--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:00:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/nrdH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -329.05 -331.88
2 -329.00 -332.56
--------------------------------------
TOTAL -329.02 -332.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891557 0.085386 0.350486 1.459238 0.867633 1424.90 1462.95 1.001
r(A<->C){all} 0.157155 0.018467 0.000018 0.434030 0.117488 96.76 210.91 1.000
r(A<->G){all} 0.174476 0.020801 0.000036 0.463031 0.137529 271.91 324.00 1.002
r(A<->T){all} 0.166482 0.020144 0.000092 0.453990 0.129377 163.98 290.16 1.000
r(C<->G){all} 0.165297 0.019253 0.000268 0.448381 0.127883 155.75 234.60 1.000
r(C<->T){all} 0.167980 0.018892 0.000092 0.438739 0.134653 163.22 242.05 1.000
r(G<->T){all} 0.168610 0.021558 0.000003 0.467380 0.126027 146.74 162.21 1.004
pi(A){all} 0.196822 0.000601 0.151634 0.248086 0.195785 1461.63 1481.32 1.001
pi(C){all} 0.286837 0.000843 0.230237 0.343309 0.286140 1351.64 1426.32 1.000
pi(G){all} 0.315853 0.000880 0.258217 0.374486 0.315785 1218.15 1290.05 1.000
pi(T){all} 0.200489 0.000633 0.149760 0.249912 0.200118 1147.13 1221.66 1.000
alpha{1,2} 0.417208 0.235077 0.000231 1.365056 0.248163 1243.91 1294.84 1.000
alpha{3} 0.452233 0.236961 0.000112 1.396547 0.299047 1335.22 1415.85 1.000
pinvar{all} 0.992794 0.000080 0.976256 0.999994 0.995702 1454.91 1477.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -304.903735
Model 2: PositiveSelection -304.903736
Model 0: one-ratio -304.903736
Model 7: beta -304.903733
Model 8: beta&w>1 -304.903734
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C2
VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C3
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C4
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C5
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
>C6
MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
APVVVAGNNHWSGFRPDRIKALAGAVLTAo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=81
C1 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C2 VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C3 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C4 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C5 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
C6 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
*************************************************
C1 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C2 QAPVVVAGNNHWSGFRPDRIKALAGAVLTA-
C3 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C4 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C5 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
C6 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2440]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2440]--->[2430]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.602 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C2 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C3 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C4 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C5 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
C6 MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQ
**************************************************
C1 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C2 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C3 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C4 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C5 APVVVAGNNHWSGFRPDRIKALAGAVLTA
C6 APVVVAGNNHWSGFRPDRIKALAGAVLTA
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C2 GTGATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C3 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C4 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C5 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
C6 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
***********************************************
C1 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C2 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C3 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C4 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C5 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
C6 CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
**************************************************
C1 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C2 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C3 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C4 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C5 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
C6 TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
**************************************************
C1 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C2 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C3 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C4 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C5 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
C6 CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
**************************************************
C1 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C2 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C3 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C4 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C5 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
C6 CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
****************************************
>C1
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C2
GTGATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C3
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C4
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C5
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C6
---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC
CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA
TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG
CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC
CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>C1
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C2
VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C3
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C4
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C5
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
>C6
oMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 243 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784334
Setting output file names to "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 328322732
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9061336601
Seed = 1105577539
Swapseed = 1579784334
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -534.576166 -- -24.965149
Chain 2 -- -534.576246 -- -24.965149
Chain 3 -- -534.576247 -- -24.965149
Chain 4 -- -534.576166 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -534.576246 -- -24.965149
Chain 2 -- -534.576246 -- -24.965149
Chain 3 -- -534.576246 -- -24.965149
Chain 4 -- -534.576247 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-534.576] (-534.576) (-534.576) (-534.576) * [-534.576] (-534.576) (-534.576) (-534.576)
500 -- [-333.441] (-344.293) (-335.724) (-338.793) * (-336.142) (-338.318) [-338.281] (-341.857) -- 0:00:00
1000 -- (-341.760) (-340.471) [-344.039] (-341.616) * [-336.875] (-338.295) (-346.964) (-342.818) -- 0:00:00
1500 -- [-335.735] (-339.242) (-342.124) (-339.810) * (-338.703) [-340.466] (-339.866) (-346.009) -- 0:00:00
2000 -- (-347.957) [-338.926] (-338.731) (-334.948) * [-342.718] (-342.768) (-335.660) (-342.564) -- 0:00:00
2500 -- (-345.548) [-342.880] (-339.791) (-334.924) * (-341.228) [-340.813] (-334.155) (-342.200) -- 0:00:00
3000 -- (-338.459) (-351.150) [-337.237] (-342.797) * [-336.438] (-342.372) (-341.071) (-339.161) -- 0:00:00
3500 -- [-336.987] (-338.299) (-339.291) (-337.636) * (-338.856) [-335.474] (-335.415) (-343.711) -- 0:00:00
4000 -- [-339.763] (-338.785) (-346.850) (-336.827) * [-337.421] (-343.016) (-347.078) (-336.931) -- 0:00:00
4500 -- (-340.411) (-340.781) (-340.660) [-342.553] * [-335.062] (-338.692) (-341.490) (-335.980) -- 0:00:00
5000 -- (-348.637) [-334.029] (-339.527) (-344.574) * (-339.772) (-339.934) [-337.152] (-339.471) -- 0:00:00
Average standard deviation of split frequencies: 0.102479
5500 -- (-342.593) [-337.943] (-345.781) (-349.375) * [-340.003] (-333.345) (-348.073) (-337.730) -- 0:00:00
6000 -- (-344.612) (-345.436) [-339.356] (-350.490) * (-343.620) [-339.955] (-341.259) (-337.399) -- 0:00:00
6500 -- (-337.650) [-336.753] (-340.293) (-346.034) * (-344.824) [-336.742] (-353.181) (-341.523) -- 0:00:00
7000 -- (-335.088) (-341.951) [-335.768] (-339.452) * (-333.314) (-337.714) [-343.380] (-332.948) -- 0:00:00
7500 -- (-336.679) (-340.037) [-340.808] (-341.339) * [-337.729] (-341.160) (-348.762) (-338.176) -- 0:00:00
8000 -- (-340.143) (-340.347) (-344.877) [-333.163] * (-331.350) (-334.098) (-346.994) [-336.058] -- 0:02:04
8500 -- (-341.571) (-351.549) [-338.984] (-337.091) * [-328.112] (-337.947) (-340.033) (-334.965) -- 0:01:56
9000 -- (-338.430) [-340.241] (-336.348) (-333.005) * (-330.215) (-341.234) [-339.735] (-344.188) -- 0:01:50
9500 -- [-334.182] (-336.200) (-337.118) (-333.125) * (-327.956) [-336.756] (-346.772) (-348.118) -- 0:01:44
10000 -- (-337.879) (-337.971) [-333.925] (-342.639) * [-329.811] (-338.049) (-355.674) (-340.183) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-333.828) [-336.666] (-342.903) (-341.328) * [-328.203] (-332.021) (-353.110) (-337.798) -- 0:01:34
11000 -- (-342.047) [-341.154] (-343.796) (-340.174) * (-329.906) (-336.860) (-347.655) [-336.380] -- 0:01:29
11500 -- [-338.365] (-346.242) (-339.061) (-338.617) * (-329.051) (-342.770) (-346.087) [-336.844] -- 0:01:25
12000 -- (-344.315) (-344.107) (-346.430) [-339.688] * (-329.285) (-338.304) (-334.576) [-341.009] -- 0:01:22
12500 -- (-339.090) [-340.277] (-344.690) (-338.062) * (-333.658) [-334.255] (-329.351) (-350.778) -- 0:01:19
13000 -- (-337.003) (-335.609) [-332.540] (-345.662) * [-334.643] (-333.456) (-331.178) (-352.183) -- 0:01:15
13500 -- (-344.354) (-342.931) [-338.930] (-337.523) * (-331.288) (-347.413) [-331.466] (-341.537) -- 0:01:13
14000 -- (-343.563) (-344.015) (-341.828) [-339.148] * (-329.602) [-342.017] (-332.372) (-339.095) -- 0:01:10
14500 -- (-346.451) [-339.239] (-338.467) (-341.515) * (-329.562) [-340.680] (-331.593) (-335.269) -- 0:01:07
15000 -- [-343.804] (-349.004) (-337.487) (-348.758) * (-330.187) (-339.119) (-329.630) [-330.225] -- 0:01:05
Average standard deviation of split frequencies: 0.066679
15500 -- (-338.531) (-355.550) [-338.133] (-343.529) * (-328.039) (-346.648) [-329.233] (-331.082) -- 0:01:03
16000 -- (-342.484) (-345.292) [-338.118] (-337.000) * [-329.719] (-342.350) (-332.146) (-327.970) -- 0:01:01
16500 -- [-329.819] (-338.902) (-349.786) (-342.985) * (-329.097) (-343.167) [-331.330] (-330.324) -- 0:00:59
17000 -- (-330.734) (-330.892) [-344.075] (-336.507) * [-328.839] (-338.637) (-331.064) (-329.008) -- 0:00:57
17500 -- (-330.251) (-327.617) (-339.689) [-338.769] * (-329.183) [-338.206] (-328.264) (-328.136) -- 0:00:56
18000 -- (-331.065) (-329.204) [-340.041] (-336.851) * [-329.405] (-339.024) (-328.613) (-328.886) -- 0:00:54
18500 -- (-329.099) [-328.127] (-338.725) (-339.553) * (-329.234) (-337.859) (-328.509) [-329.312] -- 0:00:53
19000 -- (-335.420) (-328.373) [-334.981] (-345.527) * (-328.717) (-337.326) (-328.529) [-330.004] -- 0:00:51
19500 -- (-331.832) [-329.187] (-340.846) (-341.401) * [-330.078] (-340.315) (-329.104) (-331.302) -- 0:00:50
20000 -- (-330.405) [-328.885] (-332.315) (-335.423) * (-329.147) (-340.140) [-329.826] (-329.602) -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- [-331.260] (-328.731) (-352.486) (-342.964) * (-328.303) (-342.063) (-330.692) [-328.686] -- 0:00:47
21000 -- (-328.091) (-329.526) (-355.040) [-346.681] * (-329.524) (-344.426) [-327.730] (-329.493) -- 0:00:46
21500 -- [-328.288] (-330.986) (-336.383) (-339.800) * (-330.247) (-336.101) (-327.924) [-328.225] -- 0:00:45
22000 -- [-330.249] (-331.159) (-345.798) (-345.919) * [-328.602] (-338.541) (-329.108) (-328.472) -- 0:00:44
22500 -- (-329.017) (-329.707) (-348.226) [-338.302] * (-328.969) (-343.908) (-330.378) [-328.464] -- 0:01:26
23000 -- (-328.550) (-330.102) (-344.509) [-336.213] * (-329.614) [-333.385] (-328.897) (-328.406) -- 0:01:24
23500 -- (-329.149) [-329.031] (-334.528) (-334.184) * (-329.214) [-338.423] (-329.931) (-328.491) -- 0:01:23
24000 -- [-328.439] (-331.792) (-329.175) (-341.078) * [-329.116] (-343.561) (-334.755) (-330.653) -- 0:01:21
24500 -- [-330.860] (-329.394) (-329.209) (-339.695) * (-329.707) (-339.272) [-332.580] (-330.678) -- 0:01:19
25000 -- (-330.671) [-328.773] (-329.988) (-348.930) * (-332.439) [-339.111] (-331.843) (-327.681) -- 0:01:18
Average standard deviation of split frequencies: 0.042855
25500 -- (-330.024) (-330.409) (-329.540) [-344.558] * (-329.167) (-360.623) [-328.356] (-327.517) -- 0:01:16
26000 -- (-329.064) (-333.322) [-329.669] (-336.434) * [-329.851] (-340.333) (-328.287) (-328.108) -- 0:01:14
26500 -- [-331.859] (-332.570) (-327.932) (-336.667) * (-329.509) [-335.375] (-331.438) (-329.433) -- 0:01:13
27000 -- [-329.661] (-333.992) (-327.916) (-338.164) * (-329.419) [-338.741] (-330.362) (-331.141) -- 0:01:12
27500 -- (-330.870) (-331.838) [-335.199] (-342.734) * (-333.555) [-348.629] (-328.476) (-333.209) -- 0:01:10
28000 -- (-329.875) (-328.534) (-328.651) [-333.201] * (-329.294) (-340.561) [-330.403] (-329.766) -- 0:01:09
28500 -- [-330.102] (-329.569) (-334.527) (-345.883) * [-330.397] (-340.497) (-329.586) (-329.338) -- 0:01:08
29000 -- (-332.978) (-330.453) (-328.342) [-337.996] * (-331.833) (-333.868) [-329.423] (-328.915) -- 0:01:06
29500 -- (-332.449) (-331.735) [-331.865] (-341.178) * (-330.433) (-354.036) [-330.933] (-330.646) -- 0:01:05
30000 -- (-331.411) [-331.576] (-328.721) (-336.304) * (-331.205) [-337.546] (-328.967) (-328.183) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-330.370) (-329.693) [-329.428] (-336.180) * (-330.996) [-339.494] (-328.727) (-327.941) -- 0:01:03
31000 -- (-330.798) (-328.002) (-329.010) [-339.159] * (-330.443) (-342.802) [-331.242] (-329.762) -- 0:01:02
31500 -- (-335.942) [-328.343] (-330.912) (-338.696) * (-328.120) (-331.094) [-329.733] (-328.916) -- 0:01:01
32000 -- [-331.963] (-328.146) (-328.940) (-346.072) * (-330.577) [-334.414] (-335.030) (-327.455) -- 0:01:00
32500 -- [-331.058] (-329.298) (-329.494) (-343.210) * (-328.379) [-329.310] (-333.290) (-329.850) -- 0:00:59
33000 -- (-331.825) [-331.060] (-328.891) (-339.298) * [-329.065] (-332.332) (-328.266) (-332.209) -- 0:00:58
33500 -- (-330.834) (-330.514) [-328.303] (-334.142) * (-330.606) (-330.252) (-329.580) [-331.348] -- 0:00:57
34000 -- [-328.520] (-328.537) (-331.290) (-341.264) * (-329.253) [-328.458] (-329.443) (-330.032) -- 0:00:56
34500 -- (-328.580) (-328.622) (-332.607) [-336.931] * [-333.298] (-329.799) (-327.374) (-332.178) -- 0:00:55
35000 -- (-330.518) [-330.370] (-332.930) (-340.597) * (-329.025) (-328.437) (-328.507) [-331.232] -- 0:00:55
Average standard deviation of split frequencies: 0.034160
35500 -- (-331.965) (-330.779) (-333.133) [-343.232] * (-328.159) (-330.735) [-334.099] (-330.699) -- 0:00:54
36000 -- (-330.944) [-328.654] (-334.163) (-337.829) * (-331.940) (-331.679) [-327.629] (-330.462) -- 0:00:53
36500 -- (-332.653) [-328.917] (-335.158) (-335.437) * [-328.103] (-330.099) (-330.145) (-329.400) -- 0:00:52
37000 -- (-330.444) (-330.232) [-329.969] (-338.423) * (-331.060) (-330.616) (-333.051) [-327.938] -- 0:01:18
