276) * (-334.255) [-328.790] (-328.181) (-329.937) -- 0:00:28
588500 -- (-328.877) (-328.438) (-329.872) [-329.504] * (-330.241) [-330.851] (-328.288) (-328.903) -- 0:00:27
589000 -- [-329.244] (-327.376) (-329.589) (-332.154) * (-329.951) (-329.118) (-328.635) [-327.618] -- 0:00:27
589500 -- (-328.351) (-329.719) [-334.183] (-332.387) * (-329.427) [-331.633] (-329.242) (-330.368) -- 0:00:27
590000 -- (-329.156) [-329.674] (-334.769) (-327.508) * (-329.560) [-328.089] (-330.252) (-329.499) -- 0:00:27
Average standard deviation of split frequencies: 0.009477
590500 -- [-331.177] (-332.837) (-333.529) (-330.683) * (-330.349) (-328.794) [-329.368] (-329.367) -- 0:00:28
591000 -- (-328.694) (-330.165) (-329.814) [-328.228] * (-328.932) [-329.412] (-327.872) (-328.904) -- 0:00:28
591500 -- [-330.521] (-328.884) (-331.467) (-329.484) * (-327.980) (-328.726) (-329.257) [-327.723] -- 0:00:28
592000 -- [-328.966] (-329.266) (-329.141) (-331.869) * (-328.180) (-327.981) [-328.148] (-328.375) -- 0:00:28
592500 -- [-330.079] (-330.125) (-331.220) (-328.086) * (-330.184) (-330.163) (-328.530) [-330.089] -- 0:00:28
593000 -- (-328.604) (-330.782) (-332.168) [-329.362] * (-335.133) [-329.554] (-329.633) (-332.596) -- 0:00:28
593500 -- (-331.904) (-330.954) [-331.060] (-327.765) * [-330.651] (-331.227) (-331.098) (-332.612) -- 0:00:28
594000 -- (-330.584) (-330.947) (-337.096) [-328.790] * (-330.617) (-328.778) [-328.917] (-330.094) -- 0:00:28
594500 -- [-335.389] (-331.997) (-339.240) (-328.825) * (-331.269) [-328.273] (-329.398) (-327.726) -- 0:00:27
595000 -- [-329.436] (-331.441) (-329.047) (-331.433) * [-329.479] (-328.713) (-332.090) (-327.996) -- 0:00:27
Average standard deviation of split frequencies: 0.010035
595500 -- (-332.596) (-330.785) (-330.425) [-328.797] * (-333.134) [-328.987] (-331.777) (-329.868) -- 0:00:27
596000 -- (-328.303) (-331.250) (-328.721) [-330.373] * (-329.768) [-328.561] (-335.948) (-329.283) -- 0:00:27
596500 -- (-328.197) (-332.292) [-328.557] (-328.676) * (-328.608) (-333.037) (-331.503) [-329.368] -- 0:00:27
597000 -- (-328.775) (-331.768) [-331.220] (-328.642) * (-328.212) [-329.310] (-333.428) (-329.983) -- 0:00:27
597500 -- (-328.891) [-332.113] (-331.368) (-328.662) * (-331.080) (-329.510) (-333.326) [-330.041] -- 0:00:27
598000 -- (-330.660) [-331.146] (-329.140) (-333.449) * (-330.878) [-328.744] (-328.522) (-330.368) -- 0:00:27
598500 -- (-332.939) (-331.352) [-328.408] (-328.348) * (-334.784) [-328.482] (-332.167) (-333.082) -- 0:00:27
599000 -- [-330.405] (-332.028) (-331.376) (-328.935) * (-334.386) (-335.002) [-331.412] (-329.709) -- 0:00:27
599500 -- (-334.516) [-329.241] (-332.055) (-327.727) * (-331.254) (-331.921) [-330.736] (-329.210) -- 0:00:27
600000 -- [-329.815] (-329.356) (-330.681) (-329.672) * (-332.657) [-327.727] (-331.121) (-330.701) -- 0:00:27
Average standard deviation of split frequencies: 0.010791
600500 -- (-329.357) (-328.200) (-329.708) [-328.147] * [-332.066] (-329.437) (-331.098) (-328.040) -- 0:00:27
601000 -- (-329.218) (-328.266) [-327.628] (-328.539) * (-335.853) [-331.887] (-330.885) (-329.470) -- 0:00:27
601500 -- (-329.480) [-330.029] (-330.135) (-328.127) * (-332.996) (-332.035) (-333.038) [-328.736] -- 0:00:27
602000 -- (-329.311) [-330.088] (-330.458) (-328.726) * (-329.523) [-329.830] (-328.728) (-329.043) -- 0:00:27
602500 -- [-329.509] (-333.933) (-331.445) (-331.471) * (-329.106) (-329.032) (-328.786) [-329.216] -- 0:00:27
603000 -- (-330.127) [-331.146] (-330.928) (-328.381) * [-330.180] (-330.435) (-330.292) (-329.862) -- 0:00:26
603500 -- (-328.091) (-330.306) [-328.505] (-328.596) * (-329.567) (-328.845) (-329.378) [-330.892] -- 0:00:26
604000 -- (-328.113) (-329.184) (-331.362) [-330.542] * (-328.230) (-329.322) (-329.225) [-328.596] -- 0:00:26
604500 -- (-332.540) [-329.834] (-329.988) (-330.223) * (-328.683) [-328.178] (-330.982) (-330.488) -- 0:00:26
605000 -- (-331.463) (-330.715) (-330.210) [-328.171] * [-327.979] (-328.480) (-332.377) (-330.443) -- 0:00:27
Average standard deviation of split frequencies: 0.010647
605500 -- (-333.245) (-328.337) (-329.496) [-328.540] * (-330.457) (-329.996) [-331.240] (-329.515) -- 0:00:27
606000 -- [-329.448] (-329.063) (-332.782) (-327.991) * [-331.637] (-329.631) (-330.260) (-330.698) -- 0:00:27
606500 -- (-328.210) [-328.276] (-332.027) (-330.878) * [-329.105] (-327.885) (-335.532) (-328.389) -- 0:00:27
607000 -- (-330.752) (-332.895) (-331.091) [-328.507] * (-329.122) [-327.655] (-334.080) (-331.802) -- 0:00:27
607500 -- (-331.245) (-331.220) [-327.854] (-329.617) * [-327.827] (-331.020) (-330.144) (-329.618) -- 0:00:27
608000 -- [-334.600] (-328.646) (-331.130) (-331.807) * (-332.930) [-329.735] (-329.517) (-331.480) -- 0:00:27
608500 -- (-334.544) (-328.274) [-329.486] (-333.146) * (-331.095) (-329.217) [-329.525] (-331.895) -- 0:00:27
609000 -- (-333.974) [-328.981] (-329.706) (-327.965) * (-331.673) (-328.952) [-330.072] (-335.369) -- 0:00:26
609500 -- (-331.528) (-328.169) (-329.107) [-328.435] * (-332.517) (-328.944) (-330.396) [-331.072] -- 0:00:26
610000 -- (-329.948) (-329.260) [-327.887] (-329.741) * [-328.225] (-331.635) (-329.614) (-329.953) -- 0:00:26
Average standard deviation of split frequencies: 0.010373
610500 -- [-327.893] (-329.026) (-331.975) (-331.093) * (-328.819) (-330.024) [-330.475] (-330.038) -- 0:00:26
611000 -- (-328.853) [-331.326] (-329.727) (-330.187) * (-331.150) (-328.726) [-330.918] (-331.340) -- 0:00:26
611500 -- (-331.047) (-331.292) [-328.136] (-328.590) * (-331.083) [-329.574] (-330.172) (-331.349) -- 0:00:26
612000 -- [-329.253] (-329.387) (-335.394) (-330.867) * (-334.043) (-329.876) [-328.575] (-332.696) -- 0:00:26
612500 -- (-329.335) [-327.680] (-329.093) (-329.591) * (-329.605) (-329.701) (-329.331) [-329.705] -- 0:00:26
613000 -- [-328.087] (-331.036) (-329.139) (-328.410) * (-328.887) (-329.498) (-328.391) [-328.540] -- 0:00:26
613500 -- (-335.493) (-329.808) [-329.538] (-331.130) * (-328.772) (-329.398) (-331.935) [-329.401] -- 0:00:26
614000 -- (-331.146) [-327.579] (-330.832) (-328.550) * (-327.926) [-329.715] (-333.354) (-328.587) -- 0:00:26
614500 -- (-329.328) [-329.434] (-329.413) (-330.130) * (-328.408) (-328.467) [-328.962] (-328.927) -- 0:00:26
615000 -- (-328.896) (-333.949) [-332.550] (-330.312) * (-328.857) [-327.778] (-332.532) (-331.084) -- 0:00:26