37500 -- (-329.225) [-330.615] (-329.783) (-334.405) * (-328.955) (-329.834) [-329.011] (-329.520) -- 0:01:17
38000 -- (-328.342) [-329.250] (-331.590) (-332.039) * (-331.702) (-327.961) [-329.761] (-331.240) -- 0:01:15
38500 -- (-329.842) [-330.043] (-329.241) (-352.777) * (-328.378) (-330.813) [-327.551] (-332.288) -- 0:01:14
39000 -- (-331.542) (-329.517) [-328.664] (-354.509) * (-328.974) (-329.106) (-330.879) [-330.097] -- 0:01:13
39500 -- (-328.304) (-334.959) [-329.593] (-344.101) * (-328.703) [-329.133] (-329.090) (-327.716) -- 0:01:12
40000 -- (-328.962) (-332.447) (-328.886) [-341.221] * [-330.038] (-330.026) (-330.235) (-328.765) -- 0:01:12
Average standard deviation of split frequencies: 0.038253
40500 -- [-328.675] (-330.908) (-332.126) (-341.454) * [-330.779] (-329.691) (-328.881) (-332.809) -- 0:01:11
41000 -- (-328.846) [-327.984] (-327.926) (-350.967) * (-329.289) (-329.502) [-329.855] (-328.410) -- 0:01:10
41500 -- (-333.709) [-332.500] (-330.958) (-344.873) * (-329.098) (-327.781) [-328.274] (-329.920) -- 0:01:09
42000 -- (-331.664) (-328.621) (-329.399) [-334.504] * (-331.807) (-327.839) [-328.328] (-329.378) -- 0:01:08
42500 -- (-331.843) (-328.886) (-327.910) [-339.721] * (-331.254) (-331.776) (-328.394) [-328.748] -- 0:01:07
43000 -- [-328.430] (-331.833) (-328.512) (-336.820) * (-329.427) [-330.975] (-329.874) (-329.936) -- 0:01:06
43500 -- (-333.830) (-329.975) [-330.427] (-332.042) * (-327.705) (-331.891) (-331.268) [-329.736] -- 0:01:05
44000 -- (-330.513) (-329.005) [-330.572] (-331.261) * (-328.435) [-327.574] (-334.201) (-331.638) -- 0:01:05
44500 -- [-331.227] (-328.246) (-328.339) (-332.964) * [-329.251] (-329.781) (-332.692) (-331.027) -- 0:01:04
45000 -- (-330.125) (-329.005) (-329.229) [-330.408] * [-329.140] (-330.551) (-327.570) (-329.058) -- 0:01:03
Average standard deviation of split frequencies: 0.028792
45500 -- (-331.033) (-331.440) (-328.938) [-331.602] * (-330.969) [-327.995] (-332.023) (-329.605) -- 0:01:02
46000 -- [-328.278] (-331.842) (-328.852) (-330.281) * (-329.505) [-329.091] (-330.297) (-329.303) -- 0:01:02
46500 -- (-330.556) [-330.614] (-334.069) (-328.069) * (-328.661) [-330.887] (-328.980) (-331.496) -- 0:01:01
47000 -- (-331.243) [-329.969] (-331.934) (-331.047) * [-328.036] (-332.443) (-329.857) (-331.560) -- 0:01:00
47500 -- (-331.725) (-330.967) (-328.100) [-329.471] * (-329.560) (-328.273) [-334.008] (-328.703) -- 0:01:00
48000 -- (-330.272) (-331.144) [-329.893] (-330.535) * (-335.047) (-329.819) (-329.229) [-330.184] -- 0:00:59
48500 -- (-329.733) (-329.810) [-329.450] (-328.230) * (-329.826) [-329.933] (-328.055) (-329.239) -- 0:00:58
49000 -- [-329.166] (-329.660) (-329.441) (-331.991) * (-329.778) (-329.936) [-328.477] (-327.955) -- 0:00:58
49500 -- [-328.057] (-329.868) (-328.936) (-331.084) * (-329.457) [-334.430] (-336.377) (-329.666) -- 0:00:57
50000 -- (-334.137) (-330.279) (-331.363) [-330.324] * (-328.430) (-330.368) [-331.764] (-330.464) -- 0:00:57
Average standard deviation of split frequencies: 0.023482
50500 -- [-329.190] (-331.784) (-333.089) (-329.171) * [-327.649] (-331.396) (-330.361) (-329.247) -- 0:00:56
51000 -- (-330.510) (-327.743) [-330.682] (-330.544) * (-329.336) (-328.681) [-332.628] (-330.830) -- 0:00:55
51500 -- [-327.865] (-328.016) (-329.407) (-328.775) * (-328.951) (-329.828) [-333.965] (-330.788) -- 0:01:13
52000 -- (-329.789) (-330.273) [-330.387] (-330.542) * [-329.453] (-329.932) (-332.236) (-334.424) -- 0:01:12
52500 -- (-328.512) (-327.984) (-330.913) [-329.178] * (-332.265) [-331.820] (-332.495) (-333.832) -- 0:01:12
53000 -- (-329.109) (-332.796) [-327.921] (-330.305) * (-333.518) (-329.678) (-335.973) [-328.579] -- 0:01:11
53500 -- [-328.872] (-332.279) (-328.320) (-329.078) * [-329.259] (-331.669) (-334.125) (-328.960) -- 0:01:10
54000 -- [-327.902] (-328.493) (-329.162) (-330.202) * [-329.660] (-330.601) (-332.236) (-329.210) -- 0:01:10
54500 -- (-328.390) (-331.882) (-330.195) [-331.849] * (-329.338) (-329.172) [-331.953] (-333.720) -- 0:01:09
55000 -- (-328.228) (-328.933) (-329.703) [-330.715] * [-331.496] (-330.082) (-330.178) (-332.671) -- 0:01:08
Average standard deviation of split frequencies: 0.023149
55500 -- (-328.550) [-329.181] (-328.723) (-332.406) * (-330.175) (-330.903) [-328.510] (-331.012) -- 0:01:08
56000 -- (-328.774) (-329.422) (-330.115) [-328.550] * (-330.090) (-328.713) [-329.906] (-329.017) -- 0:01:07
56500 -- (-329.718) [-329.007] (-331.830) (-328.970) * (-331.915) (-328.711) (-327.866) [-329.677] -- 0:01:06
57000 -- [-329.570] (-335.807) (-330.682) (-329.221) * (-328.289) (-329.262) (-328.834) [-334.007] -- 0:01:06
57500 -- (-329.634) (-333.672) (-329.050) [-331.395] * (-328.320) (-332.084) [-327.816] (-331.569) -- 0:01:05
58000 -- (-328.568) (-329.826) [-328.209] (-327.629) * (-331.157) (-328.077) (-329.028) [-328.733] -- 0:01:04
58500 -- (-332.220) [-332.531] (-328.953) (-330.410) * [-331.230] (-328.581) (-329.710) (-328.946) -- 0:01:04
59000 -- (-334.396) [-333.162] (-328.439) (-330.428) * (-331.957) [-329.720] (-329.563) (-329.278) -- 0:01:03
59500 -- (-331.621) (-330.744) (-331.087) [-329.667] * (-330.599) (-328.410) [-328.585] (-329.249) -- 0:01:03
60000 -- [-329.402] (-327.989) (-327.416) (-330.197) * [-329.195] (-328.837) (-327.698) (-329.194) -- 0:01:02
Average standard deviation of split frequencies: 0.021026
60500 -- [-329.911] (-329.149) (-327.789) (-328.948) * (-327.879) (-328.613) [-328.185] (-331.546) -- 0:01:02
61000 -- [-330.409] (-328.798) (-328.941) (-331.765) * (-329.767) [-329.919] (-328.918) (-331.878) -- 0:01:01
61500 -- (-331.081) (-328.397) (-329.092) [-328.599] * (-328.758) (-329.374) [-328.376] (-332.093) -- 0:01:01
62000 -- [-332.289] (-327.999) (-330.064) (-328.646) * (-331.288) [-329.066] (-329.074) (-331.254) -- 0:01:00
62500 -- [-329.446] (-331.073) (-329.516) (-330.380) * (-327.950) (-329.703) [-330.423] (-328.978) -- 0:01:00
63000 -- (-330.325) (-328.054) (-328.711) [-328.742] * (-332.305) (-327.948) (-328.014) [-327.945] -- 0:00:59
63500 -- (-332.689) (-331.442) [-328.407] (-327.810) * (-330.736) (-328.366) [-327.989] (-328.976) -- 0:00:58
64000 -- [-329.211] (-334.400) (-328.981) (-329.217) * (-328.612) (-329.329) (-327.422) [-331.392] -- 0:00:58
64500 -- (-335.487) (-327.385) [-331.356] (-328.807) * [-330.498] (-328.896) (-328.370) (-331.923) -- 0:00:58
65000 -- (-331.190) (-331.756) (-330.257) [-328.445] * (-329.149) [-330.941] (-330.905) (-328.752) -- 0:00:57
Average standard deviation of split frequencies: 0.023700
65500 -- (-334.879) [-329.061] (-329.742) (-330.123) * (-329.297) [-330.507] (-330.775) (-333.430) -- 0:01:11
66000 -- (-330.507) [-332.170] (-328.862) (-329.719) * [-329.220] (-328.399) (-331.199) (-331.090) -- 0:01:10
66500 -- [-329.721] (-328.669) (-330.424) (-329.085) * (-329.955) (-329.863) [-329.945] (-327.777) -- 0:01:10
67000 -- [-330.343] (-329.615) (-330.917) (-329.815) * (-330.168) [-329.916] (-330.837) (-328.325) -- 0:01:09
67500 -- [-330.617] (-329.443) (-330.956) (-329.836) * (-334.352) (-329.566) [-329.757] (-328.258) -- 0:01:09
68000 -- (-332.115) [-330.732] (-330.318) (-328.117) * (-331.605) (-333.323) [-328.472] (-329.335) -- 0:01:08
68500 -- (-329.382) (-331.939) [-333.822] (-328.241) * (-332.347) (-330.020) [-329.349] (-329.214) -- 0:01:07
69000 -- (-330.553) (-328.357) [-329.390] (-329.804) * (-333.567) [-331.603] (-328.383) (-329.778) -- 0:01:07
69500 -- (-328.827) (-332.277) (-328.734) [-328.067] * [-329.372] (-329.390) (-336.494) (-329.262) -- 0:01:06
70000 -- [-328.682] (-329.860) (-330.166) (-328.724) * (-328.573) (-329.617) [-328.054] (-328.830) -- 0:01:06
Average standard deviation of split frequencies: 0.023681
70500 -- (-332.003) (-330.302) (-331.669) [-328.383] * (-327.938) [-333.889] (-328.611) (-328.406) -- 0:01:05
71000 -- (-328.390) (-328.386) [-330.322] (-330.781) * (-332.520) (-330.099) [-329.875] (-330.184) -- 0:01:05
71500 -- (-332.343) (-330.091) [-329.579] (-329.335) * (-328.837) [-328.629] (-331.770) (-328.425) -- 0:01:04
72000 -- (-328.593) (-327.965) [-330.192] (-327.673) * (-329.558) [-330.422] (-329.818) (-334.452) -- 0:01:04
72500 -- (-327.635) [-334.269] (-327.859) (-328.055) * (-327.931) (-331.022) [-330.676] (-329.701) -- 0:01:03
73000 -- (-331.339) [-328.066] (-328.381) (-330.215) * (-327.652) (-333.722) [-329.407] (-333.775) -- 0:01:03
73500 -- (-329.552) (-327.855) (-328.080) [-328.985] * [-328.417] (-328.841) (-328.064) (-337.764) -- 0:01:03
74000 -- (-328.563) (-332.347) (-328.238) [-328.566] * (-328.744) [-327.439] (-334.889) (-331.743) -- 0:01:02
74500 -- (-330.502) (-330.101) (-330.029) [-329.913] * [-330.483] (-327.970) (-332.321) (-332.338) -- 0:01:02
75000 -- (-329.604) [-330.232] (-328.572) (-327.843) * (-331.899) (-328.481) (-331.472) [-331.534] -- 0:01:01
Average standard deviation of split frequencies: 0.023880
75500 -- (-330.507) [-328.363] (-328.480) (-329.967) * (-328.997) (-330.487) [-336.906] (-329.670) -- 0:01:01
76000 -- (-329.225) (-330.093) (-330.531) [-333.650] * [-328.943] (-335.733) (-329.370) (-333.241) -- 0:01:00
76500 -- (-328.326) [-328.619] (-329.639) (-330.839) * [-329.225] (-333.109) (-329.848) (-330.440) -- 0:01:00
77000 -- (-328.596) [-333.709] (-328.845) (-332.290) * [-328.462] (-332.405) (-331.139) (-329.480) -- 0:00:59
77500 -- (-328.570) (-330.610) (-334.376) [-331.451] * (-334.487) [-327.959] (-328.548) (-328.987) -- 0:00:59
78000 -- (-330.012) [-329.949] (-329.496) (-331.214) * (-329.951) (-328.691) [-329.829] (-332.456) -- 0:00:59
78500 -- [-335.134] (-327.985) (-328.531) (-328.079) * (-328.140) [-328.058] (-328.617) (-329.430) -- 0:00:58
79000 -- (-329.093) (-329.874) [-331.838] (-330.021) * (-330.410) (-331.045) [-327.769] (-327.922) -- 0:00:58
79500 -- (-328.121) (-331.020) (-330.792) [-328.467] * (-328.761) [-331.281] (-335.510) (-330.046) -- 0:00:57
80000 -- [-327.943] (-328.886) (-329.318) (-329.241) * (-328.843) [-328.360] (-331.218) (-331.235) -- 0:00:57
Average standard deviation of split frequencies: 0.024913
80500 -- (-332.219) (-328.304) (-330.273) [-328.805] * (-329.135) (-329.616) (-330.039) [-328.998] -- 0:01:08
81000 -- (-327.652) [-329.194] (-336.833) (-331.148) * [-328.423] (-328.921) (-330.275) (-330.358) -- 0:01:08
81500 -- [-329.328] (-336.331) (-330.084) (-335.610) * (-333.508) [-328.126] (-329.294) (-328.265) -- 0:01:07
82000 -- [-330.227] (-330.388) (-334.378) (-328.546) * (-329.291) [-328.514] (-328.231) (-328.175) -- 0:01:07
82500 -- [-331.680] (-330.053) (-338.961) (-331.951) * (-333.109) (-327.623) (-328.472) [-328.212] -- 0:01:06
83000 -- [-330.241] (-329.573) (-330.715) (-328.742) * (-329.537) (-329.454) (-328.383) [-330.796] -- 0:01:06
83500 -- (-331.103) [-327.823] (-330.835) (-329.330) * (-332.722) [-328.779] (-329.831) (-330.136) -- 0:01:05
84000 -- (-331.802) (-329.847) [-328.875] (-330.372) * (-329.645) (-328.497) [-328.967] (-328.079) -- 0:01:05
84500 -- (-329.568) [-329.109] (-331.808) (-330.934) * [-332.527] (-329.945) (-332.163) (-327.563) -- 0:01:05
85000 -- [-328.999] (-332.972) (-328.980) (-331.225) * (-333.257) (-329.871) [-330.017] (-328.137) -- 0:01:04
Average standard deviation of split frequencies: 0.024392
85500 -- [-328.648] (-329.138) (-328.334) (-329.190) * (-334.027) [-332.712] (-327.972) (-332.114) -- 0:01:04
86000 -- (-331.857) (-327.584) [-330.339] (-328.094) * [-330.267] (-331.678) (-329.988) (-330.176) -- 0:01:03
86500 -- [-330.171] (-327.614) (-329.914) (-329.475) * [-327.771] (-331.249) (-329.799) (-327.948) -- 0:01:03
87000 -- (-334.138) (-331.046) [-329.362] (-333.703) * (-331.073) (-327.830) (-330.816) [-328.762] -- 0:01:02
87500 -- (-327.966) [-330.978] (-327.706) (-329.328) * (-328.663) (-329.483) [-330.436] (-328.563) -- 0:01:02
88000 -- (-329.934) (-338.095) (-330.691) [-329.207] * (-329.225) [-330.681] (-330.394) (-330.517) -- 0:01:02
88500 -- (-330.419) (-332.771) [-329.768] (-328.473) * (-331.157) [-332.131] (-329.601) (-327.968) -- 0:01:01
89000 -- (-327.908) (-328.806) [-330.079] (-330.743) * (-332.551) (-331.230) [-328.942] (-330.550) -- 0:01:01
89500 -- [-331.490] (-330.758) (-330.055) (-329.712) * (-327.966) (-329.494) (-330.396) [-330.291] -- 0:01:01
90000 -- (-329.221) (-329.965) [-332.682] (-331.822) * [-329.927] (-329.253) (-331.409) (-331.722) -- 0:01:00
Average standard deviation of split frequencies: 0.025449
90500 -- (-329.731) (-329.487) (-329.674) [-332.538] * [-329.519] (-335.405) (-332.730) (-327.510) -- 0:01:00
91000 -- (-335.516) (-331.785) (-331.774) [-329.122] * (-332.371) (-333.056) [-330.155] (-329.496) -- 0:00:59
91500 -- [-328.757] (-330.006) (-328.678) (-328.882) * (-330.556) (-335.007) [-328.307] (-331.009) -- 0:00:59
92000 -- (-332.244) [-331.517] (-328.656) (-330.273) * [-330.744] (-327.865) (-329.227) (-330.172) -- 0:00:59
92500 -- [-328.225] (-329.039) (-330.215) (-332.525) * [-328.058] (-328.094) (-332.346) (-328.949) -- 0:00:58
93000 -- (-329.954) (-330.213) (-328.699) [-329.612] * (-329.319) (-329.025) (-328.405) [-327.682] -- 0:00:58
93500 -- (-330.601) (-329.036) [-330.285] (-330.370) * (-329.937) (-330.250) [-327.729] (-330.479) -- 0:00:58
94000 -- (-332.569) [-331.294] (-328.780) (-328.264) * (-328.475) (-331.395) (-329.481) [-327.939] -- 0:00:57
94500 -- (-331.782) (-331.203) (-333.439) [-329.729] * (-328.390) [-329.543] (-329.978) (-328.145) -- 0:00:57
95000 -- (-337.363) (-329.720) (-329.398) [-328.516] * (-330.013) (-329.966) [-330.010] (-330.420) -- 0:01:06
Average standard deviation of split frequencies: 0.023777
95500 -- (-333.636) [-330.133] (-333.561) (-327.968) * (-332.518) (-329.552) (-331.097) [-328.277] -- 0:01:06
96000 -- [-334.045] (-330.010) (-332.051) (-333.985) * (-331.300) (-331.951) (-328.804) [-328.256] -- 0:01:05
96500 -- (-328.500) (-330.619) [-329.362] (-335.825) * (-333.308) (-331.273) (-328.450) [-330.694] -- 0:01:05
97000 -- (-328.384) (-328.942) [-330.284] (-329.651) * (-332.804) [-329.796] (-329.734) (-327.953) -- 0:01:05
97500 -- (-329.263) [-330.099] (-331.601) (-328.764) * (-329.405) (-334.852) [-329.756] (-331.580) -- 0:01:04
98000 -- (-330.839) (-333.818) (-328.501) [-327.536] * (-329.110) [-330.496] (-329.347) (-329.634) -- 0:01:04
98500 -- [-328.370] (-331.238) (-331.384) (-329.701) * (-330.011) (-328.521) (-330.559) [-328.648] -- 0:01:04
99000 -- (-328.519) (-333.126) (-335.320) [-327.968] * (-328.485) [-332.907] (-330.189) (-329.939) -- 0:01:03
99500 -- [-328.521] (-330.528) (-328.689) (-328.978) * (-329.708) (-330.751) (-330.200) [-329.552] -- 0:01:03
100000 -- (-331.466) (-329.471) (-328.858) [-329.587] * (-328.966) (-328.753) [-329.951] (-328.663) -- 0:01:02
Average standard deviation of split frequencies: 0.022675
100500 -- (-332.071) [-328.968] (-331.777) (-329.394) * (-328.965) (-328.682) (-329.390) [-329.013] -- 0:01:02
101000 -- [-332.146] (-338.182) (-330.906) (-328.623) * [-330.118] (-329.424) (-329.186) (-328.687) -- 0:01:02
101500 -- (-330.792) (-332.393) [-331.477] (-327.515) * (-333.817) [-334.544] (-335.037) (-331.422) -- 0:01:01
102000 -- (-329.139) [-328.783] (-329.128) (-327.632) * (-328.566) (-330.303) (-334.921) [-333.393] -- 0:01:01
102500 -- (-330.725) (-329.731) (-331.895) [-328.003] * (-328.754) [-330.613] (-333.093) (-329.800) -- 0:01:01
103000 -- [-329.903] (-330.437) (-328.579) (-329.705) * (-328.747) [-331.220] (-334.868) (-329.427) -- 0:01:00
103500 -- (-332.378) (-329.666) [-329.265] (-330.220) * (-329.866) [-330.305] (-331.188) (-329.267) -- 0:01:00
104000 -- (-332.360) (-330.273) (-332.726) [-331.101] * (-329.142) (-333.639) [-328.780] (-332.719) -- 0:01:00
104500 -- [-330.425] (-328.018) (-330.924) (-328.503) * (-331.497) (-329.483) [-329.865] (-329.770) -- 0:00:59
105000 -- (-331.629) [-328.512] (-331.405) (-328.907) * (-328.537) [-328.843] (-329.414) (-328.871) -- 0:00:59
Average standard deviation of split frequencies: 0.023570
105500 -- [-330.657] (-331.638) (-330.344) (-330.438) * [-328.241] (-334.602) (-330.952) (-330.363) -- 0:00:59
106000 -- [-328.804] (-329.531) (-333.121) (-328.190) * (-331.497) [-328.348] (-328.641) (-330.677) -- 0:00:59
106500 -- (-328.792) (-328.606) [-327.982] (-328.971) * [-329.898] (-329.132) (-327.921) (-334.620) -- 0:00:58
107000 -- [-330.122] (-329.366) (-332.966) (-329.467) * (-329.334) [-328.843] (-328.567) (-332.826) -- 0:00:58
107500 -- [-331.973] (-328.287) (-330.239) (-331.494) * [-328.676] (-327.561) (-329.177) (-328.635) -- 0:00:58
108000 -- (-329.218) (-329.086) (-330.097) [-333.361] * (-331.972) (-329.731) (-329.614) [-328.087] -- 0:00:57
108500 -- (-330.240) [-328.590] (-329.444) (-334.034) * (-332.259) [-329.472] (-330.085) (-329.575) -- 0:00:57
109000 -- [-328.019] (-327.614) (-330.531) (-329.758) * [-329.951] (-330.559) (-329.896) (-328.308) -- 0:00:57
109500 -- (-328.659) (-330.232) [-329.855] (-328.241) * (-328.985) (-328.728) [-331.644] (-327.958) -- 0:01:05
110000 -- (-328.410) [-331.069] (-328.412) (-328.010) * (-330.557) (-329.227) (-331.698) [-329.985] -- 0:01:04
Average standard deviation of split frequencies: 0.024885
110500 -- (-333.363) (-328.529) [-328.706] (-329.252) * [-330.159] (-331.949) (-330.381) (-329.616) -- 0:01:04
111000 -- (-331.193) (-330.647) [-329.107] (-328.405) * (-330.786) (-329.151) (-333.567) [-328.716] -- 0:01:04
111500 -- [-329.780] (-330.903) (-329.589) (-328.548) * [-328.501] (-329.268) (-337.151) (-328.519) -- 0:01:03
112000 -- (-331.797) [-329.438] (-332.781) (-328.184) * (-328.298) (-331.078) (-330.605) [-331.951] -- 0:01:03
112500 -- (-328.690) (-329.126) [-332.837] (-328.403) * [-328.609] (-333.354) (-330.197) (-330.118) -- 0:01:03
113000 -- (-328.857) (-329.143) (-329.338) [-328.553] * (-331.125) (-334.360) (-329.233) [-328.511] -- 0:01:02
113500 -- (-331.133) (-329.128) [-328.223] (-329.010) * (-329.065) [-329.131] (-328.949) (-332.228) -- 0:01:02
114000 -- (-331.492) (-328.878) [-332.762] (-327.484) * (-328.595) (-329.464) [-330.693] (-333.469) -- 0:01:02
114500 -- (-334.328) [-331.885] (-327.936) (-327.766) * (-329.240) (-330.095) [-329.167] (-332.284) -- 0:01:01
115000 -- (-331.163) (-328.658) (-328.102) [-327.968] * (-328.835) (-331.734) (-329.098) [-327.586] -- 0:01:01
Average standard deviation of split frequencies: 0.024835
115500 -- (-328.120) (-328.573) (-329.939) [-328.090] * (-331.125) (-331.266) (-330.416) [-328.281] -- 0:01:01
116000 -- (-328.250) [-333.094] (-329.947) (-334.019) * (-332.326) [-327.810] (-331.215) (-329.820) -- 0:01:00
116500 -- (-327.536) [-329.379] (-331.096) (-338.221) * (-331.733) [-329.362] (-331.780) (-329.099) -- 0:01:00
117000 -- (-328.692) [-329.535] (-328.753) (-336.367) * [-330.894] (-330.087) (-329.402) (-329.053) -- 0:01:00
117500 -- (-329.098) (-328.688) (-328.306) [-333.872] * (-329.424) (-329.699) (-330.245) [-330.733] -- 0:01:00
118000 -- (-332.774) (-328.568) [-328.907] (-329.947) * [-330.667] (-336.595) (-327.512) (-328.499) -- 0:00:59
118500 -- (-331.464) (-331.776) (-328.671) [-330.261] * [-330.350] (-328.703) (-332.816) (-331.266) -- 0:00:59
119000 -- (-328.892) (-334.494) (-328.862) [-330.480] * (-330.970) [-329.371] (-329.147) (-332.964) -- 0:00:59
119500 -- (-328.283) (-332.720) (-329.182) [-329.907] * (-330.524) (-330.868) (-329.433) [-337.489] -- 0:00:58
120000 -- [-330.882] (-333.152) (-330.030) (-329.010) * (-329.502) (-328.879) (-333.058) [-332.818] -- 0:00:58
Average standard deviation of split frequencies: 0.024742
120500 -- [-328.773] (-329.043) (-328.015) (-331.033) * (-332.126) [-331.908] (-333.686) (-331.186) -- 0:00:58
121000 -- [-327.771] (-329.410) (-329.165) (-335.310) * (-329.915) (-332.040) (-329.768) [-327.701] -- 0:00:58
121500 -- [-328.867] (-328.866) (-332.821) (-331.778) * (-329.145) (-332.583) (-330.560) [-327.907] -- 0:00:57
122000 -- (-332.441) (-328.700) [-329.339] (-334.219) * (-329.188) (-328.546) (-328.856) [-328.563] -- 0:00:57
122500 -- (-334.056) (-330.824) (-328.364) [-332.316] * (-328.006) (-331.374) [-328.669] (-328.118) -- 0:00:57
123000 -- (-330.474) (-330.874) (-330.593) [-333.529] * [-330.013] (-332.767) (-330.420) (-330.825) -- 0:00:57
123500 -- (-328.778) [-329.521] (-330.202) (-328.897) * [-339.135] (-332.483) (-329.727) (-328.881) -- 0:00:56
124000 -- (-330.677) (-329.421) [-330.025] (-330.115) * [-331.313] (-329.521) (-330.709) (-331.876) -- 0:01:03
124500 -- (-329.267) (-330.536) (-329.529) [-328.972] * (-332.000) (-331.136) [-330.351] (-331.318) -- 0:01:03
125000 -- (-328.391) (-332.184) [-331.421] (-329.639) * (-331.318) [-328.626] (-329.179) (-328.961) -- 0:01:03
Average standard deviation of split frequencies: 0.025628
125500 -- [-328.676] (-328.668) (-327.742) (-331.030) * (-330.670) (-330.085) [-327.983] (-331.520) -- 0:01:02
126000 -- [-330.964] (-328.363) (-331.732) (-329.506) * (-329.967) (-328.449) [-328.359] (-328.543) -- 0:01:02
126500 -- (-329.302) [-329.776] (-329.219) (-331.217) * (-335.099) [-328.385] (-330.576) (-328.224) -- 0:01:02
127000 -- (-328.543) (-329.575) [-327.560] (-333.379) * (-329.502) (-328.692) (-335.211) [-328.477] -- 0:01:01
127500 -- (-328.459) (-328.001) [-328.374] (-337.548) * (-330.078) (-335.163) [-331.156] (-329.612) -- 0:01:01
128000 -- (-330.516) (-331.513) [-329.044] (-328.955) * (-328.218) (-330.247) [-329.022] (-331.158) -- 0:01:01
128500 -- (-330.208) (-330.351) [-330.246] (-328.100) * (-328.638) (-329.758) [-330.402] (-329.448) -- 0:01:01
129000 -- [-328.268] (-332.963) (-329.782) (-330.645) * (-332.926) (-328.815) (-332.425) [-330.703] -- 0:01:00
129500 -- (-331.464) [-328.926] (-327.512) (-331.202) * [-331.542] (-330.204) (-331.298) (-330.740) -- 0:01:00
130000 -- (-332.054) (-332.672) (-329.766) [-330.543] * (-329.777) [-330.719] (-331.900) (-330.625) -- 0:01:00
Average standard deviation of split frequencies: 0.024494
130500 -- (-329.594) (-330.944) [-328.682] (-330.999) * (-328.697) (-328.318) [-331.848] (-331.305) -- 0:00:59
131000 -- (-328.173) (-328.886) (-331.855) [-331.541] * (-328.675) (-329.860) (-331.149) [-328.835] -- 0:00:59
131500 -- (-328.961) (-330.944) (-331.220) [-331.637] * [-330.783] (-331.009) (-332.043) (-330.391) -- 0:00:59
132000 -- (-329.087) [-328.684] (-333.405) (-330.709) * (-329.200) (-327.836) [-331.407] (-329.482) -- 0:00:59
132500 -- (-330.363) (-331.440) (-328.685) [-328.797] * (-328.030) (-328.481) [-331.738] (-331.001) -- 0:00:58
133000 -- (-328.882) [-327.580] (-330.167) (-328.435) * (-329.938) [-330.552] (-330.821) (-330.410) -- 0:00:58
133500 -- (-328.555) [-329.921] (-329.402) (-329.073) * (-330.437) [-327.620] (-329.911) (-329.962) -- 0:00:58
134000 -- (-329.781) (-332.224) (-328.047) [-331.498] * (-329.611) [-328.649] (-330.986) (-331.189) -- 0:00:58
134500 -- (-329.639) (-331.610) (-328.356) [-329.034] * (-327.688) [-331.422] (-330.701) (-330.591) -- 0:00:57
135000 -- [-329.307] (-328.055) (-330.825) (-329.257) * (-328.293) [-328.084] (-330.680) (-328.972) -- 0:00:57
Average standard deviation of split frequencies: 0.024263
135500 -- (-327.791) (-327.841) (-329.466) [-330.139] * (-328.412) (-329.820) [-330.858] (-329.517) -- 0:00:57
136000 -- [-329.443] (-332.012) (-332.584) (-329.917) * [-327.642] (-329.040) (-330.629) (-328.108) -- 0:00:57
136500 -- (-329.378) (-329.350) (-329.834) [-332.954] * [-329.070] (-333.088) (-337.708) (-331.642) -- 0:00:56
137000 -- [-327.925] (-331.875) (-329.294) (-334.099) * (-329.899) [-327.484] (-329.845) (-328.294) -- 0:00:56
137500 -- (-334.813) (-328.166) (-333.467) [-329.687] * [-330.975] (-329.815) (-330.455) (-329.208) -- 0:00:56
138000 -- [-330.709] (-328.316) (-329.614) (-334.024) * [-330.235] (-331.512) (-332.893) (-329.888) -- 0:00:56
138500 -- [-330.453] (-330.515) (-329.705) (-328.517) * (-329.004) [-328.829] (-328.331) (-329.959) -- 0:01:02
139000 -- (-332.074) [-332.308] (-332.714) (-331.331) * (-328.286) (-329.105) (-329.940) [-328.255] -- 0:01:01
139500 -- (-329.221) (-332.164) (-331.780) [-328.666] * (-330.979) [-329.639] (-328.868) (-329.807) -- 0:01:01
140000 -- [-328.220] (-331.490) (-329.445) (-331.312) * (-329.702) (-329.837) (-329.096) [-332.018] -- 0:01:01
Average standard deviation of split frequencies: 0.024576
140500 -- (-330.048) [-331.829] (-329.419) (-328.400) * (-328.483) (-330.208) (-329.358) [-329.150] -- 0:01:01
141000 -- [-328.451] (-328.020) (-328.722) (-330.178) * (-327.808) [-330.636] (-327.725) (-328.274) -- 0:01:00
141500 -- (-329.952) (-330.113) (-331.284) [-334.686] * (-328.990) [-328.553] (-331.614) (-330.302) -- 0:01:00
142000 -- [-333.908] (-329.856) (-333.702) (-330.789) * (-339.158) (-329.828) (-330.600) [-329.697] -- 0:01:00
142500 -- (-333.149) (-331.025) (-335.191) [-329.581] * [-330.624] (-330.374) (-328.773) (-334.550) -- 0:01:00
143000 -- [-330.766] (-328.996) (-331.383) (-330.096) * (-328.983) (-330.029) [-328.548] (-330.694) -- 0:00:59
143500 -- (-331.337) (-329.256) (-328.553) [-328.075] * (-328.989) (-330.848) [-329.245] (-330.033) -- 0:00:59
144000 -- (-330.238) (-330.586) [-327.691] (-329.337) * [-327.948] (-328.627) (-330.170) (-330.085) -- 0:00:59
144500 -- (-328.289) (-328.739) (-329.979) [-328.747] * (-328.260) (-327.903) (-330.231) [-329.600] -- 0:00:59
145000 -- (-329.108) [-329.923] (-330.316) (-328.210) * (-335.790) (-329.454) [-330.669] (-328.163) -- 0:00:58
Average standard deviation of split frequencies: 0.023570
145500 -- (-330.894) [-331.284] (-328.549) (-331.075) * (-328.305) [-328.412] (-334.761) (-331.196) -- 0:00:58
146000 -- (-328.414) (-332.340) [-330.548] (-330.203) * (-328.278) (-331.686) (-332.501) [-331.482] -- 0:00:58
146500 -- (-328.755) [-328.939] (-331.766) (-328.959) * [-329.714] (-328.913) (-332.120) (-328.838) -- 0:00:58
147000 -- (-330.852) [-328.214] (-329.701) (-333.215) * (-330.043) (-331.360) (-329.664) [-330.728] -- 0:00:58
147500 -- (-327.739) (-332.090) (-328.494) [-333.093] * (-331.641) (-330.381) [-330.244] (-330.428) -- 0:00:57
148000 -- [-328.184] (-331.327) (-328.862) (-328.860) * (-329.886) (-334.318) [-329.539] (-329.757) -- 0:00:57
148500 -- (-329.505) (-329.698) (-327.704) [-328.300] * (-331.246) [-327.918] (-328.934) (-328.067) -- 0:00:57
149000 -- (-329.342) (-329.569) (-330.375) [-331.580] * (-328.490) [-330.354] (-328.664) (-329.097) -- 0:00:57
149500 -- [-329.454] (-331.547) (-332.904) (-329.604) * (-327.743) (-332.730) [-330.883] (-330.695) -- 0:00:56
150000 -- [-330.494] (-334.157) (-330.856) (-328.462) * [-328.340] (-332.378) (-328.904) (-329.663) -- 0:00:56
Average standard deviation of split frequencies: 0.022890
150500 -- (-328.782) (-329.339) (-330.612) [-331.445] * (-330.356) (-328.627) [-328.020] (-328.160) -- 0:00:56
151000 -- (-329.049) [-328.194] (-329.271) (-331.812) * (-329.259) [-330.592] (-328.116) (-329.236) -- 0:00:56
151500 -- (-329.805) [-330.324] (-335.643) (-333.049) * (-329.298) (-330.100) (-327.763) [-330.560] -- 0:00:56
152000 -- [-330.432] (-329.053) (-330.911) (-334.445) * (-330.653) (-332.242) [-329.767] (-328.980) -- 0:00:55
152500 -- (-330.334) (-329.606) [-329.594] (-328.493) * [-327.475] (-331.062) (-331.466) (-329.382) -- 0:00:55
153000 -- (-328.672) [-332.355] (-328.644) (-328.826) * (-328.593) (-328.826) [-334.073] (-329.858) -- 0:01:00
153500 -- (-332.301) (-332.692) (-328.368) [-328.916] * [-329.705] (-329.334) (-334.812) (-328.352) -- 0:01:00
154000 -- (-330.170) (-334.094) (-330.273) [-330.138] * [-330.994] (-336.677) (-332.139) (-330.560) -- 0:01:00
154500 -- [-331.364] (-330.268) (-328.792) (-328.067) * (-328.733) (-329.889) (-334.833) [-329.164] -- 0:01:00
155000 -- (-329.296) (-333.980) (-330.523) [-329.184] * (-328.815) (-327.712) (-328.133) [-332.586] -- 0:00:59
Average standard deviation of split frequencies: 0.021153
155500 -- (-327.875) (-333.069) (-330.581) [-328.979] * (-329.576) [-327.488] (-330.439) (-329.115) -- 0:00:59
156000 -- (-331.474) [-330.741] (-328.264) (-329.451) * (-329.943) (-328.095) (-328.802) [-333.222] -- 0:00:59
156500 -- [-328.046] (-332.311) (-328.812) (-328.950) * [-332.299] (-329.046) (-330.816) (-329.316) -- 0:00:59
157000 -- [-331.445] (-330.608) (-332.050) (-329.910) * [-331.046] (-333.355) (-335.273) (-335.754) -- 0:00:59
157500 -- (-329.271) [-329.964] (-330.906) (-329.433) * [-330.367] (-329.768) (-327.970) (-331.409) -- 0:00:58
158000 -- [-329.663] (-328.446) (-333.760) (-328.533) * (-329.165) [-329.746] (-331.288) (-328.801) -- 0:00:58
158500 -- (-328.761) (-332.224) [-329.966] (-329.222) * [-329.571] (-328.529) (-330.369) (-331.152) -- 0:00:58
159000 -- (-331.210) (-328.885) (-334.660) [-329.427] * [-328.726] (-329.762) (-327.732) (-330.753) -- 0:00:58
159500 -- [-329.025] (-329.061) (-330.710) (-328.274) * (-331.566) (-333.319) (-330.456) [-329.290] -- 0:00:57
160000 -- (-329.031) [-332.917] (-330.275) (-329.075) * (-331.446) (-331.374) [-327.915] (-328.983) -- 0:00:57
Average standard deviation of split frequencies: 0.020538
160500 -- [-330.001] (-328.875) (-330.625) (-329.588) * (-330.380) [-329.066] (-332.084) (-330.023) -- 0:00:57
161000 -- (-329.440) [-329.165] (-328.704) (-333.654) * (-330.918) (-330.975) [-329.720] (-328.850) -- 0:00:57
161500 -- (-329.761) [-328.456] (-329.971) (-328.771) * [-331.238] (-332.659) (-330.238) (-330.448) -- 0:00:57
162000 -- (-329.804) (-330.322) (-328.929) [-329.327] * [-330.345] (-330.016) (-329.293) (-329.200) -- 0:00:56
162500 -- [-330.028] (-330.152) (-328.228) (-329.611) * (-328.268) (-330.872) (-329.274) [-329.499] -- 0:00:56
163000 -- [-329.488] (-332.030) (-331.405) (-330.043) * (-328.235) [-328.471] (-329.108) (-328.912) -- 0:00:56
163500 -- (-328.914) [-327.989] (-332.407) (-327.935) * (-331.754) (-331.603) (-329.316) [-330.537] -- 0:00:56
164000 -- [-332.900] (-328.704) (-329.700) (-329.859) * (-333.720) (-331.445) (-329.699) [-331.506] -- 0:00:56
164500 -- (-329.379) (-332.701) [-327.888] (-329.670) * (-329.959) [-329.777] (-330.388) (-331.177) -- 0:00:55
165000 -- (-329.912) [-331.626] (-328.904) (-332.274) * (-328.396) (-328.917) (-328.957) [-329.773] -- 0:00:55
Average standard deviation of split frequencies: 0.018601
165500 -- (-329.008) [-329.313] (-331.848) (-329.631) * (-331.603) [-328.831] (-330.009) (-327.916) -- 0:00:55
166000 -- (-329.992) (-329.805) [-331.073] (-329.841) * (-328.062) (-330.248) [-329.404] (-329.128) -- 0:00:55
166500 -- (-330.861) [-329.615] (-329.184) (-328.547) * (-328.940) [-329.474] (-330.226) (-330.913) -- 0:00:55
167000 -- (-328.620) (-329.732) [-328.718] (-328.141) * (-332.625) (-331.851) [-330.407] (-331.538) -- 0:00:54
167500 -- (-329.180) (-333.230) (-331.430) [-328.208] * (-332.039) [-330.599] (-329.243) (-328.403) -- 0:00:54
168000 -- (-327.994) (-329.417) (-327.676) [-328.991] * (-329.811) (-329.902) [-328.912] (-327.774) -- 0:00:59
168500 -- (-328.024) (-329.509) (-327.393) [-329.209] * (-329.136) (-330.419) [-331.001] (-329.427) -- 0:00:59
169000 -- (-330.595) [-329.206] (-327.553) (-331.047) * (-327.735) [-328.158] (-329.375) (-328.615) -- 0:00:59
169500 -- (-328.016) (-331.578) [-329.684] (-329.758) * [-329.434] (-328.842) (-329.750) (-329.300) -- 0:00:58
170000 -- [-328.531] (-329.969) (-328.127) (-329.984) * [-329.392] (-330.352) (-330.956) (-332.234) -- 0:00:58
Average standard deviation of split frequencies: 0.015701
170500 -- (-331.934) [-330.046] (-328.474) (-332.876) * [-328.621] (-331.741) (-332.699) (-330.551) -- 0:00:58