Average standard deviation of split frequencies: 0.009805
615500 -- (-328.872) (-331.351) [-331.921] (-331.391) * (-329.739) (-331.846) (-328.729) [-334.656] -- 0:00:26
616000 -- (-330.323) [-331.089] (-330.203) (-330.046) * [-330.814] (-329.090) (-330.011) (-331.350) -- 0:00:26
616500 -- (-329.343) (-330.027) (-332.847) [-327.766] * (-330.510) [-328.181] (-330.004) (-332.317) -- 0:00:26
617000 -- (-328.864) [-331.496] (-332.329) (-329.788) * (-330.468) (-327.801) [-327.773] (-333.681) -- 0:00:26
617500 -- (-330.885) [-328.598] (-327.829) (-330.754) * (-328.024) (-331.303) [-328.989] (-328.718) -- 0:00:26
618000 -- (-331.634) [-328.775] (-330.109) (-330.785) * (-328.762) (-330.994) (-330.869) [-329.566] -- 0:00:25
618500 -- [-332.438] (-331.662) (-329.082) (-330.818) * (-329.747) (-329.217) (-336.500) [-328.247] -- 0:00:25
619000 -- [-329.744] (-329.473) (-331.055) (-334.371) * (-329.744) (-329.444) [-329.914] (-329.748) -- 0:00:25
619500 -- (-328.976) [-327.615] (-328.694) (-330.891) * (-329.186) [-329.058] (-328.618) (-332.985) -- 0:00:26
620000 -- [-329.743] (-328.006) (-331.065) (-330.758) * (-340.344) [-332.972] (-328.684) (-329.413) -- 0:00:26
Average standard deviation of split frequencies: 0.009257
620500 -- [-331.199] (-329.750) (-329.628) (-329.523) * (-331.073) [-330.034] (-329.937) (-327.894) -- 0:00:26
621000 -- (-332.632) [-328.955] (-329.297) (-328.462) * (-332.751) [-329.734] (-331.000) (-330.149) -- 0:00:26
621500 -- (-333.812) (-330.605) (-331.076) [-329.003] * (-329.552) (-329.112) (-328.759) [-329.654] -- 0:00:26
622000 -- (-332.626) (-329.941) [-329.568] (-329.036) * (-328.893) (-331.883) [-329.909] (-328.266) -- 0:00:26
622500 -- (-333.712) [-330.023] (-331.085) (-328.827) * (-337.715) (-328.529) (-329.000) [-330.871] -- 0:00:26
623000 -- (-328.170) (-337.165) (-334.458) [-331.227] * [-330.467] (-328.987) (-329.399) (-329.549) -- 0:00:26
623500 -- [-328.926] (-328.527) (-328.410) (-329.417) * (-333.304) (-331.530) [-332.071] (-329.372) -- 0:00:25
624000 -- (-331.631) [-327.603] (-328.730) (-329.206) * (-329.157) [-328.336] (-328.025) (-331.147) -- 0:00:25
624500 -- [-331.609] (-328.980) (-330.972) (-328.570) * (-329.994) [-330.710] (-329.899) (-328.899) -- 0:00:25
625000 -- (-331.850) [-330.027] (-330.585) (-328.243) * (-331.992) (-338.189) (-332.637) [-328.017] -- 0:00:25
Average standard deviation of split frequencies: 0.008895
625500 -- [-328.050] (-328.370) (-328.429) (-329.445) * (-330.183) [-334.965] (-330.509) (-329.362) -- 0:00:25
626000 -- (-327.601) (-328.843) [-328.261] (-331.222) * (-333.500) [-330.008] (-328.409) (-334.726) -- 0:00:25
626500 -- [-328.736] (-332.900) (-328.274) (-328.461) * (-330.570) (-330.836) [-327.648] (-333.715) -- 0:00:25
627000 -- (-328.145) (-331.918) [-329.344] (-329.493) * (-328.761) (-328.921) (-329.347) [-328.194] -- 0:00:25
627500 -- [-328.922] (-331.674) (-330.444) (-328.793) * (-332.363) (-328.545) [-329.188] (-330.108) -- 0:00:25
628000 -- [-328.319] (-329.223) (-331.509) (-328.254) * (-329.239) [-328.295] (-330.722) (-334.036) -- 0:00:25
628500 -- (-330.156) [-329.774] (-329.399) (-328.596) * (-327.594) (-329.430) [-329.685] (-329.755) -- 0:00:25
629000 -- [-327.773] (-333.004) (-335.632) (-328.479) * [-329.276] (-329.413) (-331.479) (-329.525) -- 0:00:25
629500 -- (-327.547) (-331.798) [-332.169] (-328.535) * (-330.115) [-328.346] (-333.767) (-331.509) -- 0:00:25
630000 -- (-327.790) [-332.607] (-333.366) (-331.929) * (-334.752) (-329.360) (-330.388) [-328.829] -- 0:00:25
Average standard deviation of split frequencies: 0.009484
630500 -- (-330.359) (-329.088) [-329.259] (-329.366) * (-331.524) (-336.770) (-330.037) [-329.583] -- 0:00:25
631000 -- [-328.722] (-327.747) (-328.711) (-329.559) * (-328.211) (-330.933) (-331.054) [-329.532] -- 0:00:25
631500 -- (-330.900) (-331.023) (-328.484) [-329.115] * (-328.984) (-330.046) [-332.007] (-328.963) -- 0:00:25
632000 -- (-331.086) [-330.248] (-331.696) (-334.628) * (-329.243) [-327.785] (-328.143) (-333.349) -- 0:00:25
632500 -- [-330.666] (-331.126) (-332.142) (-330.282) * (-329.490) [-328.864] (-330.104) (-329.890) -- 0:00:24
633000 -- [-328.594] (-331.882) (-332.285) (-334.000) * (-330.323) (-331.053) [-330.837] (-331.477) -- 0:00:24
633500 -- (-330.049) (-329.824) [-330.997] (-334.004) * (-329.125) [-327.895] (-328.981) (-331.336) -- 0:00:24
634000 -- (-331.199) [-329.766] (-328.256) (-328.768) * (-333.694) [-329.153] (-328.790) (-328.734) -- 0:00:25
634500 -- [-331.929] (-329.130) (-329.523) (-329.675) * (-328.809) (-329.766) [-328.116] (-330.542) -- 0:00:25
635000 -- (-327.630) [-329.909] (-329.955) (-329.398) * (-329.349) [-329.976] (-328.670) (-328.263) -- 0:00:25
Average standard deviation of split frequencies: 0.010562
635500 -- (-327.762) (-330.666) [-329.225] (-329.231) * (-328.357) (-328.496) (-328.908) [-328.815] -- 0:00:25
636000 -- (-331.127) (-331.820) [-331.690] (-329.548) * (-329.884) (-329.458) (-330.890) [-328.719] -- 0:00:25
636500 -- (-329.530) [-329.284] (-331.095) (-327.855) * [-328.404] (-332.539) (-331.246) (-329.115) -- 0:00:25
637000 -- (-330.415) (-328.933) [-329.233] (-331.685) * (-328.074) [-331.531] (-331.760) (-329.604) -- 0:00:25
637500 -- (-332.456) (-328.617) (-330.918) [-330.542] * (-329.371) (-328.913) [-332.629] (-329.166) -- 0:00:25
638000 -- (-332.306) (-333.207) [-332.133] (-330.435) * (-329.701) [-329.673] (-331.581) (-328.408) -- 0:00:24
638500 -- [-327.759] (-330.936) (-328.603) (-332.067) * [-328.978] (-332.158) (-335.366) (-331.086) -- 0:00:24
639000 -- (-330.694) (-329.525) [-328.197] (-328.348) * [-332.221] (-330.276) (-332.057) (-329.895) -- 0:00:24
639500 -- (-327.815) (-330.060) (-329.779) [-328.161] * (-328.718) (-330.918) [-329.016] (-329.893) -- 0:00:24
640000 -- (-328.977) (-328.611) [-328.353] (-328.516) * [-331.682] (-327.888) (-329.908) (-328.283) -- 0:00:24
Average standard deviation of split frequencies: 0.010531
640500 -- (-332.633) [-329.387] (-327.878) (-333.300) * [-329.753] (-331.497) (-332.271) (-328.960) -- 0:00:24
641000 -- [-330.649] (-327.669) (-330.616) (-330.626) * [-332.013] (-330.974) (-328.417) (-328.864) -- 0:00:24
641500 -- (-329.782) (-331.845) (-330.744) [-328.495] * (-341.310) (-329.182) [-328.211] (-328.415) -- 0:00:24
642000 -- [-332.241] (-329.125) (-331.345) (-331.516) * (-345.535) (-330.528) (-328.937) [-327.621] -- 0:00:24