171000 -- (-327.525) (-330.214) (-330.207) [-327.641] * (-329.125) (-329.817) (-332.950) [-328.383] -- 0:00:58
171500 -- (-329.715) [-328.556] (-328.976) (-329.335) * (-329.640) (-328.986) [-329.602] (-329.183) -- 0:00:57
172000 -- (-328.344) (-332.652) [-329.214] (-333.804) * (-329.747) [-328.666] (-328.410) (-328.647) -- 0:00:57
172500 -- (-328.054) (-330.456) [-329.366] (-330.614) * (-331.237) (-328.257) [-333.137] (-329.658) -- 0:00:57
173000 -- (-328.983) (-328.498) (-333.393) [-329.244] * (-328.606) (-328.435) [-329.534] (-329.415) -- 0:00:57
173500 -- (-329.303) (-329.567) (-330.534) [-329.726] * (-330.431) (-330.604) [-333.676] (-329.710) -- 0:00:57
174000 -- (-330.129) (-329.486) (-331.900) [-329.108] * [-330.043] (-331.520) (-331.297) (-328.552) -- 0:00:56
174500 -- (-328.647) [-329.420] (-329.973) (-331.035) * [-328.822] (-330.259) (-330.227) (-328.875) -- 0:00:56
175000 -- (-330.890) (-332.632) [-332.476] (-328.058) * [-328.985] (-330.870) (-335.073) (-327.876) -- 0:00:56
Average standard deviation of split frequencies: 0.015475
175500 -- (-330.957) [-329.566] (-331.392) (-330.793) * (-332.360) (-328.195) (-331.064) [-328.675] -- 0:00:56
176000 -- (-338.907) [-327.875] (-329.770) (-330.366) * (-328.445) [-328.070] (-329.721) (-332.623) -- 0:00:56
176500 -- (-337.002) (-327.468) [-329.407] (-328.399) * (-329.991) (-332.409) (-330.181) [-330.446] -- 0:00:55
177000 -- [-329.658] (-328.362) (-331.105) (-328.249) * (-332.821) (-331.249) [-329.203] (-329.571) -- 0:00:55
177500 -- (-331.693) [-327.638] (-330.600) (-330.681) * [-329.374] (-328.538) (-328.316) (-330.409) -- 0:00:55
178000 -- [-329.426] (-330.872) (-330.081) (-331.090) * (-328.426) (-328.565) [-330.197] (-328.135) -- 0:00:55
178500 -- (-331.815) (-329.114) (-330.280) [-330.548] * [-327.477] (-334.807) (-329.485) (-328.712) -- 0:00:55
179000 -- [-331.879] (-331.166) (-333.649) (-327.928) * [-329.464] (-330.451) (-328.343) (-332.732) -- 0:00:55
179500 -- (-330.972) [-328.558] (-332.318) (-327.650) * (-330.510) (-330.461) [-330.709] (-332.496) -- 0:00:54
180000 -- (-330.132) [-328.844] (-329.475) (-329.950) * (-328.663) (-331.563) [-331.614] (-329.144) -- 0:00:54
Average standard deviation of split frequencies: 0.014641
180500 -- [-330.451] (-329.400) (-327.838) (-330.500) * [-328.592] (-329.985) (-329.114) (-328.831) -- 0:00:54
181000 -- [-331.340] (-329.744) (-329.828) (-330.562) * (-332.713) (-329.483) [-328.898] (-329.245) -- 0:00:54
181500 -- (-335.613) [-327.920] (-329.055) (-331.611) * (-331.345) [-329.187] (-330.824) (-332.954) -- 0:00:54
182000 -- [-332.820] (-331.099) (-329.080) (-335.488) * (-334.061) (-329.795) [-330.868] (-330.672) -- 0:00:53
182500 -- [-329.098] (-330.200) (-332.584) (-331.341) * (-329.439) (-330.368) [-328.086] (-328.093) -- 0:00:58
183000 -- (-329.298) [-331.358] (-329.918) (-333.722) * (-329.726) (-332.814) (-327.549) [-329.371] -- 0:00:58
183500 -- [-328.549] (-331.786) (-332.383) (-329.996) * [-328.830] (-331.273) (-330.583) (-329.630) -- 0:00:57
184000 -- [-329.144] (-339.424) (-330.516) (-340.368) * (-331.041) [-327.952] (-330.836) (-331.086) -- 0:00:57
184500 -- (-331.095) [-332.561] (-329.107) (-329.542) * [-329.395] (-328.198) (-330.815) (-331.038) -- 0:00:57
185000 -- (-331.865) (-330.217) (-330.560) [-329.892] * (-336.541) [-329.577] (-332.745) (-328.686) -- 0:00:57
Average standard deviation of split frequencies: 0.014139
185500 -- (-328.632) (-329.360) [-334.699] (-330.961) * [-328.571] (-328.109) (-335.321) (-329.383) -- 0:00:57
186000 -- [-327.742] (-333.773) (-329.265) (-329.668) * (-328.364) (-332.390) [-329.640] (-328.640) -- 0:00:56
186500 -- (-328.772) (-328.655) [-329.859] (-328.602) * (-330.203) (-332.064) (-329.682) [-331.240] -- 0:00:56
187000 -- [-328.792] (-331.806) (-332.900) (-328.801) * (-330.518) (-337.526) [-328.448] (-329.479) -- 0:00:56
187500 -- (-330.334) (-331.956) [-332.156] (-328.700) * (-335.285) (-328.380) [-327.693] (-329.607) -- 0:00:56
188000 -- (-331.267) [-329.062] (-328.326) (-331.933) * (-328.772) (-329.976) [-327.948] (-328.457) -- 0:00:56
188500 -- (-331.578) [-328.449] (-331.023) (-330.928) * (-331.413) (-331.985) [-331.377] (-329.942) -- 0:00:55
189000 -- (-328.053) [-330.921] (-329.593) (-334.721) * [-329.517] (-329.726) (-328.715) (-329.532) -- 0:00:55
189500 -- (-334.518) (-328.007) (-328.282) [-330.757] * (-329.004) [-328.310] (-330.259) (-331.503) -- 0:00:55
190000 -- (-331.073) (-328.076) [-328.391] (-332.228) * (-329.639) (-331.433) [-329.983] (-328.753) -- 0:00:55
Average standard deviation of split frequencies: 0.014560
190500 -- [-329.960] (-330.804) (-330.677) (-329.592) * (-335.661) [-329.936] (-329.233) (-327.904) -- 0:00:55
191000 -- (-330.221) (-330.233) [-331.060] (-330.458) * (-338.050) [-327.899] (-328.323) (-328.670) -- 0:00:55
191500 -- (-328.759) [-328.204] (-332.531) (-329.525) * (-330.871) [-331.370] (-330.418) (-331.481) -- 0:00:54
192000 -- (-328.501) (-328.292) [-328.501] (-329.071) * (-327.991) (-328.820) [-328.903] (-330.363) -- 0:00:54
192500 -- (-332.713) (-328.782) [-329.595] (-329.083) * (-332.077) (-329.952) (-330.014) [-329.886] -- 0:00:54
193000 -- [-329.907] (-329.832) (-333.285) (-328.145) * (-330.412) [-330.828] (-329.925) (-329.117) -- 0:00:54
193500 -- [-328.466] (-330.366) (-327.957) (-332.342) * (-329.980) [-329.258] (-332.576) (-330.355) -- 0:00:54
194000 -- (-329.467) [-328.363] (-328.763) (-330.512) * (-331.584) (-328.224) (-330.951) [-329.226] -- 0:00:54
194500 -- [-329.004] (-330.734) (-329.395) (-332.125) * (-329.012) (-327.903) [-330.575] (-330.576) -- 0:00:53
195000 -- (-327.839) [-327.701] (-328.539) (-328.828) * (-332.596) [-328.755] (-332.064) (-335.214) -- 0:00:53
Average standard deviation of split frequencies: 0.015099
195500 -- [-330.113] (-334.087) (-328.407) (-328.150) * [-328.493] (-329.217) (-329.994) (-329.770) -- 0:00:53
196000 -- [-327.945] (-332.000) (-329.255) (-330.162) * (-330.394) [-328.608] (-330.331) (-329.528) -- 0:00:53
196500 -- (-329.443) (-329.228) [-330.934] (-331.030) * (-328.312) (-328.230) [-331.444] (-332.892) -- 0:00:53
197000 -- (-329.016) (-331.694) (-328.825) [-328.704] * [-329.496] (-332.342) (-332.936) (-329.696) -- 0:00:57
197500 -- (-329.241) [-329.713] (-329.456) (-328.851) * (-330.046) (-329.848) (-329.055) [-330.344] -- 0:00:56
198000 -- (-332.498) (-329.703) [-329.340] (-329.655) * (-328.859) (-337.026) [-329.920] (-331.481) -- 0:00:56
198500 -- (-331.716) (-328.816) [-329.322] (-329.063) * (-329.023) (-329.319) (-330.907) [-331.944] -- 0:00:56
199000 -- (-329.640) (-331.840) (-329.514) [-332.067] * [-328.177] (-331.899) (-330.733) (-329.900) -- 0:00:56
199500 -- (-327.722) (-327.621) (-331.697) [-328.052] * (-328.385) (-328.898) (-330.952) [-331.903] -- 0:00:56
200000 -- (-327.931) (-329.030) [-329.123] (-329.623) * (-329.188) (-331.286) (-328.126) [-331.547] -- 0:00:55
Average standard deviation of split frequencies: 0.014226
200500 -- [-328.394] (-330.179) (-331.055) (-329.982) * (-332.800) [-328.111] (-329.639) (-336.700) -- 0:00:55
201000 -- (-328.287) (-329.768) (-328.972) [-331.218] * [-329.387] (-328.836) (-330.993) (-331.004) -- 0:00:55
201500 -- (-329.105) (-335.856) [-332.339] (-328.598) * (-332.211) (-329.425) [-331.779] (-331.458) -- 0:00:55
202000 -- (-331.540) [-331.213] (-328.314) (-332.516) * (-328.669) (-331.265) (-332.859) [-328.606] -- 0:00:55
202500 -- (-331.340) (-328.974) [-331.170] (-329.319) * (-332.612) (-330.949) [-328.267] (-330.903) -- 0:00:55
203000 -- [-330.552] (-329.840) (-332.345) (-331.363) * (-333.458) (-328.569) (-330.621) [-327.333] -- 0:00:54
203500 -- (-328.846) (-330.677) (-331.403) [-332.191] * (-328.506) (-327.438) [-328.990] (-330.643) -- 0:00:54
204000 -- (-330.487) (-328.657) (-330.522) [-330.499] * (-328.411) [-329.032] (-329.445) (-331.130) -- 0:00:54
204500 -- (-331.824) [-329.953] (-330.005) (-330.074) * [-329.567] (-334.348) (-329.498) (-334.448) -- 0:00:54
205000 -- (-330.874) [-331.054] (-328.397) (-329.615) * (-327.947) (-338.395) (-327.686) [-330.597] -- 0:00:54
Average standard deviation of split frequencies: 0.015256
205500 -- (-330.335) [-331.472] (-329.226) (-327.739) * (-330.203) (-337.201) (-329.006) [-328.611] -- 0:00:54
206000 -- (-332.041) [-328.141] (-331.047) (-327.890) * (-332.421) (-330.881) (-329.967) [-329.057] -- 0:00:53
206500 -- (-332.207) (-329.167) (-328.626) [-328.947] * (-328.247) [-328.054] (-330.768) (-329.855) -- 0:00:53
207000 -- (-333.011) (-328.924) [-328.745] (-328.908) * (-329.340) (-332.157) (-330.839) [-328.823] -- 0:00:53
207500 -- (-332.380) (-331.070) (-329.275) [-329.005] * (-329.603) [-332.432] (-331.198) (-328.038) -- 0:00:53
208000 -- (-333.795) [-328.762] (-329.083) (-330.331) * (-327.762) (-329.712) (-330.150) [-331.489] -- 0:00:53
208500 -- [-328.572] (-329.304) (-330.495) (-329.487) * (-329.887) (-329.024) [-329.857] (-333.618) -- 0:00:53
209000 -- (-330.401) (-329.406) (-331.790) [-329.442] * (-331.135) (-331.610) [-328.860] (-328.885) -- 0:00:52
209500 -- (-331.245) (-329.643) [-335.634] (-327.393) * (-329.817) (-327.980) [-329.463] (-331.075) -- 0:00:52
210000 -- (-329.526) (-331.429) [-328.640] (-328.039) * (-330.509) [-329.054] (-333.433) (-330.478) -- 0:00:52
Average standard deviation of split frequencies: 0.015291
210500 -- (-329.983) (-329.312) (-328.166) [-330.203] * [-330.543] (-330.106) (-341.042) (-328.437) -- 0:00:52
211000 -- [-330.234] (-328.622) (-330.600) (-330.033) * (-329.155) (-330.094) (-339.813) [-329.079] -- 0:00:52
211500 -- [-332.963] (-333.185) (-333.391) (-335.016) * (-329.328) (-330.743) (-336.678) [-330.683] -- 0:00:55
212000 -- (-328.466) (-328.443) [-329.960] (-333.055) * (-328.622) [-328.158] (-336.817) (-334.323) -- 0:00:55
212500 -- (-330.512) (-328.577) (-328.478) [-331.493] * (-335.765) (-329.616) (-336.367) [-329.755] -- 0:00:55
213000 -- [-329.921] (-328.642) (-330.832) (-331.440) * (-330.081) (-328.284) [-327.944] (-328.928) -- 0:00:55
213500 -- (-330.164) (-330.755) [-330.700] (-331.200) * (-331.502) (-329.713) [-327.504] (-330.527) -- 0:00:55
214000 -- (-330.145) (-330.112) [-329.445] (-328.821) * [-328.613] (-328.677) (-332.285) (-328.857) -- 0:00:55
214500 -- (-328.295) (-335.462) (-328.192) [-327.953] * [-328.364] (-330.620) (-328.243) (-331.079) -- 0:00:54
215000 -- (-331.817) [-330.741] (-330.068) (-329.164) * (-330.412) [-333.697] (-327.683) (-328.444) -- 0:00:54
Average standard deviation of split frequencies: 0.014913
215500 -- (-329.375) (-329.981) [-329.085] (-330.064) * [-331.108] (-329.119) (-329.878) (-328.442) -- 0:00:54
216000 -- [-330.281] (-331.042) (-329.467) (-329.901) * (-328.605) [-331.972] (-330.101) (-333.304) -- 0:00:54
216500 -- (-327.824) [-329.523] (-329.309) (-335.697) * (-332.616) [-328.615] (-328.370) (-332.320) -- 0:00:54
217000 -- (-330.852) (-329.795) (-330.586) [-332.739] * [-329.802] (-329.910) (-329.991) (-330.684) -- 0:00:54
217500 -- [-334.480] (-328.280) (-330.167) (-329.761) * [-329.547] (-330.887) (-329.166) (-331.541) -- 0:00:53
218000 -- (-330.626) [-328.117] (-332.894) (-328.722) * (-329.395) [-330.398] (-328.680) (-329.816) -- 0:00:53
218500 -- (-328.633) (-329.545) [-330.024] (-329.134) * [-330.559] (-327.819) (-330.020) (-329.391) -- 0:00:53
219000 -- (-336.361) (-331.453) (-330.968) [-333.178] * [-327.667] (-330.771) (-329.133) (-328.824) -- 0:00:53
219500 -- (-332.274) [-328.827] (-328.992) (-329.667) * (-329.255) (-330.011) (-329.876) [-328.600] -- 0:00:53
220000 -- (-331.906) (-330.822) [-330.282] (-333.278) * (-329.025) (-329.320) (-335.116) [-327.712] -- 0:00:53
Average standard deviation of split frequencies: 0.013767
220500 -- (-328.928) (-334.458) (-330.409) [-329.620] * (-328.789) (-331.012) [-329.138] (-332.014) -- 0:00:53
221000 -- (-328.709) (-336.020) (-331.317) [-329.562] * [-329.049] (-330.890) (-330.363) (-331.451) -- 0:00:52
221500 -- (-328.017) (-334.509) (-331.305) [-330.128] * (-331.414) (-332.469) [-329.210] (-331.672) -- 0:00:52
222000 -- [-332.052] (-330.343) (-328.513) (-331.371) * (-327.973) [-329.406] (-329.154) (-330.314) -- 0:00:52
222500 -- (-331.272) [-328.840] (-329.964) (-328.258) * (-329.665) (-331.745) (-329.459) [-329.518] -- 0:00:52
223000 -- (-328.563) (-329.431) (-328.588) [-328.758] * (-331.780) [-335.525] (-329.969) (-328.016) -- 0:00:52
223500 -- [-328.569] (-328.515) (-330.169) (-329.284) * [-330.033] (-334.282) (-329.208) (-327.775) -- 0:00:52
224000 -- (-332.055) (-331.172) (-329.504) [-329.467] * (-330.146) (-337.272) (-328.497) [-328.549] -- 0:00:51
224500 -- [-327.850] (-328.675) (-330.104) (-329.938) * (-328.403) [-333.518] (-331.825) (-327.884) -- 0:00:51
225000 -- (-331.279) (-328.864) (-329.514) [-332.298] * (-328.783) [-327.610] (-330.697) (-329.921) -- 0:00:51
Average standard deviation of split frequencies: 0.013064
225500 -- (-333.717) (-329.642) [-328.754] (-328.993) * (-328.457) (-330.699) (-327.801) [-330.188] -- 0:00:51
226000 -- (-331.023) (-331.623) (-329.831) [-330.014] * (-331.344) (-334.007) [-328.838] (-327.496) -- 0:00:54
226500 -- (-327.800) (-336.351) (-327.837) [-330.383] * [-335.222] (-333.091) (-328.666) (-329.900) -- 0:00:54
227000 -- (-332.232) [-333.442] (-328.873) (-332.405) * (-331.260) [-329.085] (-329.991) (-329.375) -- 0:00:54
227500 -- (-329.863) (-330.159) (-329.066) [-328.117] * (-329.403) (-330.764) (-329.592) [-331.665] -- 0:00:54
228000 -- (-331.309) (-329.335) [-329.459] (-329.461) * [-327.810] (-329.191) (-331.117) (-328.685) -- 0:00:54
228500 -- (-328.882) (-327.557) (-328.919) [-329.165] * (-329.446) (-332.495) (-331.251) [-332.664] -- 0:00:54
229000 -- (-337.883) [-331.852] (-332.360) (-328.632) * (-329.991) (-331.486) [-328.724] (-328.201) -- 0:00:53
229500 -- [-331.754] (-330.574) (-329.746) (-331.533) * [-331.971] (-332.334) (-328.438) (-327.615) -- 0:00:53
230000 -- (-329.079) [-330.536] (-334.105) (-329.287) * (-328.495) (-328.138) (-328.375) [-328.822] -- 0:00:53
Average standard deviation of split frequencies: 0.011240
230500 -- [-328.292] (-329.140) (-330.864) (-330.806) * (-328.679) [-328.891] (-328.215) (-327.649) -- 0:00:53
231000 -- (-331.503) (-332.902) (-329.470) [-328.396] * (-329.378) [-329.665] (-328.154) (-332.217) -- 0:00:53
231500 -- (-328.897) (-331.641) (-328.840) [-328.631] * (-334.226) [-328.849] (-334.848) (-332.674) -- 0:00:53
232000 -- (-331.420) [-327.681] (-329.373) (-328.896) * (-330.098) (-329.232) [-332.053] (-328.248) -- 0:00:52
232500 -- (-328.672) (-332.522) [-329.989] (-329.933) * (-327.667) (-328.343) [-328.701] (-329.105) -- 0:00:52
233000 -- (-328.691) (-328.513) (-330.917) [-331.454] * [-332.716] (-329.798) (-329.083) (-328.536) -- 0:00:52
233500 -- (-329.035) (-328.289) [-328.819] (-332.099) * (-331.438) [-329.550] (-328.125) (-328.672) -- 0:00:52
234000 -- (-328.865) (-330.131) [-329.364] (-334.778) * (-331.635) (-329.817) (-329.476) [-330.038] -- 0:00:52
234500 -- (-332.289) (-327.420) (-328.501) [-328.186] * (-331.004) (-336.459) (-329.343) [-327.648] -- 0:00:52
235000 -- (-330.621) [-329.662] (-329.882) (-327.808) * (-333.936) [-329.767] (-330.072) (-329.148) -- 0:00:52
Average standard deviation of split frequencies: 0.011564
235500 -- (-328.906) (-330.913) (-329.248) [-331.532] * (-338.143) (-329.106) [-330.427] (-331.019) -- 0:00:51
236000 -- (-330.686) [-330.193] (-329.696) (-330.578) * (-335.435) (-330.498) (-334.080) [-331.190] -- 0:00:51
236500 -- (-328.760) (-328.038) [-327.433] (-329.909) * (-329.911) (-328.392) (-329.942) [-328.767] -- 0:00:51
237000 -- (-331.343) [-328.206] (-330.031) (-327.684) * [-330.078] (-328.862) (-333.628) (-328.964) -- 0:00:51
237500 -- (-331.337) (-330.058) (-328.775) [-328.885] * (-330.730) (-332.806) (-336.789) [-330.650] -- 0:00:51