642500 -- (-331.247) (-332.865) [-328.409] (-328.314) * (-334.399) (-328.538) [-327.948] (-328.625) -- 0:00:24
643000 -- (-336.257) (-329.876) (-327.659) [-330.475] * [-331.221] (-330.243) (-328.700) (-333.887) -- 0:00:24
643500 -- [-330.065] (-331.584) (-328.296) (-332.536) * (-328.349) (-331.226) [-327.861] (-327.795) -- 0:00:24
644000 -- [-329.194] (-329.574) (-334.008) (-328.205) * [-328.336] (-328.490) (-327.848) (-331.949) -- 0:00:24
644500 -- (-330.204) (-328.910) (-329.002) [-330.449] * (-331.892) (-329.347) (-329.665) [-327.738] -- 0:00:24
645000 -- [-331.284] (-331.361) (-328.162) (-329.096) * [-332.632] (-328.915) (-329.292) (-328.434) -- 0:00:24
Average standard deviation of split frequencies: 0.010535
645500 -- (-332.462) (-327.751) [-330.881] (-330.536) * (-330.745) (-329.782) (-328.011) [-327.932] -- 0:00:24
646000 -- (-334.813) (-333.863) [-333.033] (-331.513) * [-331.113] (-331.804) (-329.521) (-328.885) -- 0:00:24
646500 -- [-327.658] (-328.811) (-327.590) (-330.634) * (-329.930) [-338.422] (-328.356) (-331.638) -- 0:00:24
647000 -- (-327.774) (-329.876) (-330.760) [-330.359] * (-332.513) (-333.570) [-328.745] (-328.723) -- 0:00:24
647500 -- (-328.768) (-329.171) (-330.571) [-328.813] * (-329.833) (-331.586) (-328.536) [-331.707] -- 0:00:23
648000 -- (-330.226) [-329.127] (-329.753) (-329.602) * (-331.505) (-332.238) (-332.517) [-328.508] -- 0:00:23
648500 -- (-332.618) [-328.273] (-329.719) (-330.364) * (-330.621) [-330.522] (-332.083) (-329.060) -- 0:00:23
649000 -- (-335.844) (-329.803) (-332.061) [-328.996] * [-330.357] (-327.540) (-330.093) (-329.863) -- 0:00:24
649500 -- (-330.494) (-331.401) [-329.213] (-329.017) * (-330.191) (-327.882) (-330.507) [-328.189] -- 0:00:24
650000 -- (-332.123) (-333.232) (-328.404) [-329.413] * (-334.334) [-331.404] (-329.493) (-330.703) -- 0:00:24
Average standard deviation of split frequencies: 0.010143
650500 -- [-329.679] (-332.067) (-329.365) (-331.680) * (-330.159) (-327.900) (-327.679) [-330.053] -- 0:00:24
651000 -- (-331.504) (-330.235) [-327.851] (-331.110) * [-328.454] (-329.454) (-330.288) (-332.286) -- 0:00:24
651500 -- (-331.044) [-327.751] (-329.314) (-330.802) * (-328.254) [-329.106] (-329.045) (-331.215) -- 0:00:24
652000 -- (-329.531) (-330.656) [-327.737] (-328.523) * [-329.615] (-329.164) (-328.230) (-334.473) -- 0:00:24
652500 -- (-329.565) [-331.681] (-329.479) (-331.267) * [-334.228] (-328.364) (-328.916) (-331.702) -- 0:00:23
653000 -- [-328.810] (-329.057) (-328.334) (-329.673) * (-328.728) (-330.441) (-329.868) [-329.406] -- 0:00:23
653500 -- (-328.762) (-328.923) (-329.060) [-329.285] * (-329.375) (-328.596) (-329.266) [-329.973] -- 0:00:23
654000 -- [-328.478] (-328.236) (-331.787) (-329.137) * [-329.991] (-328.423) (-331.460) (-329.611) -- 0:00:23
654500 -- (-328.059) (-329.671) (-331.520) [-329.088] * [-328.642] (-328.070) (-331.576) (-332.159) -- 0:00:23
655000 -- (-330.623) (-329.910) (-328.375) [-328.682] * (-331.490) (-328.020) (-330.970) [-330.954] -- 0:00:23
Average standard deviation of split frequencies: 0.010644
655500 -- (-330.844) (-333.348) [-334.059] (-330.433) * (-329.618) (-328.985) [-328.955] (-328.613) -- 0:00:23
656000 -- (-331.234) (-330.726) [-327.813] (-330.181) * (-328.519) [-328.436] (-328.260) (-331.991) -- 0:00:23
656500 -- (-330.774) (-329.979) (-334.159) [-329.503] * (-329.318) (-333.048) [-331.762] (-328.545) -- 0:00:23
657000 -- (-330.340) (-330.200) (-331.934) [-328.848] * (-331.780) [-330.819] (-329.144) (-330.247) -- 0:00:23
657500 -- (-332.520) (-328.365) (-329.348) [-329.148] * (-330.288) [-331.759] (-329.826) (-331.825) -- 0:00:23
658000 -- (-331.922) [-329.165] (-330.164) (-331.422) * (-330.700) (-331.096) (-328.990) [-328.107] -- 0:00:23
658500 -- (-330.428) (-328.069) (-328.026) [-329.987] * (-329.223) (-336.190) (-331.207) [-330.062] -- 0:00:23
659000 -- (-330.217) (-328.745) [-327.484] (-331.655) * (-335.433) (-334.939) [-332.418] (-330.054) -- 0:00:23
659500 -- (-332.007) [-328.248] (-328.500) (-336.562) * (-336.749) [-327.620] (-327.913) (-328.803) -- 0:00:23
660000 -- (-330.240) (-327.588) [-328.318] (-331.209) * (-330.002) (-330.485) (-328.364) [-329.336] -- 0:00:23
Average standard deviation of split frequencies: 0.010346
660500 -- (-329.400) [-329.582] (-332.443) (-338.975) * [-327.961] (-331.198) (-329.381) (-332.082) -- 0:00:23
661000 -- (-329.184) (-327.588) [-328.856] (-331.511) * [-328.422] (-330.417) (-327.905) (-328.039) -- 0:00:23
661500 -- (-330.238) (-329.838) (-329.556) [-328.976] * (-330.417) (-329.898) [-328.947] (-328.179) -- 0:00:23
662000 -- [-327.427] (-331.707) (-330.208) (-329.263) * [-331.764] (-331.836) (-330.307) (-329.514) -- 0:00:22
662500 -- [-329.554] (-328.662) (-331.169) (-329.514) * [-327.882] (-330.930) (-331.713) (-328.779) -- 0:00:22
663000 -- (-329.053) (-328.859) [-329.519] (-333.666) * [-328.658] (-332.709) (-329.123) (-331.626) -- 0:00:22
663500 -- (-328.679) (-331.150) [-328.320] (-334.026) * (-333.182) (-331.170) (-329.972) [-333.118] -- 0:00:23
664000 -- [-328.544] (-328.265) (-328.920) (-329.831) * (-328.310) (-328.070) [-328.016] (-330.408) -- 0:00:23
664500 -- (-329.813) (-332.925) (-328.487) [-328.243] * (-330.263) (-329.419) (-329.330) [-329.252] -- 0:00:23
665000 -- (-327.752) (-330.813) [-328.966] (-328.681) * (-328.051) [-329.995] (-331.815) (-328.810) -- 0:00:23
Average standard deviation of split frequencies: 0.009511
665500 -- [-330.810] (-329.879) (-330.429) (-328.646) * (-329.021) (-329.436) (-331.982) [-329.017] -- 0:00:23
666000 -- (-329.744) (-331.065) (-329.361) [-329.798] * (-328.659) (-330.140) (-332.450) [-330.444] -- 0:00:23
666500 -- [-329.026] (-334.327) (-332.351) (-329.910) * (-328.447) (-330.092) [-332.708] (-330.482) -- 0:00:23
667000 -- (-328.982) (-328.600) [-329.351] (-329.349) * (-331.233) [-328.235] (-328.390) (-330.321) -- 0:00:22
667500 -- (-329.122) [-330.775] (-329.754) (-328.587) * [-329.538] (-328.938) (-329.119) (-333.669) -- 0:00:22
668000 -- (-332.455) (-328.851) [-328.968] (-328.807) * (-329.825) (-330.420) [-327.659] (-335.309) -- 0:00:22
668500 -- (-330.339) (-329.351) (-331.577) [-328.921] * (-329.004) (-330.846) [-327.692] (-329.723) -- 0:00:22
669000 -- (-330.423) (-331.145) [-328.042] (-328.724) * (-330.569) (-328.938) (-330.458) [-331.402] -- 0:00:22