238000 -- (-331.301) (-333.036) (-329.126) [-330.423] * (-329.727) [-328.880] (-334.182) (-329.117) -- 0:00:51
238500 -- (-330.299) [-328.650] (-330.423) (-327.934) * (-329.410) [-330.747] (-333.563) (-329.683) -- 0:00:51
239000 -- [-330.465] (-328.899) (-328.752) (-329.200) * (-330.669) [-328.085] (-331.308) (-330.769) -- 0:00:50
239500 -- (-330.697) (-334.850) [-328.459] (-328.469) * [-328.635] (-327.746) (-332.945) (-331.060) -- 0:00:50
240000 -- (-331.189) (-330.797) (-330.255) [-332.069] * [-329.357] (-332.489) (-335.434) (-331.606) -- 0:00:50
Average standard deviation of split frequencies: 0.011140
240500 -- (-331.834) (-330.555) (-331.736) [-329.461] * (-328.510) [-329.922] (-330.106) (-331.162) -- 0:00:50
241000 -- (-330.677) (-328.618) [-334.395] (-332.401) * (-332.884) (-329.961) [-328.284] (-331.927) -- 0:00:53
241500 -- (-329.300) [-330.926] (-333.886) (-328.719) * [-329.336] (-328.419) (-329.346) (-330.855) -- 0:00:53
242000 -- (-330.034) (-331.419) [-331.580] (-329.369) * (-328.562) (-329.472) (-331.147) [-329.397] -- 0:00:53
242500 -- (-330.656) (-330.110) (-328.239) [-329.696] * [-328.937] (-331.007) (-331.463) (-332.995) -- 0:00:53
243000 -- (-328.530) (-327.908) [-329.195] (-328.668) * [-329.058] (-334.891) (-328.770) (-328.128) -- 0:00:52
243500 -- (-329.044) [-331.528] (-331.467) (-329.086) * (-328.176) [-328.839] (-330.603) (-328.635) -- 0:00:52
244000 -- [-328.926] (-335.510) (-330.489) (-328.655) * (-330.250) (-334.944) (-328.537) [-327.714] -- 0:00:52
244500 -- (-330.270) (-330.533) [-330.205] (-328.237) * [-328.918] (-335.356) (-330.465) (-328.352) -- 0:00:52
245000 -- (-329.787) (-332.613) (-335.404) [-329.449] * (-330.388) (-333.777) (-328.628) [-334.548] -- 0:00:52
Average standard deviation of split frequencies: 0.012405
245500 -- [-330.263] (-332.571) (-328.016) (-330.135) * (-327.772) (-333.880) (-332.330) [-328.763] -- 0:00:52
246000 -- (-328.584) [-330.292] (-329.393) (-328.701) * (-329.833) (-330.025) [-329.959] (-329.795) -- 0:00:52
246500 -- (-330.480) [-327.837] (-332.604) (-329.649) * (-330.668) (-328.127) [-330.164] (-333.335) -- 0:00:51
247000 -- (-329.354) (-330.705) [-330.794] (-328.929) * (-328.945) (-328.343) (-329.359) [-328.368] -- 0:00:51
247500 -- (-329.766) (-328.850) [-329.008] (-331.330) * (-330.095) [-327.803] (-329.250) (-329.770) -- 0:00:51
248000 -- (-329.457) [-328.436] (-328.100) (-329.676) * (-329.603) [-331.354] (-328.363) (-330.070) -- 0:00:51
248500 -- (-330.104) (-328.801) [-329.486] (-330.320) * (-329.241) [-333.520] (-334.429) (-332.630) -- 0:00:51
249000 -- (-328.754) [-329.269] (-330.143) (-329.865) * [-330.010] (-329.764) (-330.399) (-332.583) -- 0:00:51
249500 -- (-328.787) (-331.088) (-329.895) [-328.216] * (-329.745) (-330.488) [-328.835] (-330.838) -- 0:00:51
250000 -- (-328.683) (-328.547) [-330.098] (-327.942) * [-329.927] (-331.266) (-328.425) (-329.634) -- 0:00:51
Average standard deviation of split frequencies: 0.010509
250500 -- (-328.836) (-330.673) [-332.131] (-330.091) * (-334.123) [-329.980] (-328.944) (-330.910) -- 0:00:50
251000 -- (-330.018) (-329.910) (-332.767) [-328.225] * (-329.431) (-330.811) (-328.468) [-329.538] -- 0:00:50
251500 -- [-330.554] (-332.950) (-332.546) (-330.201) * (-332.084) (-328.700) [-327.765] (-331.721) -- 0:00:50
252000 -- (-333.187) (-331.983) [-333.180] (-330.700) * [-329.029] (-329.080) (-329.875) (-330.035) -- 0:00:50
252500 -- (-329.925) (-330.192) (-334.305) [-329.099] * [-328.459] (-331.190) (-329.189) (-332.082) -- 0:00:50
253000 -- (-331.138) [-328.690] (-333.683) (-328.619) * [-330.154] (-329.540) (-330.818) (-330.165) -- 0:00:50
253500 -- (-330.726) (-331.826) [-329.271] (-330.818) * (-331.546) (-328.442) [-330.769] (-331.321) -- 0:00:50
254000 -- [-328.903] (-333.841) (-331.130) (-331.999) * (-328.097) (-330.915) (-328.097) [-329.451] -- 0:00:49
254500 -- (-331.770) (-331.433) (-331.028) [-331.064] * [-327.866] (-328.531) (-329.480) (-331.167) -- 0:00:49
255000 -- (-331.596) (-329.203) [-328.811] (-330.723) * (-328.315) (-328.211) (-333.077) [-329.269] -- 0:00:49
Average standard deviation of split frequencies: 0.011049
255500 -- (-328.353) (-335.133) [-328.569] (-333.011) * (-328.718) (-327.865) (-335.220) [-328.737] -- 0:00:52
256000 -- (-334.188) (-331.814) (-328.476) [-331.300] * (-337.692) [-329.350] (-331.641) (-331.684) -- 0:00:52
256500 -- [-328.992] (-331.103) (-333.943) (-329.926) * (-329.109) [-331.399] (-332.274) (-329.359) -- 0:00:52
257000 -- (-328.913) [-329.384] (-331.809) (-330.793) * (-327.793) (-336.308) (-331.988) [-329.013] -- 0:00:52
257500 -- (-329.521) [-329.612] (-331.834) (-331.865) * (-333.507) [-329.527] (-330.868) (-331.267) -- 0:00:51
258000 -- (-330.569) (-329.169) [-329.501] (-328.000) * (-331.109) (-329.167) [-331.630] (-329.683) -- 0:00:51
258500 -- (-335.825) (-328.768) [-329.189] (-328.989) * (-331.295) [-329.327] (-330.241) (-329.688) -- 0:00:51
259000 -- [-328.626] (-328.496) (-331.172) (-328.936) * (-329.019) (-331.335) [-327.662] (-329.396) -- 0:00:51
259500 -- (-330.612) [-328.008] (-331.745) (-327.500) * [-331.292] (-331.597) (-331.572) (-330.283) -- 0:00:51
260000 -- (-328.365) [-327.737] (-331.067) (-329.867) * (-328.908) (-331.202) [-331.571] (-331.650) -- 0:00:51
Average standard deviation of split frequencies: 0.013111
260500 -- [-329.338] (-329.574) (-328.094) (-330.263) * (-329.345) [-328.275] (-330.252) (-328.699) -- 0:00:51
261000 -- [-331.830] (-329.825) (-330.454) (-329.108) * (-327.852) (-329.765) [-328.510] (-328.336) -- 0:00:50
261500 -- (-328.710) (-328.196) (-331.510) [-329.568] * [-328.885] (-328.730) (-328.394) (-329.648) -- 0:00:50
262000 -- (-328.204) (-332.725) (-330.151) [-327.788] * (-328.788) (-329.372) (-328.944) [-328.950] -- 0:00:50
262500 -- (-329.967) [-330.817] (-332.671) (-328.609) * (-329.442) (-328.161) (-329.034) [-328.293] -- 0:00:50
263000 -- [-329.934] (-336.668) (-329.483) (-327.624) * (-328.481) [-332.821] (-328.320) (-327.895) -- 0:00:50
263500 -- [-328.094] (-331.306) (-328.202) (-327.900) * (-328.341) (-329.338) [-328.293] (-328.063) -- 0:00:50
264000 -- (-328.899) (-329.027) (-330.043) [-328.022] * [-329.440] (-328.686) (-330.116) (-332.398) -- 0:00:50
264500 -- (-331.996) (-329.130) [-332.586] (-331.035) * (-328.883) [-328.302] (-328.649) (-329.366) -- 0:00:50
265000 -- (-328.898) [-328.676] (-334.547) (-332.577) * (-330.420) [-328.965] (-328.677) (-329.972) -- 0:00:49
Average standard deviation of split frequencies: 0.013587
265500 -- (-329.191) [-329.421] (-330.577) (-332.020) * (-328.037) (-329.390) (-329.039) [-329.396] -- 0:00:49
266000 -- [-328.899] (-328.126) (-331.239) (-330.360) * [-328.632] (-329.081) (-329.475) (-328.386) -- 0:00:49
266500 -- (-328.830) [-328.760] (-332.928) (-331.659) * (-333.700) (-328.011) [-328.616] (-327.848) -- 0:00:49
267000 -- (-330.505) (-328.220) (-329.813) [-330.961] * (-329.335) (-327.745) [-330.909] (-330.930) -- 0:00:49
267500 -- (-329.558) (-329.543) (-336.140) [-329.280] * (-329.029) (-332.897) (-330.453) [-329.463] -- 0:00:49
268000 -- (-330.970) (-332.608) (-331.386) [-329.288] * (-329.015) (-332.997) [-333.359] (-328.141) -- 0:00:49
268500 -- (-329.022) (-329.714) [-330.250] (-328.206) * [-330.276] (-329.701) (-330.465) (-329.654) -- 0:00:49
269000 -- [-331.479] (-331.393) (-329.277) (-331.316) * [-330.503] (-329.004) (-330.476) (-328.167) -- 0:00:48
269500 -- [-328.299] (-328.653) (-331.226) (-331.685) * (-331.486) (-331.599) [-328.338] (-327.867) -- 0:00:48
270000 -- [-333.475] (-329.412) (-327.745) (-331.977) * [-330.400] (-330.416) (-331.250) (-330.584) -- 0:00:48
Average standard deviation of split frequencies: 0.013114
270500 -- (-330.404) (-332.974) [-329.494] (-329.369) * (-329.073) (-330.999) (-332.571) [-328.322] -- 0:00:51
271000 -- [-331.020] (-329.742) (-332.240) (-328.180) * (-333.270) (-329.011) (-329.316) [-329.328] -- 0:00:51
271500 -- [-330.392] (-330.947) (-331.458) (-329.141) * (-330.872) (-328.181) (-329.871) [-331.262] -- 0:00:50
272000 -- (-333.041) [-328.965] (-328.726) (-330.325) * (-334.200) (-332.046) [-330.274] (-330.558) -- 0:00:50
272500 -- (-330.483) [-328.980] (-331.601) (-328.904) * (-331.556) (-328.603) (-329.037) [-333.063] -- 0:00:50
273000 -- [-327.686] (-332.443) (-328.632) (-328.057) * (-334.060) (-330.139) [-328.644] (-331.780) -- 0:00:50
273500 -- (-328.431) [-330.581] (-327.993) (-329.846) * (-328.330) [-333.762] (-327.683) (-333.474) -- 0:00:50
274000 -- [-327.680] (-331.076) (-329.204) (-332.631) * (-330.422) (-331.826) [-327.972] (-329.024) -- 0:00:50
274500 -- (-330.038) (-330.385) (-328.040) [-328.285] * (-332.307) (-328.789) [-328.723] (-329.182) -- 0:00:50
275000 -- (-329.490) [-327.651] (-330.236) (-331.781) * (-333.510) (-328.116) [-330.185] (-331.044) -- 0:00:50
Average standard deviation of split frequencies: 0.013463
275500 -- (-329.948) [-330.149] (-334.538) (-329.154) * [-331.225] (-330.398) (-330.606) (-331.188) -- 0:00:49
276000 -- (-330.643) (-327.931) [-329.494] (-331.461) * [-332.123] (-330.941) (-332.170) (-332.122) -- 0:00:49
276500 -- (-328.860) [-328.112] (-332.116) (-332.370) * (-329.551) [-332.919] (-329.195) (-331.022) -- 0:00:49
277000 -- [-329.593] (-328.724) (-329.271) (-328.934) * (-330.502) (-328.926) [-329.156] (-328.323) -- 0:00:49
277500 -- (-330.430) (-328.415) [-330.552] (-329.719) * (-332.268) (-327.992) [-327.671] (-328.263) -- 0:00:49
278000 -- [-328.424] (-330.470) (-331.797) (-331.047) * (-335.609) [-332.549] (-333.192) (-328.386) -- 0:00:49
278500 -- (-329.778) [-331.090] (-329.406) (-334.002) * (-337.054) (-332.398) [-330.501] (-328.054) -- 0:00:49
279000 -- (-329.434) (-331.649) (-328.825) [-329.291] * (-330.815) (-329.560) (-327.943) [-329.216] -- 0:00:49
279500 -- (-328.384) (-329.574) [-329.262] (-328.351) * [-329.209] (-328.520) (-330.819) (-328.591) -- 0:00:48
280000 -- (-334.418) [-331.193] (-329.030) (-330.932) * [-330.549] (-332.801) (-332.906) (-330.357) -- 0:00:48
Average standard deviation of split frequencies: 0.013338
280500 -- [-330.947] (-329.235) (-330.222) (-330.843) * (-330.027) [-331.209] (-328.732) (-335.057) -- 0:00:48
281000 -- (-331.623) (-328.938) (-328.217) [-329.009] * (-331.456) (-329.812) (-328.712) [-328.465] -- 0:00:48
281500 -- (-327.865) [-330.414] (-329.555) (-329.324) * (-328.302) (-327.755) (-332.152) [-328.930] -- 0:00:48
282000 -- (-328.520) (-330.508) [-330.954] (-330.958) * (-330.383) [-329.904] (-330.387) (-332.091) -- 0:00:48
282500 -- [-329.517] (-329.646) (-328.744) (-330.477) * (-329.216) [-328.986] (-332.686) (-338.355) -- 0:00:48
283000 -- (-333.524) (-330.327) (-330.157) [-328.497] * (-329.677) (-330.647) (-329.678) [-329.148] -- 0:00:48
283500 -- (-334.200) (-331.513) (-331.386) [-329.024] * [-329.433] (-332.414) (-329.628) (-333.044) -- 0:00:48
284000 -- (-330.826) (-331.011) [-332.947] (-329.101) * (-329.205) (-332.682) [-329.470] (-330.812) -- 0:00:47
284500 -- (-328.816) (-329.676) (-341.917) [-329.147] * (-329.117) (-329.216) [-328.702] (-328.722) -- 0:00:47
285000 -- (-328.502) [-329.508] (-337.322) (-328.973) * [-329.624] (-329.851) (-328.055) (-330.267) -- 0:00:50
Average standard deviation of split frequencies: 0.012120
285500 -- (-330.545) [-330.882] (-330.603) (-330.463) * (-331.001) (-330.142) (-328.728) [-327.928] -- 0:00:50
286000 -- (-332.094) (-331.437) (-332.275) [-330.174] * (-328.362) (-331.880) [-329.111] (-330.131) -- 0:00:49
286500 -- (-329.806) [-329.868] (-331.693) (-328.384) * [-327.483] (-329.063) (-329.261) (-330.630) -- 0:00:49
287000 -- (-330.730) [-328.566] (-329.259) (-328.690) * (-328.024) (-330.126) [-328.770] (-331.738) -- 0:00:49
287500 -- (-328.825) (-332.385) (-329.062) [-327.702] * (-330.414) [-331.347] (-331.871) (-330.119) -- 0:00:49
288000 -- [-329.760] (-329.871) (-328.805) (-334.202) * (-334.282) (-330.332) (-331.315) [-331.839] -- 0:00:49
288500 -- (-331.375) [-329.292] (-329.246) (-334.321) * (-331.534) (-330.709) (-328.891) [-330.775] -- 0:00:49
289000 -- (-329.542) (-333.498) [-329.111] (-330.949) * (-330.460) [-329.411] (-329.771) (-328.984) -- 0:00:49
289500 -- (-333.201) [-330.153] (-330.003) (-333.858) * (-331.719) (-331.576) [-332.439] (-327.671) -- 0:00:49
290000 -- (-329.037) (-332.234) [-328.573] (-333.659) * (-328.981) [-328.715] (-340.947) (-327.786) -- 0:00:48
Average standard deviation of split frequencies: 0.012073
290500 -- [-329.525] (-339.086) (-333.686) (-327.779) * (-335.542) (-328.800) (-331.210) [-328.225] -- 0:00:48
291000 -- [-330.013] (-329.338) (-331.606) (-328.736) * (-332.025) [-331.139] (-330.537) (-328.035) -- 0:00:48
291500 -- [-331.054] (-328.819) (-334.444) (-329.854) * (-328.891) (-330.165) (-328.244) [-327.872] -- 0:00:48
292000 -- (-331.227) [-328.072] (-328.788) (-329.532) * (-328.032) (-332.136) [-332.689] (-328.211) -- 0:00:48
292500 -- (-332.361) [-332.525] (-330.333) (-328.066) * (-333.410) (-327.849) [-329.600] (-330.312) -- 0:00:48
293000 -- (-330.478) [-328.727] (-332.257) (-330.724) * (-333.541) [-328.737] (-329.523) (-327.977) -- 0:00:48
293500 -- (-331.250) [-329.092] (-328.832) (-330.657) * (-329.945) (-329.786) (-328.994) [-328.922] -- 0:00:48
294000 -- [-330.555] (-333.941) (-329.780) (-328.718) * (-330.362) (-335.087) (-329.240) [-329.503] -- 0:00:48
294500 -- [-328.091] (-333.227) (-330.004) (-331.065) * (-328.732) (-328.002) (-331.556) [-328.603] -- 0:00:47
295000 -- (-330.579) [-330.746] (-329.290) (-334.735) * [-328.218] (-329.022) (-328.817) (-330.182) -- 0:00:47
Average standard deviation of split frequencies: 0.013006
295500 -- (-334.415) (-327.947) [-328.215] (-331.086) * (-328.342) [-329.934] (-328.904) (-332.983) -- 0:00:47
296000 -- (-336.341) (-330.585) (-328.381) [-327.939] * (-331.305) (-329.434) (-330.075) [-329.404] -- 0:00:47
296500 -- (-329.996) (-328.787) [-328.266] (-329.981) * (-331.118) (-328.766) [-330.119] (-328.891) -- 0:00:47
297000 -- (-336.271) (-328.081) [-329.853] (-329.239) * [-331.254] (-328.567) (-329.698) (-327.590) -- 0:00:47
297500 -- [-329.041] (-329.242) (-331.808) (-330.029) * [-329.593] (-331.063) (-327.677) (-329.234) -- 0:00:47
298000 -- [-330.421] (-331.576) (-330.215) (-330.080) * (-331.321) [-331.772] (-327.952) (-330.173) -- 0:00:47
298500 -- (-331.768) (-332.616) (-327.527) [-328.700] * [-330.522] (-331.858) (-329.090) (-333.707) -- 0:00:47
299000 -- [-328.810] (-331.404) (-328.217) (-329.151) * (-330.733) [-336.609] (-329.484) (-330.698) -- 0:00:46
299500 -- [-329.899] (-329.700) (-328.931) (-333.174) * (-330.959) (-330.602) (-333.445) [-328.812] -- 0:00:49
300000 -- (-338.956) (-327.461) [-329.420] (-328.937) * (-332.646) (-331.303) [-329.490] (-332.799) -- 0:00:48
Average standard deviation of split frequencies: 0.012717
300500 -- (-331.866) [-328.621] (-331.183) (-331.174) * [-330.614] (-333.658) (-331.382) (-328.209) -- 0:00:48
301000 -- [-328.404] (-335.516) (-332.217) (-334.269) * (-331.394) (-335.684) (-328.915) [-330.718] -- 0:00:48
301500 -- (-327.976) (-334.052) [-332.949] (-329.763) * (-330.278) [-331.631] (-328.088) (-330.207) -- 0:00:48
302000 -- [-327.684] (-330.341) (-329.624) (-327.820) * (-329.663) (-328.336) [-329.659] (-331.951) -- 0:00:48
302500 -- [-328.799] (-333.346) (-329.718) (-329.582) * [-329.084] (-327.573) (-330.565) (-332.519) -- 0:00:48
303000 -- [-329.475] (-335.490) (-329.696) (-332.415) * [-329.750] (-329.886) (-329.037) (-329.877) -- 0:00:48
303500 -- (-330.309) [-331.060] (-329.721) (-328.780) * (-327.680) (-329.385) (-328.695) [-330.291] -- 0:00:48
304000 -- (-331.645) [-330.030] (-331.240) (-331.390) * [-328.991] (-329.103) (-331.376) (-329.035) -- 0:00:48