669500 -- (-330.336) (-335.763) [-328.951] (-331.090) * [-329.773] (-333.312) (-330.292) (-328.555) -- 0:00:22
670000 -- (-328.985) (-330.715) [-330.565] (-336.509) * (-328.752) [-334.283] (-330.286) (-330.610) -- 0:00:22
Average standard deviation of split frequencies: 0.009006
670500 -- (-327.606) [-329.136] (-328.940) (-332.627) * (-328.459) (-328.398) (-329.260) [-328.115] -- 0:00:22
671000 -- (-327.574) (-329.083) (-328.465) [-328.526] * (-330.681) [-329.684] (-330.050) (-329.000) -- 0:00:22
671500 -- (-329.473) (-328.987) [-329.422] (-333.343) * (-330.654) [-329.394] (-328.658) (-329.320) -- 0:00:22
672000 -- (-329.517) (-331.579) (-328.683) [-331.403] * (-329.839) (-330.915) (-327.959) [-329.801] -- 0:00:22
672500 -- (-330.511) (-334.074) [-328.086] (-328.390) * (-330.506) [-332.267] (-329.111) (-329.321) -- 0:00:22
673000 -- (-332.628) (-330.656) (-329.738) [-329.541] * (-329.311) (-330.916) [-328.615] (-330.571) -- 0:00:22
673500 -- (-328.566) (-328.253) (-328.226) [-331.379] * [-328.272] (-331.503) (-329.265) (-329.218) -- 0:00:22
674000 -- (-329.249) (-330.195) [-328.071] (-329.928) * (-329.553) (-330.576) [-329.007] (-329.346) -- 0:00:22
674500 -- (-328.846) [-329.174] (-328.969) (-330.829) * (-334.690) (-330.560) (-328.990) [-331.299] -- 0:00:22
675000 -- [-331.267] (-329.454) (-328.018) (-328.563) * (-330.766) (-329.807) (-328.530) [-329.892] -- 0:00:22
Average standard deviation of split frequencies: 0.009458
675500 -- (-330.514) (-331.467) [-328.210] (-330.052) * (-332.968) (-327.881) (-330.664) [-334.640] -- 0:00:22
676000 -- (-331.067) (-330.655) (-328.084) [-331.314] * (-329.728) [-328.254] (-330.201) (-329.302) -- 0:00:22
676500 -- (-328.167) [-330.137] (-330.872) (-328.263) * [-328.280] (-327.945) (-328.271) (-328.234) -- 0:00:21
677000 -- (-330.053) [-329.429] (-329.232) (-330.568) * (-328.201) (-327.774) [-328.398] (-330.435) -- 0:00:21
677500 -- (-332.998) (-330.716) (-331.062) [-330.419] * (-330.708) (-328.881) (-328.227) [-329.191] -- 0:00:21
678000 -- (-332.342) (-332.321) [-329.633] (-329.783) * (-329.282) (-332.103) [-329.834] (-327.858) -- 0:00:22
678500 -- (-331.761) (-329.274) (-328.390) [-329.963] * (-331.564) (-327.421) [-329.835] (-328.600) -- 0:00:22
679000 -- (-327.924) (-330.246) (-328.749) [-331.233] * [-327.677] (-332.099) (-329.895) (-329.119) -- 0:00:22
679500 -- (-329.586) (-330.494) (-328.215) [-327.689] * (-330.232) (-331.911) (-329.775) [-328.860] -- 0:00:22
680000 -- (-327.931) (-332.520) (-332.757) [-328.274] * [-330.606] (-329.475) (-329.924) (-329.147) -- 0:00:22
Average standard deviation of split frequencies: 0.009739
680500 -- (-328.838) [-328.091] (-330.150) (-329.645) * (-331.080) (-331.095) (-329.955) [-328.130] -- 0:00:22
681000 -- (-330.325) (-329.800) (-328.653) [-330.552] * (-328.688) (-331.669) (-328.271) [-328.280] -- 0:00:22
681500 -- [-328.607] (-330.228) (-331.591) (-328.281) * (-328.481) [-329.510] (-330.536) (-332.545) -- 0:00:21
682000 -- (-329.454) [-331.732] (-329.800) (-334.232) * (-329.517) (-331.292) [-330.928] (-331.995) -- 0:00:21
682500 -- (-328.725) (-329.354) [-328.553] (-331.246) * [-332.927] (-329.079) (-329.144) (-328.123) -- 0:00:21
683000 -- [-327.894] (-330.027) (-328.600) (-328.040) * (-329.679) [-336.876] (-329.775) (-331.372) -- 0:00:21
683500 -- (-329.069) (-329.339) (-329.185) [-328.757] * [-328.412] (-331.853) (-330.570) (-328.252) -- 0:00:21
684000 -- [-330.965] (-328.682) (-329.184) (-332.714) * (-327.962) (-328.990) (-330.458) [-330.343] -- 0:00:21
684500 -- (-329.328) (-334.408) [-332.607] (-330.596) * (-329.490) (-328.891) (-331.188) [-329.907] -- 0:00:21
685000 -- (-330.241) [-330.157] (-330.978) (-331.109) * (-328.248) (-330.196) [-328.136] (-329.572) -- 0:00:21
Average standard deviation of split frequencies: 0.009449
685500 -- (-329.176) (-328.619) [-328.649] (-331.244) * (-328.360) [-328.567] (-330.185) (-330.832) -- 0:00:21
686000 -- (-331.293) [-331.169] (-333.117) (-327.653) * (-327.558) (-329.905) (-330.542) [-329.671] -- 0:00:21
686500 -- (-332.526) [-328.740] (-333.899) (-328.280) * [-327.743] (-331.119) (-328.920) (-328.259) -- 0:00:21
687000 -- [-328.927] (-330.767) (-328.379) (-329.218) * [-330.683] (-331.095) (-329.758) (-328.711) -- 0:00:21
687500 -- (-327.999) [-328.924] (-328.736) (-330.414) * [-328.777] (-330.298) (-327.928) (-329.115) -- 0:00:21
688000 -- (-329.579) (-331.194) (-329.253) [-330.092] * (-329.969) (-332.235) [-330.289] (-330.930) -- 0:00:21
688500 -- (-329.886) [-334.780] (-331.094) (-329.248) * (-330.881) (-330.070) (-330.972) [-329.273] -- 0:00:21
689000 -- [-333.604] (-331.991) (-328.752) (-331.007) * (-332.628) [-328.420] (-329.219) (-330.047) -- 0:00:21
689500 -- (-328.921) (-329.802) (-331.817) [-330.008] * (-330.873) (-328.486) (-329.740) [-329.652] -- 0:00:21
690000 -- (-331.073) (-329.558) [-330.012] (-329.536) * (-333.276) (-327.806) (-328.221) [-328.682] -- 0:00:21
Average standard deviation of split frequencies: 0.009641
690500 -- (-329.910) (-329.453) [-334.450] (-334.445) * (-330.388) (-327.662) [-332.035] (-329.308) -- 0:00:21
691000 -- (-332.552) (-331.786) [-332.970] (-331.261) * (-331.815) (-329.101) (-329.923) [-329.538] -- 0:00:21
691500 -- [-333.627] (-329.199) (-331.280) (-330.127) * (-328.183) (-328.306) [-329.194] (-329.846) -- 0:00:20
692000 -- (-334.015) (-330.612) [-332.807] (-329.915) * (-331.321) [-328.107] (-329.034) (-329.486) -- 0:00:20
692500 -- (-328.049) (-330.281) [-329.685] (-330.657) * (-332.184) [-330.371] (-329.132) (-329.040) -- 0:00:21
693000 -- [-329.465] (-329.737) (-331.693) (-336.811) * (-333.906) (-329.577) [-328.323] (-328.126) -- 0:00:21
693500 -- (-329.048) [-328.616] (-328.335) (-327.852) * (-335.652) (-329.144) [-329.292] (-327.995) -- 0:00:21
694000 -- (-328.904) [-329.120] (-329.310) (-328.435) * (-333.567) (-331.130) [-329.355] (-328.737) -- 0:00:21
694500 -- (-329.893) (-330.887) [-328.698] (-332.170) * (-331.568) [-328.854] (-328.541) (-329.897) -- 0:00:21
695000 -- (-329.907) (-329.747) (-328.612) [-328.443] * [-331.355] (-331.402) (-329.112) (-332.811) -- 0:00:21
Average standard deviation of split frequencies: 0.009017
695500 -- (-329.964) [-328.330] (-328.264) (-329.018) * (-329.530) (-330.267) (-328.840) [-329.536] -- 0:00:21
696000 -- [-328.659] (-327.665) (-329.729) (-330.024) * (-329.302) (-328.967) (-332.065) [-327.845] -- 0:00:20