304500 -- [-331.233] (-330.317) (-327.400) (-330.203) * (-328.938) [-327.664] (-328.587) (-328.373) -- 0:00:47
305000 -- (-330.511) (-328.371) (-330.127) [-328.284] * (-328.329) (-328.792) (-331.923) [-329.355] -- 0:00:47
Average standard deviation of split frequencies: 0.012068
305500 -- [-332.551] (-329.829) (-330.032) (-330.521) * (-331.859) (-329.859) (-328.305) [-332.086] -- 0:00:47
306000 -- (-331.304) [-329.036] (-328.245) (-329.926) * (-329.557) (-332.366) (-331.369) [-329.250] -- 0:00:47
306500 -- (-329.154) [-328.735] (-332.413) (-327.936) * (-328.829) (-328.940) [-330.878] (-331.509) -- 0:00:47
307000 -- (-330.386) (-328.641) (-329.371) [-328.770] * (-331.142) (-329.261) (-328.382) [-330.825] -- 0:00:47
307500 -- (-329.972) (-327.899) (-331.432) [-330.577] * (-330.625) [-328.408] (-328.180) (-332.677) -- 0:00:47
308000 -- (-331.858) [-328.833] (-330.858) (-330.720) * (-329.893) [-328.240] (-331.393) (-334.204) -- 0:00:47
308500 -- (-330.802) (-329.164) [-330.514] (-330.837) * (-328.277) [-329.727] (-330.290) (-331.565) -- 0:00:47
309000 -- (-330.137) [-331.695] (-332.148) (-331.043) * (-330.591) [-332.392] (-329.653) (-330.909) -- 0:00:46
309500 -- (-329.180) (-333.764) [-330.659] (-329.903) * (-330.290) (-329.697) [-328.294] (-330.050) -- 0:00:46
310000 -- (-332.615) [-330.938] (-329.491) (-329.617) * (-328.122) (-331.192) [-328.575] (-331.016) -- 0:00:46
Average standard deviation of split frequencies: 0.011633
310500 -- (-329.141) (-331.852) [-328.890] (-328.061) * [-329.966] (-327.609) (-330.595) (-330.228) -- 0:00:46
311000 -- (-329.855) (-330.456) [-328.337] (-328.749) * (-329.036) (-327.687) (-330.765) [-332.865] -- 0:00:46
311500 -- (-329.095) (-329.249) [-329.165] (-329.121) * (-330.154) [-327.482] (-328.883) (-331.442) -- 0:00:46
312000 -- (-330.343) [-329.786] (-330.747) (-327.803) * [-330.083] (-329.490) (-328.988) (-328.410) -- 0:00:46
312500 -- (-330.607) (-330.933) (-332.525) [-327.767] * [-330.541] (-330.674) (-330.801) (-329.673) -- 0:00:46
313000 -- (-330.256) [-331.349] (-332.013) (-329.126) * (-330.821) (-327.973) [-328.764] (-328.591) -- 0:00:46
313500 -- (-330.575) [-331.189] (-329.042) (-330.939) * (-330.078) (-328.307) (-328.820) [-328.516] -- 0:00:45
314000 -- (-328.834) (-328.781) [-328.826] (-329.752) * (-330.508) (-328.378) (-331.987) [-328.516] -- 0:00:48
314500 -- (-330.000) (-327.849) (-330.491) [-328.015] * (-328.971) [-328.744] (-330.885) (-329.310) -- 0:00:47
315000 -- (-328.633) [-329.946] (-329.701) (-329.137) * (-329.166) (-331.339) [-329.887] (-329.663) -- 0:00:47
Average standard deviation of split frequencies: 0.011603
315500 -- (-330.601) (-328.757) [-329.709] (-329.279) * (-330.617) [-328.425] (-331.197) (-329.082) -- 0:00:47
316000 -- (-330.021) [-328.901] (-331.331) (-329.646) * [-328.279] (-331.346) (-331.339) (-328.299) -- 0:00:47
316500 -- [-328.381] (-328.411) (-330.820) (-331.470) * [-327.977] (-330.744) (-329.980) (-329.557) -- 0:00:47
317000 -- (-328.092) (-331.785) (-328.884) [-328.768] * (-327.938) [-331.137] (-327.943) (-328.905) -- 0:00:47
317500 -- (-328.728) (-332.538) (-328.465) [-329.141] * [-328.584] (-330.370) (-330.494) (-329.679) -- 0:00:47
318000 -- (-333.624) [-329.966] (-328.270) (-331.517) * (-330.010) (-330.385) [-332.082] (-331.123) -- 0:00:47
318500 -- (-329.701) (-330.040) [-329.666] (-327.997) * [-329.621] (-331.662) (-328.234) (-333.774) -- 0:00:47
319000 -- [-330.676] (-331.116) (-329.632) (-327.913) * (-330.230) [-329.209] (-329.213) (-328.170) -- 0:00:46
319500 -- (-333.328) (-328.599) (-329.574) [-328.822] * (-330.201) [-329.349] (-328.946) (-328.405) -- 0:00:46
320000 -- (-331.886) [-329.266] (-327.831) (-328.786) * [-328.800] (-330.153) (-328.347) (-330.491) -- 0:00:46
Average standard deviation of split frequencies: 0.012036
320500 -- (-331.809) (-330.224) [-328.083] (-331.750) * (-330.164) [-328.952] (-329.037) (-333.193) -- 0:00:46
321000 -- [-333.789] (-328.263) (-328.206) (-329.930) * (-327.963) (-330.504) (-329.040) [-328.441] -- 0:00:46
321500 -- (-332.438) (-329.222) [-329.254] (-328.475) * (-330.993) (-330.544) (-330.370) [-328.731] -- 0:00:46
322000 -- (-329.425) [-329.061] (-331.032) (-328.774) * (-327.753) (-327.874) [-331.956] (-333.368) -- 0:00:46
322500 -- (-331.624) (-329.724) [-329.014] (-328.526) * (-328.123) [-328.225] (-330.129) (-334.271) -- 0:00:46
323000 -- (-328.174) [-329.539] (-328.550) (-331.422) * (-329.041) (-329.166) (-332.298) [-328.494] -- 0:00:46
323500 -- (-331.683) [-329.958] (-328.335) (-329.649) * [-331.222] (-328.343) (-328.839) (-328.114) -- 0:00:46
324000 -- (-330.469) (-331.337) [-328.527] (-329.531) * [-328.532] (-329.359) (-328.651) (-331.050) -- 0:00:45
324500 -- (-328.319) (-329.485) [-329.578] (-332.113) * (-328.192) (-329.007) [-331.581] (-327.775) -- 0:00:45
325000 -- (-328.536) (-330.844) (-331.712) [-328.436] * [-330.287] (-330.264) (-332.115) (-329.495) -- 0:00:45
Average standard deviation of split frequencies: 0.011653
325500 -- (-329.179) [-330.435] (-330.310) (-328.046) * (-329.733) [-327.982] (-330.312) (-330.670) -- 0:00:45
326000 -- (-331.517) (-329.494) [-328.185] (-330.355) * [-332.962] (-328.693) (-332.066) (-329.612) -- 0:00:45
326500 -- (-331.888) (-329.307) [-328.886] (-328.466) * (-328.994) [-328.352] (-329.005) (-331.791) -- 0:00:45
327000 -- (-329.739) [-330.217] (-328.022) (-329.008) * [-327.821] (-329.670) (-328.051) (-330.193) -- 0:00:45
327500 -- (-333.580) (-328.985) (-329.712) [-329.581] * (-330.785) (-328.609) [-328.759] (-331.511) -- 0:00:45
328000 -- [-329.873] (-332.328) (-328.399) (-330.694) * (-336.690) (-328.136) (-331.206) [-330.475] -- 0:00:45
328500 -- (-329.639) (-331.456) [-333.154] (-332.011) * (-329.523) [-327.483] (-330.886) (-329.480) -- 0:00:47
329000 -- (-329.166) (-335.549) [-330.810] (-331.147) * (-331.213) [-330.418] (-335.646) (-331.198) -- 0:00:46
329500 -- (-332.516) [-331.641] (-328.137) (-329.283) * [-329.213] (-331.140) (-335.638) (-331.676) -- 0:00:46
330000 -- (-334.288) [-330.020] (-328.580) (-330.393) * [-329.644] (-328.115) (-330.056) (-333.403) -- 0:00:46
Average standard deviation of split frequencies: 0.011227
330500 -- (-329.130) [-331.264] (-338.131) (-329.604) * [-328.994] (-336.149) (-330.217) (-333.144) -- 0:00:46
331000 -- [-330.982] (-329.204) (-336.248) (-332.109) * (-329.699) (-329.476) [-330.221] (-332.123) -- 0:00:46
331500 -- [-329.391] (-328.087) (-328.992) (-331.319) * (-330.224) (-329.033) [-330.353] (-327.532) -- 0:00:46
332000 -- (-329.682) [-328.798] (-334.087) (-332.048) * (-328.667) (-330.175) [-328.884] (-330.349) -- 0:00:46
332500 -- [-328.409] (-330.217) (-330.687) (-329.812) * (-329.025) [-329.452] (-330.863) (-330.822) -- 0:00:46
333000 -- [-328.212] (-328.866) (-328.219) (-330.961) * (-330.057) [-330.561] (-332.796) (-331.771) -- 0:00:46
333500 -- [-329.235] (-329.669) (-330.798) (-328.463) * (-328.178) [-330.108] (-333.261) (-333.497) -- 0:00:45
334000 -- (-329.848) (-331.780) [-328.540] (-328.913) * [-328.376] (-329.081) (-331.948) (-331.630) -- 0:00:45
334500 -- [-332.325] (-329.174) (-327.690) (-333.134) * (-330.512) [-330.046] (-332.993) (-331.627) -- 0:00:45
335000 -- (-329.052) (-329.853) [-332.233] (-336.714) * (-327.876) [-328.690] (-330.900) (-330.655) -- 0:00:45
Average standard deviation of split frequencies: 0.010785
335500 -- (-335.178) [-331.378] (-330.070) (-331.772) * (-329.946) (-328.144) [-329.062] (-331.385) -- 0:00:45
336000 -- (-332.395) (-331.628) [-328.944] (-329.024) * (-333.430) (-329.824) (-328.701) [-327.871] -- 0:00:45
336500 -- (-335.527) [-328.861] (-329.924) (-333.237) * (-329.569) (-331.157) (-328.100) [-332.435] -- 0:00:45
337000 -- (-330.157) (-328.776) (-329.646) [-329.267] * [-328.838] (-328.707) (-327.696) (-330.841) -- 0:00:45
337500 -- (-330.445) (-329.487) [-334.023] (-328.789) * (-330.149) [-327.638] (-328.930) (-329.171) -- 0:00:45
338000 -- [-328.901] (-330.796) (-330.818) (-331.985) * (-332.420) (-327.965) [-328.748] (-330.288) -- 0:00:45
338500 -- [-328.261] (-330.200) (-330.949) (-330.520) * (-329.954) (-328.844) (-328.484) [-330.009] -- 0:00:44
339000 -- [-328.030] (-331.050) (-330.334) (-329.540) * (-330.830) [-328.337] (-332.038) (-331.440) -- 0:00:44
339500 -- [-327.470] (-328.479) (-332.730) (-328.672) * (-329.237) (-332.755) [-329.608] (-328.918) -- 0:00:44
340000 -- (-331.942) (-333.544) [-330.173] (-333.725) * (-333.055) (-329.536) [-328.849] (-330.967) -- 0:00:44
Average standard deviation of split frequencies: 0.010984
340500 -- [-330.432] (-328.961) (-331.267) (-331.912) * (-328.322) (-328.444) [-328.261] (-328.519) -- 0:00:44
341000 -- (-328.939) [-328.369] (-328.814) (-329.959) * (-331.768) (-329.438) [-328.060] (-328.434) -- 0:00:44
341500 -- [-330.384] (-328.857) (-327.718) (-332.343) * (-331.115) (-329.471) (-330.017) [-330.216] -- 0:00:44
342000 -- (-329.614) [-330.578] (-329.122) (-338.449) * (-330.934) (-329.300) [-330.510] (-331.553) -- 0:00:44
342500 -- (-328.187) (-329.895) (-331.594) [-332.520] * (-328.771) (-330.530) (-331.339) [-328.402] -- 0:00:44
343000 -- (-328.607) [-329.626] (-331.250) (-330.138) * (-332.330) (-332.122) (-331.805) [-330.602] -- 0:00:45
343500 -- (-332.359) [-330.480] (-331.831) (-329.122) * [-327.739] (-328.646) (-330.328) (-330.609) -- 0:00:45
344000 -- [-328.139] (-333.101) (-328.194) (-328.282) * (-328.757) (-328.900) [-330.876] (-328.623) -- 0:00:45
344500 -- (-334.849) [-328.669] (-333.587) (-328.258) * [-328.142] (-329.050) (-328.433) (-327.865) -- 0:00:45
345000 -- (-329.666) (-330.050) (-330.261) [-331.277] * (-328.926) (-327.874) (-329.421) [-328.111] -- 0:00:45
Average standard deviation of split frequencies: 0.010499
345500 -- (-329.251) (-329.248) [-330.020] (-331.217) * [-329.546] (-331.498) (-331.854) (-329.965) -- 0:00:45
346000 -- (-328.439) (-329.198) [-334.088] (-328.725) * (-329.163) (-329.472) [-328.980] (-330.565) -- 0:00:45
346500 -- (-329.752) (-332.067) [-329.258] (-329.736) * [-329.005] (-327.627) (-328.590) (-328.816) -- 0:00:45
347000 -- (-328.757) (-329.452) [-329.270] (-331.731) * (-330.140) [-327.893] (-333.170) (-332.037) -- 0:00:45
347500 -- (-330.156) (-332.478) [-330.161] (-329.236) * (-332.688) [-331.260] (-329.559) (-330.576) -- 0:00:45
348000 -- (-329.226) (-332.243) [-332.796] (-329.180) * (-330.809) [-331.205] (-327.937) (-329.653) -- 0:00:44
348500 -- (-328.372) (-330.620) [-329.184] (-332.624) * (-328.372) (-329.962) (-332.159) [-331.188] -- 0:00:44
349000 -- [-330.122] (-330.325) (-334.309) (-334.559) * (-329.540) (-328.573) (-332.691) [-330.183] -- 0:00:44
349500 -- (-331.950) (-334.702) (-330.011) [-329.900] * (-331.416) (-328.002) [-327.988] (-331.149) -- 0:00:44
350000 -- (-329.639) [-329.533] (-329.127) (-329.283) * (-330.596) [-329.197] (-329.289) (-329.982) -- 0:00:44
Average standard deviation of split frequencies: 0.010834
350500 -- (-329.956) [-328.457] (-327.611) (-330.150) * [-328.923] (-330.396) (-333.104) (-328.706) -- 0:00:44
351000 -- (-328.560) (-329.818) (-330.980) [-329.687] * (-328.160) (-329.799) (-329.552) [-329.131] -- 0:00:44
351500 -- (-329.343) (-328.100) [-328.027] (-330.208) * [-333.459] (-332.718) (-330.225) (-328.837) -- 0:00:44
352000 -- (-327.751) (-328.610) (-330.512) [-328.764] * [-331.972] (-329.457) (-328.131) (-333.061) -- 0:00:44
352500 -- (-330.762) (-334.680) (-333.049) [-328.245] * (-329.799) (-335.004) (-330.319) [-330.337] -- 0:00:44
353000 -- (-328.276) (-329.681) [-330.433] (-328.524) * (-331.383) (-329.366) [-329.048] (-327.952) -- 0:00:43
353500 -- (-331.275) (-330.466) [-328.459] (-328.643) * [-332.211] (-331.042) (-329.973) (-327.540) -- 0:00:43
354000 -- (-332.389) (-330.702) [-330.613] (-328.779) * (-331.347) (-333.710) (-330.861) [-328.142] -- 0:00:43
354500 -- (-331.601) (-334.413) [-327.710] (-330.950) * (-328.426) (-331.344) (-330.760) [-328.341] -- 0:00:43
355000 -- (-333.821) [-328.355] (-329.627) (-329.547) * [-329.315] (-331.472) (-332.776) (-327.689) -- 0:00:43
Average standard deviation of split frequencies: 0.010180
355500 -- [-333.379] (-330.339) (-330.470) (-330.749) * [-328.433] (-329.788) (-330.989) (-330.531) -- 0:00:43
356000 -- (-331.925) [-330.030] (-330.703) (-328.927) * (-332.096) (-334.531) [-327.709] (-331.631) -- 0:00:43
356500 -- (-329.535) [-330.458] (-329.650) (-332.827) * (-328.002) [-330.313] (-333.489) (-334.627) -- 0:00:43
357000 -- (-328.196) (-330.848) [-336.416] (-331.356) * (-331.934) [-329.542] (-335.370) (-331.342) -- 0:00:43
357500 -- (-333.154) (-328.202) (-331.298) [-329.200] * [-329.766] (-328.631) (-330.205) (-335.644) -- 0:00:44
358000 -- [-330.759] (-328.596) (-332.934) (-328.747) * (-330.272) (-328.080) (-330.275) [-328.156] -- 0:00:44
358500 -- [-331.234] (-330.363) (-332.078) (-327.607) * (-332.820) [-328.035] (-333.674) (-330.617) -- 0:00:44
359000 -- (-328.830) (-331.293) (-330.574) [-330.559] * (-331.973) (-328.781) (-328.271) [-329.964] -- 0:00:44
359500 -- (-330.577) (-327.959) (-333.264) [-329.019] * (-330.162) (-327.608) [-329.614] (-328.229) -- 0:00:44
360000 -- (-330.526) (-329.397) (-333.462) [-330.827] * (-328.904) [-327.657] (-329.900) (-330.660) -- 0:00:44
Average standard deviation of split frequencies: 0.009721
360500 -- (-331.226) (-333.023) [-331.949] (-329.814) * [-328.571] (-329.121) (-328.892) (-330.889) -- 0:00:44
361000 -- (-328.118) [-328.873] (-328.961) (-330.498) * (-330.319) (-329.926) [-328.603] (-330.249) -- 0:00:44
361500 -- (-328.783) (-330.753) [-328.263] (-328.875) * (-330.981) (-329.303) [-329.036] (-329.225) -- 0:00:44
362000 -- [-328.072] (-336.191) (-330.307) (-330.182) * (-329.491) [-328.526] (-329.236) (-331.466) -- 0:00:44
362500 -- (-332.840) (-334.043) [-329.976] (-328.801) * (-330.457) [-328.868] (-332.439) (-331.422) -- 0:00:43
363000 -- (-329.299) (-330.445) (-333.975) [-331.753] * (-327.764) [-330.858] (-329.865) (-329.100) -- 0:00:43
363500 -- (-331.427) (-329.584) [-328.603] (-329.493) * (-329.177) (-331.292) [-329.210] (-332.348) -- 0:00:43
364000 -- [-329.250] (-336.406) (-329.163) (-328.413) * (-328.332) (-334.019) (-328.006) [-329.792] -- 0:00:43
364500 -- (-328.424) (-329.399) [-330.434] (-329.462) * (-327.844) [-331.575] (-332.136) (-328.199) -- 0:00:43
365000 -- (-328.914) (-328.536) [-330.985] (-330.260) * [-328.530] (-329.351) (-331.737) (-328.792) -- 0:00:43
Average standard deviation of split frequencies: 0.009901
365500 -- (-327.778) (-330.341) (-328.307) [-334.241] * (-328.662) (-330.074) (-329.271) [-327.960] -- 0:00:43
366000 -- [-328.605] (-329.280) (-329.393) (-336.843) * (-328.849) (-327.865) (-330.331) [-329.904] -- 0:00:43
366500 -- (-327.772) (-330.169) [-330.572] (-331.963) * (-328.011) (-329.849) (-328.351) [-329.189] -- 0:00:43
367000 -- (-328.838) (-328.330) [-331.353] (-328.032) * (-328.865) (-328.406) [-328.643] (-329.246) -- 0:00:43
367500 -- (-330.918) [-332.683] (-332.307) (-329.912) * (-329.115) (-330.533) [-330.153] (-329.443) -- 0:00:43
368000 -- (-332.389) [-331.623] (-333.857) (-329.155) * (-327.866) [-329.836] (-328.815) (-331.780) -- 0:00:42
368500 -- (-334.684) (-331.209) (-329.933) [-331.332] * (-329.006) [-330.778] (-328.644) (-329.071) -- 0:00:42
369000 -- (-333.431) (-329.292) [-328.563] (-330.233) * (-329.785) (-328.975) (-329.815) [-327.892] -- 0:00:42
369500 -- (-329.188) (-332.633) (-330.345) [-329.246] * (-331.300) [-330.921] (-335.939) (-327.437) -- 0:00:42
370000 -- [-330.084] (-329.620) (-330.168) (-329.642) * (-329.145) (-328.208) (-332.558) [-328.342] -- 0:00:42
Average standard deviation of split frequencies: 0.009697
370500 -- [-329.285] (-330.614) (-328.279) (-328.630) * (-334.513) [-328.480] (-328.308) (-328.031) -- 0:00:42
371000 -- (-330.129) (-328.287) [-328.997] (-328.663) * [-331.542] (-329.675) (-329.386) (-328.256) -- 0:00:42
371500 -- (-328.948) [-328.894] (-328.251) (-330.354) * (-329.463) [-329.287] (-330.205) (-330.065) -- 0:00:42
372000 -- (-334.075) [-329.348] (-330.211) (-329.017) * (-331.794) [-330.255] (-335.605) (-329.233) -- 0:00:43
372500 -- [-330.232] (-330.346) (-329.277) (-328.654) * (-330.076) [-329.971] (-331.055) (-329.678) -- 0:00:43
373000 -- [-328.321] (-330.897) (-329.858) (-328.535) * (-330.336) (-330.861) [-330.355] (-333.249) -- 0:00:43
373500 -- (-328.744) (-329.238) [-329.676] (-330.427) * [-328.705] (-331.909) (-331.813) (-328.986) -- 0:00:43
374000 -- (-330.011) (-328.970) [-329.573] (-334.846) * (-329.096) (-329.631) (-330.929) [-328.498] -- 0:00:43
374500 -- (-332.997) (-332.584) (-327.894) [-331.705] * [-330.555] (-329.488) (-327.716) (-329.213) -- 0:00:43
375000 -- [-330.398] (-330.443) (-331.711) (-330.569) * (-328.768) (-329.213) [-327.704] (-330.643) -- 0:00:43
Average standard deviation of split frequencies: 0.009011
375500 -- (-331.813) [-328.799] (-330.557) (-332.117) * (-329.285) (-329.779) [-331.722] (-328.539) -- 0:00:43
376000 -- (-331.250) [-330.764] (-330.978) (-330.229) * [-330.568] (-328.366) (-333.878) (-328.672) -- 0:00:43
376500 -- (-330.107) [-332.544] (-328.694) (-329.181) * (-329.255) (-328.777) (-329.124) [-331.218] -- 0:00:43
377000 -- (-327.697) (-331.162) [-328.717] (-328.593) * (-328.422) [-329.043] (-330.685) (-331.493) -- 0:00:42
377500 -- (-329.487) [-330.103] (-328.642) (-330.061) * [-330.723] (-328.779) (-332.348) (-329.098) -- 0:00:42
378000 -- [-328.054] (-328.038) (-330.656) (-328.592) * (-328.159) [-328.983] (-328.825) (-328.760) -- 0:00:42
378500 -- [-328.954] (-330.418) (-329.991) (-329.190) * [-328.427] (-330.367) (-330.256) (-330.799) -- 0:00:42
379000 -- (-331.319) (-328.064) [-328.812] (-334.649) * [-329.769] (-329.968) (-333.917) (-330.634) -- 0:00:42
379500 -- (-329.984) (-330.321) (-327.896) [-327.943] * (-328.117) (-330.466) (-332.422) [-328.481] -- 0:00:42
380000 -- (-333.875) (-332.447) (-331.621) [-328.732] * [-329.241] (-328.403) (-330.759) (-329.549) -- 0:00:42
Average standard deviation of split frequencies: 0.010139
380500 -- [-332.836] (-329.423) (-331.469) (-330.974) * (-329.284) [-329.786] (-328.687) (-328.247) -- 0:00:42
381000 -- (-329.763) [-330.458] (-328.993) (-327.689) * (-331.578) (-329.668) [-330.468] (-328.974) -- 0:00:42
381500 -- (-328.832) (-330.590) (-331.126) [-330.612] * (-329.543) [-329.487] (-327.819) (-328.993) -- 0:00:42
382000 -- (-328.953) (-330.617) (-329.051) [-328.897] * (-329.770) (-330.943) (-329.777) [-330.700] -- 0:00:42
382500 -- (-327.496) [-329.346] (-328.310) (-328.773) * (-328.542) [-330.451] (-336.532) (-333.680) -- 0:00:41
383000 -- (-330.349) (-331.662) (-331.379) [-329.364] * (-332.464) (-331.240) (-331.379) [-332.732] -- 0:00:41
383500 -- (-330.452) [-332.764] (-329.171) (-330.043) * (-330.965) (-329.670) [-329.462] (-332.723) -- 0:00:41
384000 -- [-328.455] (-329.704) (-329.567) (-333.395) * [-328.859] (-331.971) (-329.307) (-333.507) -- 0:00:41
384500 -- (-329.680) (-330.035) [-328.780] (-331.195) * (-330.325) [-329.628] (-329.953) (-330.850) -- 0:00:41
385000 -- (-331.012) [-327.919] (-330.781) (-331.606) * (-329.573) (-329.246) [-328.711] (-331.304) -- 0:00:41
Average standard deviation of split frequencies: 0.010228
385500 -- (-328.242) (-329.956) (-330.623) [-331.961] * (-330.031) (-330.122) [-328.520] (-331.473) -- 0:00:41
386000 -- (-328.293) (-331.340) [-328.390] (-328.396) * (-330.807) (-328.730) (-328.176) [-328.376] -- 0:00:41
386500 -- (-330.044) (-331.984) (-329.130) [-328.309] * (-329.440) (-332.452) [-332.367] (-329.798) -- 0:00:42
387000 -- (-328.697) (-328.843) [-329.799] (-328.629) * [-328.190] (-331.035) (-333.069) (-330.357) -- 0:00:42
387500 -- (-332.602) (-330.651) (-329.371) [-329.621] * [-330.719] (-332.744) (-333.364) (-329.285) -- 0:00:42
388000 -- (-330.078) (-330.587) (-329.249) [-328.044] * [-329.886] (-330.169) (-331.720) (-328.044) -- 0:00:42
388500 -- (-331.223) (-329.051) (-328.616) [-327.550] * [-329.511] (-332.071) (-328.702) (-328.308) -- 0:00:42
389000 -- (-329.971) (-328.021) (-333.526) [-329.601] * (-329.332) (-330.816) [-327.986] (-329.650) -- 0:00:42
389500 -- (-332.228) [-328.039] (-331.233) (-328.731) * (-331.151) (-328.583) (-331.147) [-332.592] -- 0:00:42
390000 -- (-330.257) [-327.792] (-329.656) (-329.840) * (-330.216) (-328.206) [-330.396] (-332.340) -- 0:00:42
Average standard deviation of split frequencies: 0.010408
390500 -- (-330.709) (-330.675) (-328.111) [-330.877] * (-331.750) (-327.925) [-329.548] (-336.879) -- 0:00:42
391000 -- [-328.354] (-329.751) (-328.787) (-328.930) * (-333.620) (-327.432) (-328.311) [-327.997] -- 0:00:42
391500 -- (-329.356) (-333.401) [-327.805] (-330.377) * (-331.376) (-331.087) [-328.571] (-329.469) -- 0:00:41
392000 -- (-328.770) [-328.807] (-330.707) (-329.849) * (-328.043) (-327.600) (-332.792) [-328.419] -- 0:00:41
392500 -- [-329.247] (-328.532) (-335.938) (-330.804) * (-329.587) (-328.001) [-328.004] (-333.956) -- 0:00:41
393000 -- (-331.559) (-330.007) (-329.647) [-328.317] * (-331.694) (-330.658) [-329.747] (-328.956) -- 0:00:41
393500 -- (-332.262) (-329.072) [-329.177] (-331.433) * (-330.785) (-334.840) (-329.013) [-328.817] -- 0:00:41
394000 -- (-330.672) (-330.296) [-331.741] (-330.824) * [-330.402] (-336.141) (-329.829) (-328.472) -- 0:00:41
394500 -- (-327.892) [-328.176] (-330.413) (-330.330) * (-333.954) (-330.028) (-329.122) [-331.354] -- 0:00:41
395000 -- (-330.066) [-328.401] (-330.329) (-328.189) * (-333.212) (-329.593) (-331.351) [-331.653] -- 0:00:41
Average standard deviation of split frequencies: 0.010491
395500 -- (-328.882) (-334.961) [-328.157] (-333.057) * (-333.464) (-334.168) (-330.915) [-328.855] -- 0:00:41
396000 -- (-329.782) (-329.357) (-330.757) [-331.162] * (-335.593) [-329.457] (-331.403) (-328.656) -- 0:00:41
396500 -- [-334.867] (-329.626) (-328.905) (-329.723) * [-331.703] (-329.476) (-331.707) (-328.299) -- 0:00:41
397000 -- (-330.523) [-327.805] (-331.031) (-331.187) * (-332.911) [-328.533] (-331.248) (-329.249) -- 0:00:41
397500 -- (-331.819) (-327.978) (-331.581) [-328.202] * (-332.123) [-332.659] (-329.015) (-327.698) -- 0:00:40
398000 -- (-331.708) [-328.345] (-329.439) (-329.710) * (-331.861) [-332.302] (-331.083) (-328.121) -- 0:00:40
398500 -- (-330.588) (-329.781) [-330.580] (-329.289) * (-329.925) (-332.022) [-332.361] (-333.785) -- 0:00:40
399000 -- [-329.004] (-329.338) (-330.303) (-329.155) * [-330.776] (-330.048) (-329.799) (-328.811) -- 0:00:40
399500 -- [-328.686] (-334.854) (-329.235) (-329.320) * [-329.376] (-327.704) (-328.273) (-332.408) -- 0:00:40
400000 -- (-333.399) (-336.819) (-333.176) [-328.265] * (-332.325) (-330.218) [-329.591] (-330.697) -- 0:00:40
Average standard deviation of split frequencies: 0.010736
400500 -- (-329.159) (-336.187) (-329.774) [-329.999] * (-333.510) (-339.917) (-333.003) [-333.274] -- 0:00:40
401000 -- [-328.484] (-330.641) (-331.098) (-329.854) * (-335.212) [-335.110] (-335.362) (-328.736) -- 0:00:41
401500 -- (-330.788) (-328.757) [-330.088] (-328.174) * [-329.949] (-331.445) (-332.757) (-330.141) -- 0:00:41
402000 -- [-328.391] (-327.939) (-329.752) (-328.757) * (-329.970) (-330.232) (-335.364) [-329.684] -- 0:00:41
402500 -- (-328.792) [-329.756] (-331.210) (-327.808) * (-331.894) [-330.723] (-329.075) (-328.932) -- 0:00:41
403000 -- (-329.147) (-329.946) (-328.537) [-329.918] * (-333.164) [-328.805] (-328.424) (-330.369) -- 0:00:41
403500 -- (-332.482) [-327.631] (-329.931) (-329.924) * (-329.153) [-329.724] (-328.883) (-330.114) -- 0:00:41
404000 -- (-330.072) [-330.669] (-327.457) (-330.073) * (-331.566) [-332.467] (-328.274) (-329.033) -- 0:00:41
404500 -- (-329.087) [-329.723] (-328.424) (-330.571) * (-331.088) (-327.999) (-329.855) [-327.471] -- 0:00:41
405000 -- (-327.497) (-330.531) [-328.454] (-332.900) * (-332.495) (-330.442) (-329.602) [-328.098] -- 0:00:41
Average standard deviation of split frequencies: 0.010668
405500 -- (-331.961) (-329.137) [-331.933] (-330.807) * (-329.837) (-329.706) (-330.002) [-328.749] -- 0:00:41
406000 -- (-330.965) [-329.732] (-329.557) (-328.700) * (-328.251) (-331.146) (-328.988) [-327.612] -- 0:00:40
406500 -- (-328.060) (-328.199) [-328.167] (-332.287) * (-329.340) (-333.876) (-329.022) [-328.725] -- 0:00:40
407000 -- (-329.847) [-328.054] (-330.412) (-332.077) * (-330.336) [-330.007] (-330.263) (-331.887) -- 0:00:40
407500 -- (-330.485) [-328.109] (-328.238) (-330.138) * (-330.463) (-328.893) (-332.807) [-328.125] -- 0:00:40
408000 -- (-333.031) [-328.598] (-328.258) (-329.882) * [-331.195] (-330.749) (-329.121) (-330.635) -- 0:00:40
408500 -- [-328.598] (-328.166) (-328.310) (-328.555) * (-329.186) (-333.455) [-329.564] (-328.733) -- 0:00:40
409000 -- (-327.475) [-335.759] (-329.292) (-333.399) * (-331.038) (-334.342) [-331.360] (-328.267) -- 0:00:40
409500 -- (-331.001) (-329.250) [-329.795] (-333.991) * (-331.991) (-331.479) (-328.646) [-331.902] -- 0:00:40
410000 -- (-331.687) (-330.768) (-328.303) [-330.548] * (-328.567) (-327.855) (-328.238) [-331.517] -- 0:00:40
Average standard deviation of split frequencies: 0.010188
410500 -- (-328.616) [-330.511] (-329.076) (-329.127) * [-330.692] (-328.687) (-334.907) (-333.624) -- 0:00:40
411000 -- (-333.950) [-330.351] (-328.029) (-328.157) * [-328.621] (-328.353) (-334.014) (-330.738) -- 0:00:40
411500 -- (-335.737) [-328.904] (-330.048) (-328.526) * (-329.966) (-328.843) [-332.324] (-331.084) -- 0:00:40
412000 -- (-328.871) (-328.639) (-330.787) [-328.715] * (-331.015) (-327.897) [-332.070] (-329.917) -- 0:00:39
412500 -- (-328.229) [-327.867] (-327.927) (-328.191) * (-329.431) (-329.946) (-332.190) [-327.883] -- 0:00:39
413000 -- [-328.855] (-332.200) (-332.672) (-330.457) * (-328.402) (-328.208) (-331.374) [-328.589] -- 0:00:39
413500 -- (-329.316) [-328.729] (-333.190) (-329.540) * [-328.308] (-329.293) (-331.013) (-329.270) -- 0:00:39
414000 -- (-330.729) (-330.221) (-328.525) [-329.480] * [-329.959] (-331.218) (-330.355) (-330.785) -- 0:00:39
414500 -- (-332.895) (-331.421) (-330.265) [-328.611] * (-328.552) (-330.206) (-327.388) [-329.336] -- 0:00:39
415000 -- [-330.447] (-330.872) (-330.642) (-329.326) * (-327.959) (-328.968) (-329.825) [-329.220] -- 0:00:39
Average standard deviation of split frequencies: 0.010057
415500 -- (-328.424) [-331.218] (-331.586) (-335.723) * (-329.706) [-329.206] (-329.398) (-330.730) -- 0:00:40
416000 -- [-327.810] (-329.724) (-329.437) (-333.282) * (-332.232) [-330.398] (-329.211) (-328.471) -- 0:00:40
416500 -- (-329.611) (-328.513) [-331.095] (-327.953) * (-329.472) (-330.347) (-330.282) [-328.015] -- 0:00:40
417000 -- (-329.991) [-330.233] (-334.500) (-329.134) * (-330.108) [-329.965] (-328.624) (-328.640) -- 0:00:40
417500 -- (-330.932) (-333.193) (-329.525) [-327.974] * (-332.127) [-329.787] (-329.307) (-331.455) -- 0:00:40
418000 -- (-330.929) (-329.488) [-330.460] (-328.062) * [-328.192] (-327.921) (-330.466) (-333.315) -- 0:00:40
418500 -- (-328.119) (-331.521) [-329.595] (-329.421) * (-327.694) [-330.005] (-329.994) (-329.828) -- 0:00:40
419000 -- (-328.721) [-328.686] (-333.072) (-329.186) * (-332.875) [-329.584] (-329.603) (-332.861) -- 0:00:40
419500 -- (-333.838) [-328.388] (-328.595) (-334.062) * (-331.817) [-330.931] (-334.472) (-330.888) -- 0:00:40
420000 -- (-330.314) (-328.165) [-329.044] (-329.811) * [-328.233] (-333.284) (-327.528) (-329.949) -- 0:00:40
Average standard deviation of split frequencies: 0.009595
420500 -- [-334.273] (-330.262) (-332.214) (-328.779) * (-331.662) [-332.001] (-329.946) (-328.471) -- 0:00:39
421000 -- [-330.197] (-331.477) (-332.246) (-329.736) * [-331.158] (-328.999) (-330.721) (-329.561) -- 0:00:39
421500 -- (-338.072) (-329.838) [-330.432] (-328.917) * (-330.306) [-329.297] (-328.761) (-330.764) -- 0:00:39
422000 -- (-334.312) (-328.693) (-330.287) [-329.442] * (-327.910) (-328.844) (-329.169) [-328.300] -- 0:00:39
422500 -- (-329.026) (-329.700) [-329.003] (-330.858) * (-328.821) [-327.770] (-329.135) (-331.887) -- 0:00:39
423000 -- (-330.126) [-328.669] (-328.803) (-331.231) * [-328.452] (-328.085) (-329.975) (-329.960) -- 0:00:39
423500 -- [-330.149] (-327.759) (-331.998) (-329.718) * (-328.667) (-329.271) (-328.366) [-330.039] -- 0:00:39
424000 -- (-332.216) (-327.917) (-330.135) [-328.283] * (-328.249) (-331.063) [-329.052] (-328.180) -- 0:00:39
424500 -- (-328.510) [-329.829] (-331.171) (-328.867) * [-330.315] (-329.820) (-328.341) (-331.187) -- 0:00:39
425000 -- (-328.364) [-328.798] (-330.492) (-331.342) * (-330.140) (-328.740) [-329.163] (-329.586) -- 0:00:39
Average standard deviation of split frequencies: 0.010028
425500 -- [-329.753] (-328.469) (-330.352) (-329.541) * (-332.399) (-332.880) (-327.500) [-328.130] -- 0:00:39
426000 -- [-330.916] (-328.994) (-330.163) (-335.443) * (-331.999) (-329.396) [-330.426] (-331.019) -- 0:00:39
426500 -- (-329.503) (-328.886) (-329.432) [-331.614] * (-335.326) (-329.968) (-333.977) [-332.176] -- 0:00:38
427000 -- (-328.258) [-329.723] (-329.343) (-331.641) * [-329.713] (-328.555) (-328.390) (-330.257) -- 0:00:38
427500 -- (-329.647) [-328.236] (-331.297) (-329.880) * (-332.610) [-329.282] (-327.563) (-330.637) -- 0:00:38
428000 -- (-329.957) [-328.913] (-328.602) (-328.321) * (-334.283) (-331.925) [-327.935] (-328.704) -- 0:00:38
428500 -- (-328.267) [-328.394] (-329.127) (-331.340) * [-332.814] (-328.255) (-329.322) (-329.107) -- 0:00:38
429000 -- (-329.807) (-328.875) [-329.072] (-328.687) * (-330.263) (-329.911) [-329.273] (-331.972) -- 0:00:38
429500 -- (-328.695) (-327.915) [-328.934] (-330.077) * (-328.028) (-330.687) [-329.394] (-331.009) -- 0:00:38
430000 -- (-329.112) (-328.946) (-328.276) [-330.730] * (-332.379) (-334.557) [-328.667] (-329.730) -- 0:00:39
Average standard deviation of split frequencies: 0.009920
430500 -- (-330.761) (-328.919) [-328.419] (-331.024) * (-330.606) (-329.788) (-331.393) [-329.780] -- 0:00:39
431000 -- (-331.785) (-330.094) [-328.504] (-330.029) * [-330.294] (-328.837) (-329.995) (-329.538) -- 0:00:39
431500 -- (-336.123) (-328.417) (-330.073) [-328.704] * (-329.108) (-328.847) [-329.007] (-328.829) -- 0:00:39
432000 -- (-330.538) (-330.575) (-331.504) [-330.918] * (-328.396) [-328.786] (-328.580) (-329.272) -- 0:00:39
432500 -- [-327.915] (-328.329) (-329.127) (-330.927) * (-330.762) (-329.480) [-328.328] (-327.753) -- 0:00:39
433000 -- [-329.959] (-329.643) (-330.538) (-330.482) * (-330.503) [-328.445] (-327.698) (-331.572) -- 0:00:39
433500 -- [-329.056] (-331.740) (-330.030) (-330.320) * [-331.307] (-330.579) (-330.637) (-328.747) -- 0:00:39
434000 -- (-328.303) (-332.048) [-329.175] (-329.598) * (-332.334) (-330.876) (-331.396) [-328.428] -- 0:00:39
434500 -- (-332.610) (-328.321) [-332.548] (-329.068) * (-328.578) (-329.960) (-331.231) [-332.219] -- 0:00:39
435000 -- [-334.343] (-330.182) (-329.487) (-330.874) * (-327.596) [-327.910] (-329.391) (-328.709) -- 0:00:38
Average standard deviation of split frequencies: 0.009325
435500 -- (-335.162) (-328.662) [-327.765] (-333.061) * (-328.231) (-334.046) (-328.752) [-329.625] -- 0:00:38
436000 -- [-328.195] (-335.274) (-329.623) (-331.258) * (-329.242) [-332.131] (-330.472) (-329.059) -- 0:00:38
436500 -- [-331.381] (-328.624) (-330.220) (-329.717) * (-332.534) (-328.579) (-329.140) [-330.661] -- 0:00:38
437000 -- [-331.265] (-329.949) (-330.139) (-332.261) * (-331.946) [-331.845] (-328.732) (-333.057) -- 0:00:38