696500 -- [-328.615] (-332.967) (-328.250) (-327.752) * (-330.991) (-333.004) (-331.591) [-330.535] -- 0:00:20
697000 -- (-330.685) [-331.116] (-329.198) (-327.935) * [-329.998] (-331.723) (-329.509) (-332.207) -- 0:00:20
697500 -- [-331.275] (-330.100) (-328.236) (-331.611) * (-329.475) (-328.653) (-327.576) [-335.784] -- 0:00:20
698000 -- (-329.880) (-331.746) (-328.087) [-332.326] * (-329.719) (-328.339) [-328.006] (-329.216) -- 0:00:20
698500 -- (-329.961) [-327.752] (-328.980) (-330.906) * (-328.149) (-328.013) (-332.917) [-329.566] -- 0:00:20
699000 -- (-331.109) (-329.561) (-330.348) [-329.940] * (-334.363) (-328.076) (-333.868) [-331.221] -- 0:00:20
699500 -- (-330.202) (-328.565) [-330.243] (-333.390) * [-327.613] (-331.674) (-330.622) (-329.590) -- 0:00:20
700000 -- (-332.717) [-336.017] (-330.855) (-330.767) * [-330.112] (-331.069) (-328.844) (-329.607) -- 0:00:20
Average standard deviation of split frequencies: 0.008208
700500 -- (-335.704) [-329.012] (-332.196) (-333.969) * (-329.661) [-329.388] (-328.905) (-332.081) -- 0:00:20
701000 -- (-328.884) (-327.955) [-331.935] (-329.286) * (-328.504) (-332.443) [-328.414] (-331.680) -- 0:00:20
701500 -- (-328.855) [-328.153] (-329.177) (-333.630) * [-330.470] (-331.134) (-333.983) (-329.164) -- 0:00:20
702000 -- [-330.290] (-328.526) (-328.825) (-328.444) * [-328.024] (-332.773) (-329.029) (-329.522) -- 0:00:20
702500 -- (-330.477) [-330.105] (-331.907) (-331.721) * (-331.430) (-331.838) [-331.691] (-330.391) -- 0:00:20
703000 -- [-328.812] (-328.379) (-331.033) (-331.924) * (-329.622) (-331.779) [-328.175] (-332.413) -- 0:00:20
703500 -- [-330.290] (-328.807) (-330.781) (-329.172) * (-330.348) [-328.277] (-328.153) (-330.856) -- 0:00:20
704000 -- (-329.506) [-328.906] (-329.538) (-336.546) * [-328.226] (-328.525) (-329.769) (-329.641) -- 0:00:20
704500 -- (-329.632) (-329.576) [-329.053] (-330.781) * [-328.399] (-329.064) (-330.504) (-329.451) -- 0:00:20
705000 -- [-329.822] (-330.508) (-329.220) (-331.206) * [-330.422] (-329.655) (-329.484) (-332.234) -- 0:00:20
Average standard deviation of split frequencies: 0.008191
705500 -- (-329.757) (-327.810) (-328.902) [-333.344] * [-329.472] (-330.785) (-329.510) (-327.493) -- 0:00:20
706000 -- (-328.007) (-333.336) [-328.397] (-328.905) * (-329.201) (-328.641) (-331.412) [-328.488] -- 0:00:19
706500 -- (-330.789) (-329.309) [-328.788] (-330.584) * [-329.393] (-329.230) (-330.361) (-328.487) -- 0:00:19
707000 -- [-330.874] (-331.248) (-328.311) (-329.659) * (-330.968) (-329.973) (-330.414) [-328.960] -- 0:00:20
707500 -- (-327.991) (-330.912) (-329.750) [-333.483] * (-334.645) [-331.436] (-333.780) (-328.514) -- 0:00:20
708000 -- (-328.118) [-330.667] (-329.391) (-332.281) * (-331.701) (-332.058) [-328.925] (-330.308) -- 0:00:20
708500 -- (-328.961) (-330.148) (-328.628) [-330.738] * (-328.450) [-330.452] (-331.890) (-328.049) -- 0:00:20
709000 -- [-333.422] (-329.682) (-329.974) (-330.109) * [-329.309] (-328.904) (-330.788) (-331.571) -- 0:00:20
709500 -- [-330.633] (-331.380) (-328.449) (-329.495) * (-330.824) [-328.029] (-329.680) (-330.701) -- 0:00:20
710000 -- [-328.516] (-328.857) (-328.822) (-327.951) * (-330.598) (-328.334) (-332.614) [-328.625] -- 0:00:20
Average standard deviation of split frequencies: 0.007916
710500 -- [-332.973] (-329.137) (-329.330) (-328.646) * (-331.971) (-328.780) (-330.445) [-330.856] -- 0:00:19
711000 -- (-329.339) [-329.603] (-330.155) (-330.624) * (-328.224) (-328.882) (-330.559) [-330.761] -- 0:00:19
711500 -- (-327.875) (-327.716) [-329.672] (-332.122) * [-330.787] (-332.316) (-329.284) (-329.371) -- 0:00:19
712000 -- [-328.070] (-328.062) (-330.248) (-328.824) * (-329.928) (-332.141) (-331.317) [-328.893] -- 0:00:19
712500 -- (-329.235) [-329.285] (-336.078) (-329.080) * (-327.749) (-331.339) (-329.247) [-328.705] -- 0:00:19
713000 -- (-330.958) [-330.191] (-333.913) (-329.839) * (-330.345) (-329.295) (-329.115) [-328.626] -- 0:00:19
713500 -- (-331.803) [-328.806] (-334.439) (-336.649) * (-333.248) (-327.892) (-331.424) [-328.773] -- 0:00:19
714000 -- [-328.897] (-332.876) (-330.914) (-330.128) * (-335.178) (-329.519) (-336.710) [-327.820] -- 0:00:19
714500 -- (-328.687) (-329.807) [-329.062] (-332.866) * (-330.000) (-328.822) [-330.851] (-331.216) -- 0:00:19
715000 -- [-328.614] (-329.257) (-329.726) (-332.325) * [-330.950] (-327.792) (-329.341) (-329.929) -- 0:00:19
Average standard deviation of split frequencies: 0.007857
715500 -- (-330.253) [-332.153] (-329.396) (-334.431) * (-333.005) [-327.662] (-327.903) (-329.423) -- 0:00:19
716000 -- (-328.615) (-328.976) (-332.579) [-329.324] * (-330.058) (-327.705) (-329.586) [-327.668] -- 0:00:19
716500 -- (-333.027) [-330.893] (-330.337) (-328.221) * (-330.843) [-329.972] (-334.451) (-329.507) -- 0:00:19
717000 -- (-330.660) (-329.055) [-332.918] (-330.308) * (-329.043) [-331.188] (-329.927) (-330.438) -- 0:00:19
717500 -- [-333.755] (-329.792) (-335.895) (-332.310) * [-330.386] (-327.982) (-333.767) (-330.185) -- 0:00:19
718000 -- (-330.493) [-329.058] (-334.882) (-330.366) * (-327.899) (-332.361) (-334.381) [-330.389] -- 0:00:19
718500 -- (-330.486) [-329.042] (-333.777) (-328.884) * [-330.432] (-329.597) (-329.035) (-330.216) -- 0:00:19
719000 -- [-331.000] (-330.579) (-332.305) (-328.606) * (-330.943) [-329.681] (-329.450) (-328.368) -- 0:00:19
719500 -- (-331.730) [-329.052] (-332.503) (-330.537) * (-328.679) (-330.852) (-328.254) [-328.144] -- 0:00:19
720000 -- (-327.697) (-331.142) (-331.006) [-329.195] * (-327.988) (-329.900) [-327.711] (-329.197) -- 0:00:19
Average standard deviation of split frequencies: 0.007152
720500 -- (-331.126) [-329.398] (-329.097) (-328.936) * (-330.081) [-328.347] (-328.551) (-330.272) -- 0:00:19
721000 -- (-330.248) (-328.601) (-330.983) [-328.884] * [-329.590] (-328.419) (-328.413) (-331.589) -- 0:00:18
721500 -- [-330.501] (-331.162) (-327.994) (-332.498) * (-331.597) (-329.389) [-330.920] (-327.916) -- 0:00:19
722000 -- (-331.871) [-331.182] (-330.977) (-327.828) * (-332.881) (-327.398) (-329.637) [-328.324] -- 0:00:19
722500 -- (-329.536) (-331.735) [-329.888] (-329.076) * [-332.194] (-328.686) (-329.981) (-328.449) -- 0:00:19
723000 -- (-330.394) (-331.293) (-328.754) [-331.154] * (-330.581) (-329.713) (-328.121) [-328.004] -- 0:00:19
723500 -- (-328.298) [-329.980] (-329.957) (-328.031) * (-328.288) (-330.389) [-331.212] (-327.569) -- 0:00:19
724000 -- (-328.466) (-328.749) (-329.623) [-328.622] * (-329.062) (-328.381) (-331.979) [-327.752] -- 0:00:19
724500 -- (-329.191) [-328.609] (-331.173) (-330.878) * [-328.239] (-331.660) (-331.314) (-328.920) -- 0:00:19
725000 -- (-330.592) (-330.699) [-328.443] (-330.715) * (-329.103) [-329.704] (-331.375) (-329.694) -- 0:00:18
Average standard deviation of split frequencies: 0.007792
725500 -- (-330.223) (-330.155) [-329.875] (-329.293) * [-329.528] (-328.552) (-329.596) (-330.057) -- 0:00:18
726000 -- (-329.994) (-330.869) (-329.833) [-328.811] * (-330.236) [-329.957] (-329.253) (-333.504) -- 0:00:18
726500 -- (-328.618) [-328.952] (-331.241) (-331.579) * [-334.397] (-329.025) (-328.712) (-332.209) -- 0:00:18
727000 -- (-329.861) [-332.034] (-329.381) (-332.169) * [-329.762] (-328.702) (-328.165) (-334.194) -- 0:00:18
727500 -- (-333.612) (-328.883) [-329.111] (-333.845) * (-329.306) (-336.753) (-327.869) [-330.762] -- 0:00:18
728000 -- (-329.027) (-331.115) [-329.990] (-329.975) * [-330.738] (-329.818) (-328.192) (-328.509) -- 0:00:18
728500 -- (-329.138) (-329.184) [-328.466] (-329.370) * [-330.366] (-333.151) (-327.817) (-328.837) -- 0:00:18
729000 -- (-328.278) (-329.003) (-332.709) [-328.597] * (-329.057) (-328.915) [-330.557] (-327.947) -- 0:00:18
729500 -- (-330.042) (-333.197) (-331.098) [-328.086] * (-332.345) (-330.319) (-329.769) [-328.567] -- 0:00:18
730000 -- (-329.936) (-328.839) [-331.424] (-328.618) * (-328.751) (-328.678) (-329.609) [-329.017] -- 0:00:18
Average standard deviation of split frequencies: 0.008731
730500 -- (-331.173) [-328.263] (-327.895) (-329.968) * [-328.877] (-332.702) (-327.846) (-327.978) -- 0:00:18
731000 -- (-330.165) [-328.003] (-328.985) (-330.505) * [-330.516] (-330.180) (-329.658) (-329.746) -- 0:00:18
731500 -- (-329.423) (-328.664) [-329.157] (-329.929) * (-333.265) (-327.897) [-328.870] (-337.811) -- 0:00:18
732000 -- [-330.092] (-327.968) (-329.165) (-328.295) * (-329.616) (-327.581) (-332.089) [-328.170] -- 0:00:18
732500 -- (-332.222) (-329.236) (-329.604) [-331.480] * (-328.569) [-328.502] (-327.860) (-331.255) -- 0:00:18
733000 -- (-328.230) [-328.509] (-329.801) (-332.852) * [-328.675] (-328.885) (-328.061) (-330.682) -- 0:00:18
733500 -- [-328.060] (-329.617) (-327.893) (-330.310) * (-330.279) (-331.665) [-331.482] (-331.050) -- 0:00:18
734000 -- (-332.574) (-329.038) (-328.564) [-330.314] * [-332.298] (-332.047) (-331.741) (-328.373) -- 0:00:18
734500 -- (-331.882) (-330.375) [-331.638] (-329.965) * (-329.959) (-331.281) (-327.886) [-328.764] -- 0:00:18
735000 -- [-329.216] (-329.713) (-332.177) (-329.012) * (-331.761) (-333.713) (-328.065) [-329.289] -- 0:00:18
Average standard deviation of split frequencies: 0.008625
735500 -- (-327.997) [-330.012] (-328.994) (-329.419) * (-332.353) [-327.718] (-331.149) (-329.202) -- 0:00:17
736000 -- (-329.649) [-329.451] (-339.184) (-330.282) * (-328.816) (-329.784) [-329.134] (-331.319) -- 0:00:18
736500 -- (-330.076) [-332.194] (-332.280) (-328.069) * (-331.293) (-330.893) (-328.731) [-331.288] -- 0:00:18
737000 -- (-329.758) (-333.811) (-333.828) [-330.527] * (-327.921) [-328.097] (-332.956) (-333.302) -- 0:00:18
737500 -- [-331.431] (-329.972) (-333.610) (-329.685) * (-328.694) (-331.102) (-332.246) [-328.632] -- 0:00:18
738000 -- (-333.495) (-329.202) (-333.998) [-329.635] * (-334.600) (-330.923) (-331.026) [-331.990] -- 0:00:18
738500 -- [-329.451] (-329.605) (-332.890) (-328.639) * (-331.196) [-328.084] (-329.886) (-329.489) -- 0:00:18
739000 -- (-328.931) [-328.779] (-329.116) (-329.986) * (-330.629) [-329.335] (-328.749) (-328.397) -- 0:00:18
739500 -- (-331.002) [-329.124] (-330.630) (-336.690) * (-330.592) [-331.115] (-330.383) (-329.018) -- 0:00:17
740000 -- (-329.730) (-330.249) [-331.800] (-330.777) * (-331.521) (-332.696) (-333.560) [-328.240] -- 0:00:17
Average standard deviation of split frequencies: 0.008232
740500 -- (-328.213) (-330.020) (-332.423) [-330.357] * (-328.550) (-332.020) (-332.753) [-330.609] -- 0:00:17
741000 -- [-331.557] (-330.880) (-331.007) (-327.987) * (-329.120) (-331.846) (-328.529) [-329.083] -- 0:00:17
741500 -- (-329.844) [-327.559] (-329.780) (-330.563) * (-331.741) (-328.758) (-329.896) [-331.068] -- 0:00:17
742000 -- (-329.419) [-327.745] (-329.334) (-331.437) * (-334.233) [-329.553] (-329.407) (-331.459) -- 0:00:17
742500 -- [-330.396] (-329.620) (-329.509) (-331.728) * (-328.946) (-329.783) (-331.717) [-330.118] -- 0:00:17
743000 -- (-328.763) (-331.077) (-328.959) [-330.299] * [-328.717] (-328.704) (-331.147) (-332.071) -- 0:00:17
743500 -- [-328.925] (-329.644) (-330.990) (-327.851) * (-330.111) [-328.159] (-328.875) (-329.549) -- 0:00:17
744000 -- (-331.500) (-329.243) [-328.917] (-330.536) * [-330.802] (-329.436) (-328.885) (-329.718) -- 0:00:17
744500 -- [-330.349] (-329.642) (-328.415) (-334.895) * [-327.896] (-328.744) (-328.290) (-328.822) -- 0:00:17
745000 -- (-331.771) (-328.820) (-329.782) [-331.003] * (-328.340) (-328.434) (-329.759) [-328.522] -- 0:00:17
Average standard deviation of split frequencies: 0.008215
745500 -- [-331.092] (-328.266) (-329.688) (-329.245) * (-330.084) (-328.493) (-329.086) [-329.456] -- 0:00:17
746000 -- (-334.653) [-328.578] (-333.070) (-329.429) * (-328.434) (-331.776) [-328.509] (-331.859) -- 0:00:17
746500 -- (-333.345) (-330.620) (-332.998) [-327.774] * (-329.125) (-329.448) (-329.612) [-329.848] -- 0:00:17
747000 -- (-332.524) [-328.895] (-328.601) (-331.667) * (-329.170) [-328.237] (-329.804) (-328.588) -- 0:00:17
747500 -- (-331.300) (-328.025) (-329.118) [-329.617] * (-328.308) (-328.826) [-329.101] (-328.581) -- 0:00:17
748000 -- (-329.042) [-329.356] (-331.012) (-328.379) * (-328.961) [-328.380] (-327.981) (-328.778) -- 0:00:17
748500 -- (-331.780) (-333.169) (-329.096) [-328.991] * (-329.510) [-333.348] (-328.991) (-329.677) -- 0:00:17
749000 -- [-329.576] (-329.602) (-330.208) (-329.054) * (-328.834) (-331.145) [-331.452] (-328.400) -- 0:00:17
749500 -- [-328.453] (-329.444) (-328.306) (-331.094) * (-331.292) [-327.799] (-329.341) (-329.845) -- 0:00:17
750000 -- (-330.680) [-329.463] (-328.323) (-331.396) * [-329.908] (-329.134) (-329.566) (-329.448) -- 0:00:17
Average standard deviation of split frequencies: 0.008708
750500 -- (-330.338) [-331.518] (-330.555) (-329.169) * [-328.633] (-329.827) (-330.311) (-328.420) -- 0:00:17
751000 -- (-331.378) (-328.741) [-330.211] (-329.376) * [-330.952] (-329.950) (-329.937) (-329.493) -- 0:00:17
751500 -- [-331.549] (-332.233) (-328.396) (-327.983) * (-333.292) (-330.433) (-333.260) [-330.042] -- 0:00:17
752000 -- [-329.397] (-327.406) (-330.033) (-327.995) * (-335.058) (-331.930) (-330.115) [-330.098] -- 0:00:17
752500 -- [-333.045] (-330.198) (-333.374) (-331.506) * (-336.224) (-330.081) [-329.663] (-332.643) -- 0:00:17
753000 -- (-329.570) (-330.345) [-329.638] (-331.850) * (-331.958) (-329.907) [-330.736] (-334.386) -- 0:00:17
753500 -- [-329.279] (-328.629) (-328.653) (-330.361) * (-335.136) [-328.473] (-329.861) (-329.082) -- 0:00:17
754000 -- (-330.154) (-328.819) (-328.999) [-327.820] * (-332.959) (-328.810) [-328.195] (-329.129) -- 0:00:16
754500 -- [-327.970] (-328.921) (-330.637) (-329.287) * (-332.675) [-333.093] (-328.100) (-331.669) -- 0:00:16
755000 -- (-332.649) (-329.906) [-329.483] (-328.439) * [-331.064] (-335.497) (-329.036) (-330.377) -- 0:00:16
Average standard deviation of split frequencies: 0.008771
755500 -- (-330.905) (-328.781) (-327.969) [-330.821] * [-328.186] (-330.533) (-334.995) (-331.483) -- 0:00:16
756000 -- (-329.986) [-331.817] (-327.594) (-331.380) * [-330.587] (-328.936) (-328.119) (-332.269) -- 0:00:16
756500 -- [-330.218] (-328.381) (-330.381) (-328.525) * [-330.588] (-331.804) (-328.977) (-332.276) -- 0:00:16
757000 -- (-333.667) (-330.113) [-328.989] (-329.815) * (-329.587) (-332.542) [-328.833] (-330.820) -- 0:00:16
757500 -- [-331.513] (-331.122) (-331.496) (-332.406) * [-328.783] (-330.034) (-327.810) (-327.711) -- 0:00:16
758000 -- [-329.295] (-333.869) (-329.587) (-329.070) * [-328.511] (-330.344) (-327.919) (-330.033) -- 0:00:16
758500 -- [-333.715] (-327.580) (-331.559) (-328.323) * (-328.953) (-332.111) [-330.568] (-330.320) -- 0:00:16
759000 -- [-330.215] (-331.603) (-328.059) (-332.058) * [-328.190] (-330.510) (-329.459) (-331.365) -- 0:00:16
759500 -- [-327.624] (-332.478) (-329.757) (-329.980) * (-330.814) [-330.870] (-333.190) (-328.767) -- 0:00:16
760000 -- (-332.606) (-334.173) (-327.592) [-328.021] * (-329.385) [-329.707] (-334.172) (-332.371) -- 0:00:16
Average standard deviation of split frequencies: 0.009048
760500 -- (-332.725) [-336.733] (-336.351) (-328.791) * [-331.386] (-330.029) (-332.805) (-334.065) -- 0:00:16
761000 -- [-331.823] (-330.953) (-332.146) (-328.863) * [-330.802] (-336.878) (-328.896) (-331.457) -- 0:00:16
761500 -- (-332.038) (-331.585) (-330.750) [-328.903] * [-331.884] (-330.288) (-329.220) (-328.843) -- 0:00:16
762000 -- (-330.740) (-329.504) [-331.008] (-329.029) * (-328.982) [-328.063] (-328.523) (-329.509) -- 0:00:16
762500 -- [-328.526] (-332.185) (-331.689) (-328.749) * (-330.261) (-328.094) (-330.126) [-331.124] -- 0:00:16
763000 -- (-327.741) (-332.889) [-330.116] (-328.963) * [-331.130] (-329.421) (-332.209) (-337.569) -- 0:00:16
763500 -- [-328.645] (-330.450) (-331.393) (-331.775) * [-329.817] (-333.099) (-332.654) (-329.958) -- 0:00:16
764000 -- [-328.525] (-327.977) (-330.150) (-330.670) * (-334.028) [-333.649] (-332.263) (-333.227) -- 0:00:16
764500 -- (-329.672) [-329.492] (-331.451) (-330.141) * (-335.924) [-328.317] (-330.242) (-329.552) -- 0:00:16
765000 -- (-331.183) [-329.172] (-328.459) (-330.519) * (-331.881) (-329.860) (-334.528) [-328.932] -- 0:00:15
Average standard deviation of split frequencies: 0.008985
765500 -- (-329.661) [-330.498] (-329.368) (-329.810) * (-329.164) (-327.671) (-337.736) [-330.448] -- 0:00:16
766000 -- (-332.257) [-331.676] (-331.056) (-333.754) * (-331.323) (-327.589) [-329.321] (-330.999) -- 0:00:16
766500 -- (-329.012) (-331.719) [-331.006] (-334.250) * (-331.636) [-328.441] (-330.931) (-330.031) -- 0:00:16
767000 -- [-328.370] (-332.771) (-331.708) (-329.048) * (-330.310) [-328.899] (-332.159) (-327.933) -- 0:00:16
767500 -- (-328.931) (-331.624) (-330.505) [-331.427] * (-330.084) (-330.366) (-328.085) [-329.458] -- 0:00:16
768000 -- (-332.776) (-331.011) [-331.746] (-331.257) * (-328.735) (-330.331) [-328.052] (-332.195) -- 0:00:16
768500 -- (-332.291) [-329.860] (-329.156) (-330.968) * (-329.807) (-328.752) [-329.399] (-333.755) -- 0:00:15
769000 -- [-332.513] (-328.910) (-328.774) (-328.846) * (-329.265) [-331.512] (-329.943) (-332.777) -- 0:00:15
769500 -- [-328.572] (-328.270) (-329.228) (-330.551) * [-335.727] (-331.205) (-331.190) (-330.727) -- 0:00:15
770000 -- (-330.768) [-331.709] (-330.245) (-328.895) * (-329.031) (-332.078) [-330.099] (-327.784) -- 0:00:15
Average standard deviation of split frequencies: 0.008849
770500 -- [-331.267] (-329.079) (-330.123) (-329.863) * (-328.362) (-330.300) [-330.959] (-332.293) -- 0:00:15
771000 -- (-329.123) (-330.335) [-329.560] (-331.378) * (-328.058) (-332.692) [-332.494] (-331.383) -- 0:00:15
771500 -- [-330.775] (-327.947) (-330.393) (-332.938) * [-329.585] (-328.659) (-330.547) (-329.671) -- 0:00:15
772000 -- (-328.166) (-331.540) [-329.924] (-335.234) * (-329.300) (-329.408) (-339.283) [-329.185] -- 0:00:15
772500 -- (-329.280) (-330.033) [-328.165] (-332.163) * [-335.759] (-331.960) (-331.955) (-332.173) -- 0:00:15
773000 -- (-329.690) (-329.758) [-328.010] (-335.056) * [-329.153] (-331.361) (-329.250) (-329.275) -- 0:00:15
773500 -- (-330.274) [-330.322] (-330.999) (-328.479) * (-338.032) [-330.981] (-329.678) (-330.444) -- 0:00:15
774000 -- (-328.465) (-329.066) [-327.983] (-329.978) * (-329.065) (-330.154) [-328.768] (-332.814) -- 0:00:15
774500 -- [-328.287] (-332.660) (-331.638) (-328.055) * (-331.354) [-329.057] (-330.370) (-329.648) -- 0:00:15
775000 -- (-332.174) (-329.468) [-330.137] (-329.930) * (-328.852) (-327.768) (-327.482) [-331.249] -- 0:00:15
Average standard deviation of split frequencies: 0.008829
775500 -- [-329.636] (-331.131) (-328.903) (-331.655) * [-332.995] (-332.602) (-331.051) (-333.628) -- 0:00:15
776000 -- (-331.071) (-328.654) [-328.530] (-332.595) * (-329.545) [-329.245] (-331.661) (-329.891) -- 0:00:15
776500 -- (-328.633) (-328.066) [-330.155] (-330.344) * (-331.368) (-328.908) (-328.986) [-334.589] -- 0:00:15
777000 -- (-328.390) [-329.235] (-331.899) (-329.167) * [-330.331] (-330.327) (-331.874) (-328.715) -- 0:00:15
777500 -- (-331.887) [-329.362] (-330.514) (-330.324) * (-327.664) (-335.066) (-333.903) [-329.705] -- 0:00:15
778000 -- (-329.364) [-331.083] (-331.539) (-329.931) * (-330.141) (-330.664) (-328.515) [-333.325] -- 0:00:15
778500 -- (-330.096) (-332.681) (-333.697) [-331.019] * [-328.169] (-331.941) (-330.202) (-332.294) -- 0:00:15
779000 -- [-328.296] (-334.646) (-329.985) (-330.432) * (-328.398) (-332.997) [-330.192] (-328.877) -- 0:00:15
779500 -- (-328.448) [-328.987] (-329.041) (-330.610) * (-328.791) [-331.312] (-329.290) (-332.758) -- 0:00:14
780000 -- (-331.098) (-328.902) [-331.929] (-330.561) * (-328.470) (-337.947) (-329.557) [-330.197] -- 0:00:15
Average standard deviation of split frequencies: 0.009098
780500 -- [-331.188] (-330.086) (-333.770) (-331.675) * (-330.407) [-329.439] (-328.938) (-328.776) -- 0:00:15
781000 -- [-328.964] (-329.750) (-330.840) (-329.065) * (-328.674) [-327.860] (-332.584) (-331.523) -- 0:00:15
781500 -- (-327.440) (-331.333) (-329.114) [-327.922] * [-329.052] (-330.084) (-328.879) (-331.463) -- 0:00:15
782000 -- (-332.981) (-330.554) (-331.705) [-330.695] * (-330.074) (-327.835) [-328.221] (-332.030) -- 0:00:15
782500 -- (-332.030) (-329.371) [-335.109] (-330.009) * (-330.967) (-327.607) [-329.151] (-331.447) -- 0:00:15
783000 -- (-327.811) [-330.829] (-331.811) (-329.315) * [-328.770] (-332.041) (-328.787) (-330.096) -- 0:00:14
783500 -- [-328.123] (-330.464) (-331.849) (-331.919) * [-328.100] (-331.851) (-332.118) (-327.823) -- 0:00:14
784000 -- (-327.927) (-329.146) (-328.746) [-329.026] * (-327.467) (-331.409) (-328.469) [-329.346] -- 0:00:14
784500 -- (-330.875) (-333.396) (-330.146) [-328.179] * (-327.379) [-331.710] (-330.572) (-332.871) -- 0:00:14
785000 -- (-328.914) [-329.470] (-327.848) (-328.397) * (-328.513) (-330.959) (-334.295) [-328.973] -- 0:00:14
Average standard deviation of split frequencies: 0.009316
785500 -- (-331.224) (-329.427) (-328.525) [-328.615] * (-329.527) [-328.435] (-331.995) (-330.167) -- 0:00:14
786000 -- [-329.184] (-328.319) (-328.717) (-328.051) * (-329.499) (-330.990) (-331.691) [-329.319] -- 0:00:14
786500 -- (-330.177) (-335.329) (-328.498) [-330.276] * (-333.211) (-329.921) (-332.368) [-330.236] -- 0:00:14
787000 -- (-331.434) [-328.578] (-331.448) (-331.676) * (-335.205) (-332.617) [-328.621] (-328.966) -- 0:00:14
787500 -- (-329.365) (-329.319) (-332.555) [-331.447] * (-330.483) [-335.737] (-330.257) (-329.906) -- 0:00:14
788000 -- (-336.293) (-328.979) (-328.390) [-330.333] * (-329.788) [-332.797] (-328.312) (-330.456) -- 0:00:14
788500 -- (-328.407) (-328.299) (-329.434) [-329.166] * [-331.074] (-329.710) (-328.368) (-328.557) -- 0:00:14
789000 -- [-329.283] (-330.934) (-330.012) (-329.056) * (-329.296) (-332.297) [-329.201] (-329.631) -- 0:00:14
789500 -- (-327.767) (-331.363) (-332.444) [-331.411] * (-333.925) (-332.565) [-328.448] (-328.510) -- 0:00:14
790000 -- (-327.962) (-332.085) [-327.707] (-332.330) * (-329.599) [-330.508] (-332.484) (-331.293) -- 0:00:14
Average standard deviation of split frequencies: 0.009182
790500 -- (-329.995) [-327.467] (-327.498) (-338.540) * (-335.103) (-328.662) [-332.287] (-328.870) -- 0:00:14
791000 -- (-329.319) (-331.271) (-331.494) [-330.045] * (-332.991) (-328.113) [-330.247] (-330.582) -- 0:00:14
791500 -- (-329.500) [-329.687] (-328.558) (-329.451) * (-330.320) [-330.537] (-329.757) (-328.151) -- 0:00:14
792000 -- (-329.624) (-338.377) [-331.525] (-329.044) * (-327.786) (-330.182) [-330.066] (-330.178) -- 0:00:14
792500 -- [-330.071] (-329.394) (-332.687) (-330.336) * [-328.505] (-330.153) (-331.972) (-327.982) -- 0:00:14
793000 -- (-332.151) (-331.873) (-328.961) [-330.466] * [-328.187] (-329.159) (-331.115) (-328.651) -- 0:00:14
793500 -- (-331.122) [-330.696] (-328.343) (-330.885) * (-330.131) [-329.424] (-331.056) (-331.151) -- 0:00:14
794000 -- (-329.442) (-333.199) (-330.772) [-333.656] * (-331.250) (-328.711) [-328.585] (-328.193) -- 0:00:14
794500 -- (-329.757) (-329.836) (-328.957) [-336.788] * (-332.285) (-327.611) [-328.233] (-328.615) -- 0:00:14
795000 -- [-329.607] (-328.737) (-329.656) (-327.782) * (-330.669) [-328.687] (-333.013) (-330.388) -- 0:00:14
Average standard deviation of split frequencies: 0.008962
795500 -- (-328.444) (-328.769) (-329.430) [-328.502] * (-330.439) [-329.737] (-332.116) (-334.386) -- 0:00:14
796000 -- (-328.639) (-338.409) [-329.082] (-328.643) * (-329.583) (-329.377) (-334.347) [-329.950] -- 0:00:14
796500 -- (-329.129) [-332.277] (-329.789) (-329.228) * [-328.126] (-329.840) (-329.373) (-328.995) -- 0:00:14
797000 -- (-328.541) (-329.587) [-329.761] (-330.139) * (-327.820) [-332.117] (-331.145) (-328.295) -- 0:00:14
797500 -- (-330.145) [-329.460] (-329.444) (-328.855) * (-329.370) (-334.540) [-329.088] (-327.531) -- 0:00:13
798000 -- (-330.437) [-328.534] (-327.437) (-332.354) * [-329.438] (-328.821) (-329.862) (-332.424) -- 0:00:13
798500 -- (-334.818) [-332.332] (-329.704) (-332.447) * (-330.067) (-330.081) [-328.927] (-328.619) -- 0:00:13
799000 -- [-332.438] (-329.462) (-328.438) (-328.958) * (-330.622) (-332.906) [-328.982] (-328.656) -- 0:00:13
799500 -- (-329.978) [-329.007] (-330.789) (-328.446) * [-330.449] (-331.356) (-332.032) (-331.816) -- 0:00:13
800000 -- [-329.077] (-330.352) (-331.667) (-332.408) * [-334.118] (-327.988) (-329.416) (-327.854) -- 0:00:13
Average standard deviation of split frequencies: 0.009106
800500 -- (-331.187) [-328.799] (-329.563) (-329.953) * (-332.423) (-328.842) [-334.367] (-329.302) -- 0:00:13
801000 -- (-328.990) [-329.561] (-329.568) (-327.975) * (-335.086) [-327.785] (-328.771) (-331.384) -- 0:00:13
801500 -- (-330.716) [-328.974] (-330.206) (-329.847) * [-328.411] (-327.581) (-327.929) (-329.404) -- 0:00:13
802000 -- [-328.281] (-327.652) (-330.924) (-329.855) * (-329.620) [-327.905] (-330.143) (-329.999) -- 0:00:13
802500 -- (-328.115) (-332.694) (-329.681) [-328.410] * (-333.407) (-327.836) [-329.512] (-328.064) -- 0:00:13
803000 -- (-331.902) [-331.257] (-333.701) (-333.441) * (-332.624) (-328.142) (-330.642) [-328.808] -- 0:00:13
803500 -- (-329.714) (-329.787) [-327.618] (-331.590) * (-332.844) (-328.246) [-332.675] (-328.191) -- 0:00:13
804000 -- (-330.201) [-328.686] (-328.202) (-328.238) * (-329.360) (-327.835) (-329.343) [-330.598] -- 0:00:13
804500 -- (-331.632) [-329.612 