437500 -- (-333.620) [-330.208] (-330.782) (-329.965) * (-329.827) [-331.297] (-328.723) (-329.528) -- 0:00:38
438000 -- (-330.723) [-331.483] (-328.141) (-334.051) * [-331.140] (-331.605) (-330.226) (-333.158) -- 0:00:38
438500 -- (-330.014) [-328.520] (-330.203) (-329.521) * (-331.812) (-327.719) [-329.394] (-334.639) -- 0:00:38
439000 -- (-329.443) [-329.266] (-329.494) (-331.245) * [-331.114] (-328.968) (-328.000) (-329.778) -- 0:00:38
439500 -- (-328.964) (-327.904) [-330.051] (-333.419) * (-328.603) (-329.795) [-328.293] (-333.956) -- 0:00:38
440000 -- (-328.523) (-332.735) [-328.716] (-331.914) * (-332.676) [-328.027] (-329.861) (-329.571) -- 0:00:38
Average standard deviation of split frequencies: 0.009427
440500 -- (-332.836) (-333.297) [-328.165] (-330.474) * [-329.972] (-329.111) (-328.150) (-329.339) -- 0:00:38
441000 -- (-328.323) (-333.513) [-328.372] (-330.816) * (-330.593) [-329.317] (-330.608) (-330.748) -- 0:00:38
441500 -- (-327.789) (-335.822) (-331.270) [-329.086] * (-329.767) (-334.672) (-330.795) [-331.285] -- 0:00:37
442000 -- (-332.354) (-328.931) (-330.544) [-329.341] * (-328.793) (-330.904) (-330.259) [-329.153] -- 0:00:37
442500 -- (-329.910) (-330.137) (-329.752) [-330.103] * (-332.278) (-329.130) [-330.782] (-330.561) -- 0:00:37
443000 -- [-329.558] (-329.630) (-332.897) (-327.487) * (-328.917) [-328.192] (-329.610) (-333.930) -- 0:00:37
443500 -- (-331.835) [-329.315] (-332.708) (-328.768) * (-330.314) (-328.410) (-328.333) [-333.733] -- 0:00:37
444000 -- (-328.570) (-329.726) (-329.052) [-328.036] * (-328.183) [-329.037] (-329.644) (-331.457) -- 0:00:37
444500 -- [-328.364] (-331.990) (-331.497) (-331.295) * (-331.961) [-329.131] (-329.018) (-333.065) -- 0:00:37
445000 -- [-331.585] (-329.690) (-330.196) (-333.426) * [-330.143] (-328.841) (-335.119) (-332.710) -- 0:00:38
Average standard deviation of split frequencies: 0.009050
445500 -- (-338.870) [-328.096] (-329.376) (-328.026) * (-328.975) (-327.991) [-328.245] (-328.249) -- 0:00:38
446000 -- (-336.211) (-328.225) (-330.415) [-330.082] * (-331.111) [-328.594] (-330.002) (-329.362) -- 0:00:38
446500 -- (-331.968) (-328.122) [-328.733] (-328.810) * (-336.357) (-330.080) [-327.947] (-330.731) -- 0:00:38
447000 -- (-330.717) (-328.989) [-329.475] (-329.383) * (-333.993) (-329.108) (-329.717) [-329.590] -- 0:00:38
447500 -- (-332.214) (-330.680) [-330.632] (-329.550) * [-331.350] (-328.745) (-328.455) (-331.753) -- 0:00:38
448000 -- (-328.288) (-329.464) (-327.827) [-330.074] * (-330.719) (-328.803) [-331.708] (-331.096) -- 0:00:38
448500 -- (-330.783) (-330.436) (-329.394) [-328.762] * (-332.935) (-331.094) [-331.142] (-328.050) -- 0:00:38
449000 -- (-328.370) (-330.249) [-328.724] (-330.117) * [-335.587] (-331.305) (-329.073) (-330.095) -- 0:00:38
449500 -- (-328.266) (-330.208) (-328.733) [-328.540] * (-329.740) (-328.944) (-329.778) [-328.728] -- 0:00:37
450000 -- [-329.859] (-332.894) (-331.072) (-331.817) * (-329.375) [-330.410] (-330.035) (-330.254) -- 0:00:37
Average standard deviation of split frequencies: 0.009414
450500 -- [-330.205] (-329.526) (-328.558) (-333.276) * (-328.452) (-331.460) [-328.118] (-330.161) -- 0:00:37
451000 -- [-328.366] (-330.653) (-328.979) (-332.965) * [-328.722] (-330.368) (-329.749) (-329.238) -- 0:00:37
451500 -- [-327.621] (-332.588) (-328.749) (-333.140) * (-328.914) [-328.530] (-332.539) (-328.404) -- 0:00:37
452000 -- (-328.458) (-329.685) [-328.346] (-330.794) * (-328.433) (-330.304) [-327.888] (-328.118) -- 0:00:37
452500 -- [-329.491] (-328.950) (-328.510) (-331.380) * (-329.885) (-332.675) [-328.056] (-328.514) -- 0:00:37
453000 -- [-329.285] (-333.089) (-328.334) (-329.563) * (-331.163) (-328.806) (-328.687) [-329.060] -- 0:00:37
453500 -- (-332.404) [-329.832] (-330.008) (-328.204) * [-327.697] (-330.524) (-332.777) (-329.537) -- 0:00:37
454000 -- [-328.030] (-332.435) (-328.439) (-328.734) * (-331.051) [-335.737] (-329.103) (-332.480) -- 0:00:37
454500 -- (-330.231) (-329.548) [-329.158] (-328.262) * (-329.315) (-338.319) [-329.869] (-329.472) -- 0:00:37
455000 -- (-329.339) (-329.812) [-332.868] (-330.433) * [-328.771] (-330.860) (-328.511) (-329.271) -- 0:00:37
Average standard deviation of split frequencies: 0.009046
455500 -- [-329.228] (-327.719) (-329.121) (-333.963) * (-331.145) (-329.450) (-330.611) [-329.309] -- 0:00:37
456000 -- [-329.292] (-336.628) (-330.276) (-332.458) * (-328.477) [-328.302] (-328.078) (-330.917) -- 0:00:36
456500 -- [-330.104] (-330.981) (-333.196) (-332.845) * (-328.107) [-327.742] (-332.110) (-329.747) -- 0:00:36
457000 -- (-330.095) [-334.637] (-329.040) (-330.636) * [-327.845] (-330.510) (-333.616) (-327.967) -- 0:00:36
457500 -- [-328.389] (-330.090) (-330.584) (-328.913) * (-328.363) (-328.254) (-331.396) [-331.029] -- 0:00:36
458000 -- (-331.032) (-331.780) [-327.998] (-331.084) * (-329.031) (-328.176) (-331.424) [-330.134] -- 0:00:36
458500 -- [-333.315] (-334.542) (-328.026) (-330.040) * (-334.620) (-329.396) [-329.651] (-329.003) -- 0:00:36
459000 -- (-330.128) [-329.674] (-329.130) (-330.426) * (-330.266) (-328.567) (-329.466) [-328.134] -- 0:00:36
459500 -- (-330.707) [-331.263] (-329.412) (-328.814) * [-331.025] (-332.135) (-330.395) (-331.871) -- 0:00:37
460000 -- (-329.393) (-330.459) (-329.445) [-328.256] * (-331.690) [-329.478] (-332.055) (-328.865) -- 0:00:37
Average standard deviation of split frequencies: 0.009402
460500 -- (-328.771) [-329.325] (-329.234) (-329.919) * (-330.342) [-334.835] (-333.921) (-328.651) -- 0:00:37
461000 -- (-328.487) [-329.111] (-328.332) (-333.674) * (-328.193) (-328.766) (-331.431) [-330.450] -- 0:00:37
461500 -- (-331.860) [-327.766] (-328.352) (-328.534) * (-328.998) [-328.857] (-328.202) (-337.944) -- 0:00:37
462000 -- (-330.835) (-331.146) (-327.698) [-328.875] * [-328.567] (-332.315) (-328.202) (-332.694) -- 0:00:37
462500 -- (-331.251) [-330.238] (-328.171) (-328.234) * (-330.139) [-329.558] (-329.101) (-337.700) -- 0:00:37
463000 -- (-331.043) (-329.863) [-330.604] (-328.489) * (-328.977) (-328.048) [-329.084] (-329.265) -- 0:00:37
463500 -- (-330.962) (-329.910) [-333.315] (-327.803) * (-330.265) (-329.297) (-330.429) [-329.498] -- 0:00:37
464000 -- (-328.711) (-328.008) [-329.794] (-327.559) * (-328.672) [-329.250] (-331.842) (-329.007) -- 0:00:36
464500 -- (-328.862) (-330.701) [-330.268] (-328.808) * (-328.769) (-331.426) (-329.020) [-331.394] -- 0:00:36
465000 -- (-329.280) (-330.465) [-328.101] (-328.840) * (-331.167) (-331.142) [-328.025] (-334.955) -- 0:00:36
Average standard deviation of split frequencies: 0.009547
465500 -- (-330.171) (-328.488) (-329.633) [-328.771] * (-330.516) [-328.402] (-329.108) (-328.241) -- 0:00:36
466000 -- (-328.287) [-331.329] (-330.036) (-329.261) * (-329.014) (-331.833) (-330.840) [-329.506] -- 0:00:36
466500 -- (-328.873) (-330.242) [-329.315] (-328.340) * (-333.341) (-328.874) [-329.125] (-338.392) -- 0:00:36
467000 -- [-332.142] (-329.334) (-331.393) (-335.853) * (-334.246) [-331.629] (-328.972) (-332.512) -- 0:00:36
467500 -- [-329.352] (-331.119) (-330.539) (-332.415) * (-330.567) (-331.228) [-329.247] (-330.449) -- 0:00:36
468000 -- [-329.261] (-331.837) (-328.384) (-329.026) * (-328.216) (-331.222) [-329.584] (-333.665) -- 0:00:36
468500 -- [-328.579] (-330.105) (-329.287) (-328.302) * (-331.242) (-330.757) (-329.303) [-335.093] -- 0:00:36
469000 -- [-329.319] (-328.714) (-329.074) (-328.661) * [-330.957] (-329.448) (-331.302) (-331.012) -- 0:00:36
469500 -- (-330.146) (-329.255) [-328.729] (-328.231) * (-328.643) [-329.568] (-333.523) (-330.848) -- 0:00:36
470000 -- (-328.220) [-329.565] (-329.568) (-330.403) * (-331.761) [-329.446] (-329.216) (-328.756) -- 0:00:36
Average standard deviation of split frequencies: 0.010266
470500 -- [-332.869] (-331.084) (-331.799) (-327.640) * (-340.055) (-328.005) [-328.641] (-331.200) -- 0:00:36
471000 -- [-329.271] (-330.766) (-330.018) (-332.620) * (-332.869) [-327.694] (-328.173) (-327.880) -- 0:00:35
471500 -- [-329.187] (-330.176) (-330.440) (-329.253) * (-328.702) (-332.690) (-331.163) [-327.922] -- 0:00:35
472000 -- (-330.244) [-330.716] (-329.860) (-331.557) * (-328.701) (-330.334) [-328.935] (-331.553) -- 0:00:35
472500 -- (-330.232) [-329.002] (-328.807) (-330.479) * (-329.270) [-329.924] (-333.696) (-331.090) -- 0:00:35
473000 -- (-330.324) [-330.647] (-328.927) (-329.484) * (-332.334) (-331.870) [-331.198] (-330.715) -- 0:00:35
473500 -- [-330.443] (-334.272) (-328.225) (-329.026) * (-331.330) (-329.978) (-331.537) [-328.726] -- 0:00:35
474000 -- (-330.076) (-329.060) (-328.246) [-331.666] * (-330.584) (-328.903) (-331.715) [-329.495] -- 0:00:36
474500 -- (-331.153) (-329.335) [-331.900] (-329.422) * (-335.076) (-328.353) (-329.670) [-328.933] -- 0:00:36
475000 -- [-330.093] (-329.373) (-327.992) (-330.154) * (-330.604) (-331.252) (-329.586) [-333.627] -- 0:00:36
Average standard deviation of split frequencies: 0.011389
475500 -- (-330.031) [-328.502] (-331.527) (-330.664) * (-331.895) (-334.677) [-330.350] (-333.381) -- 0:00:36
476000 -- (-328.601) (-330.757) [-328.913] (-332.969) * [-329.009] (-328.305) (-332.527) (-330.312) -- 0:00:36
476500 -- (-330.467) (-333.066) [-328.943] (-332.288) * [-328.231] (-329.206) (-331.671) (-332.166) -- 0:00:36
477000 -- [-329.499] (-336.464) (-329.642) (-331.460) * (-329.112) [-332.259] (-331.283) (-328.667) -- 0:00:36
477500 -- [-328.441] (-329.042) (-329.549) (-331.217) * [-330.271] (-330.141) (-329.387) (-329.162) -- 0:00:36
478000 -- (-329.405) [-331.550] (-330.900) (-329.844) * (-329.679) [-327.766] (-329.395) (-328.973) -- 0:00:36
478500 -- [-327.494] (-335.312) (-329.847) (-331.453) * (-329.126) (-331.373) [-332.002] (-329.813) -- 0:00:35
479000 -- (-329.134) (-336.070) [-329.380] (-330.819) * (-327.745) (-329.044) (-327.693) [-329.023] -- 0:00:35
479500 -- (-331.124) (-328.017) [-331.812] (-334.975) * (-329.966) (-328.179) (-327.984) [-327.958] -- 0:00:35
480000 -- [-328.928] (-329.349) (-330.555) (-330.058) * (-329.210) (-329.207) [-332.104] (-332.749) -- 0:00:35
Average standard deviation of split frequencies: 0.011033
480500 -- (-329.365) (-329.005) [-329.808] (-329.824) * [-330.342] (-329.558) (-327.875) (-328.938) -- 0:00:35
481000 -- (-328.635) [-330.416] (-328.490) (-328.637) * (-332.497) (-329.135) [-328.055] (-328.646) -- 0:00:35
481500 -- (-331.316) (-332.972) [-329.477] (-329.106) * [-329.774] (-331.173) (-331.961) (-331.078) -- 0:00:35
482000 -- (-331.088) (-332.290) (-330.558) [-329.370] * (-330.971) [-329.454] (-328.557) (-329.335) -- 0:00:35
482500 -- [-328.874] (-329.558) (-333.521) (-330.447) * (-329.222) (-329.124) (-329.141) [-328.346] -- 0:00:35
483000 -- (-330.590) (-330.855) [-332.060] (-330.687) * (-330.032) (-331.168) [-329.603] (-336.919) -- 0:00:35
483500 -- (-328.560) (-334.033) (-329.714) [-329.357] * (-328.472) (-331.600) (-327.853) [-328.906] -- 0:00:35
484000 -- (-332.486) [-328.074] (-329.644) (-329.553) * (-329.823) [-329.312] (-330.340) (-332.916) -- 0:00:35
484500 -- (-332.373) (-330.003) (-328.625) [-333.138] * [-329.367] (-329.332) (-333.789) (-328.483) -- 0:00:35
485000 -- (-328.003) [-327.943] (-330.897) (-330.142) * (-329.413) [-329.873] (-330.288) (-328.255) -- 0:00:35
Average standard deviation of split frequencies: 0.010852
485500 -- [-328.212] (-327.606) (-330.322) (-327.731) * (-328.269) [-328.385] (-334.156) (-335.907) -- 0:00:34
486000 -- [-330.142] (-329.993) (-329.664) (-332.406) * (-329.981) (-328.490) (-329.455) [-334.936] -- 0:00:34
486500 -- [-329.994] (-331.864) (-330.054) (-330.720) * [-329.276] (-328.370) (-328.790) (-335.929) -- 0:00:34
487000 -- [-330.682] (-328.125) (-328.777) (-332.243) * (-332.615) (-328.685) (-330.866) [-331.311] -- 0:00:34
487500 -- (-328.845) [-328.295] (-330.319) (-332.821) * [-334.243] (-328.594) (-327.660) (-328.202) -- 0:00:34
488000 -- [-329.374] (-332.675) (-328.348) (-328.798) * (-328.690) [-327.383] (-327.915) (-329.457) -- 0:00:34
488500 -- (-329.732) (-331.079) (-332.639) [-329.996] * (-328.730) [-329.458] (-330.586) (-331.248) -- 0:00:35
489000 -- (-332.622) [-330.522] (-329.057) (-329.299) * (-330.976) (-330.518) [-329.451] (-330.965) -- 0:00:35
489500 -- (-329.362) [-331.828] (-332.438) (-328.359) * (-333.608) (-328.985) [-329.545] (-329.214) -- 0:00:35
490000 -- (-335.303) (-332.024) [-334.353] (-329.188) * (-329.474) (-330.638) [-334.926] (-330.521) -- 0:00:35
Average standard deviation of split frequencies: 0.011529
490500 -- (-327.755) (-329.194) (-331.382) [-330.825] * (-329.667) (-328.048) [-327.722] (-329.029) -- 0:00:35
491000 -- (-328.698) (-330.203) (-332.043) [-328.807] * (-329.031) (-328.533) [-328.817] (-327.594) -- 0:00:35
491500 -- [-330.485] (-329.858) (-331.960) (-328.094) * (-328.497) [-330.001] (-328.815) (-330.906) -- 0:00:35
492000 -- (-330.047) (-329.776) [-330.738] (-331.335) * (-329.562) (-327.724) [-328.732] (-332.907) -- 0:00:35
492500 -- [-330.735] (-328.995) (-328.416) (-328.836) * (-329.314) [-328.619] (-328.020) (-333.181) -- 0:00:35
493000 -- (-329.469) [-329.938] (-328.709) (-330.246) * (-329.327) (-330.105) [-329.314] (-330.655) -- 0:00:34
493500 -- [-328.924] (-333.968) (-338.546) (-334.267) * (-332.180) (-329.708) [-330.100] (-331.710) -- 0:00:34
494000 -- (-330.545) [-328.927] (-334.133) (-330.385) * [-329.952] (-329.844) (-329.739) (-329.938) -- 0:00:34
494500 -- [-329.600] (-328.105) (-327.843) (-330.211) * (-334.282) [-332.115] (-331.070) (-328.124) -- 0:00:34
495000 -- [-327.496] (-332.703) (-328.740) (-328.435) * [-329.940] (-329.509) (-330.835) (-329.995) -- 0:00:34
Average standard deviation of split frequencies: 0.010989
495500 -- (-329.300) [-327.983] (-329.842) (-328.162) * (-332.136) [-329.094] (-329.172) (-329.647) -- 0:00:34
496000 -- (-329.954) (-328.723) (-332.175) [-328.020] * (-327.725) (-330.424) [-329.037] (-329.770) -- 0:00:34
496500 -- (-329.160) [-329.070] (-330.862) (-327.589) * (-327.877) (-332.214) (-330.651) [-328.173] -- 0:00:34
497000 -- [-328.741] (-331.316) (-330.066) (-328.423) * (-329.458) (-327.384) (-329.679) [-327.599] -- 0:00:34
497500 -- (-329.972) [-329.189] (-329.277) (-329.222) * (-330.129) (-328.282) [-332.418] (-330.204) -- 0:00:34
498000 -- [-330.362] (-328.779) (-333.139) (-333.047) * (-328.752) [-329.554] (-330.322) (-330.044) -- 0:00:34
498500 -- [-329.119] (-329.128) (-332.339) (-333.397) * (-331.403) (-328.164) [-335.782] (-330.097) -- 0:00:34
499000 -- (-328.735) [-330.260] (-331.829) (-329.867) * (-332.222) (-328.292) [-332.351] (-330.302) -- 0:00:34
499500 -- [-331.665] (-336.559) (-328.794) (-330.944) * (-334.465) [-328.097] (-327.588) (-327.879) -- 0:00:34
500000 -- (-330.743) (-332.221) [-328.380] (-330.899) * (-333.650) (-330.167) [-328.898] (-329.097) -- 0:00:34
Average standard deviation of split frequencies: 0.009886
500500 -- (-329.366) [-330.371] (-329.183) (-330.508) * (-333.103) (-330.964) [-329.456] (-328.184) -- 0:00:33
501000 -- (-330.053) (-330.682) (-329.293) [-329.246] * [-329.712] (-334.631) (-330.954) (-329.924) -- 0:00:33
501500 -- (-330.980) (-332.585) [-331.129] (-329.563) * [-330.071] (-329.093) (-332.259) (-328.654) -- 0:00:33
502000 -- (-331.397) [-329.154] (-331.498) (-333.292) * [-329.833] (-327.427) (-330.250) (-329.658) -- 0:00:33
502500 -- [-328.694] (-328.654) (-329.767) (-329.902) * (-328.099) (-330.200) [-328.391] (-328.728) -- 0:00:33
503000 -- (-328.251) [-328.606] (-330.906) (-329.306) * (-334.348) (-329.239) [-329.146] (-330.891) -- 0:00:34
503500 -- [-329.161] (-329.765) (-333.707) (-332.605) * (-330.739) [-330.402] (-327.971) (-339.570) -- 0:00:34
504000 -- [-328.645] (-334.319) (-333.021) (-328.633) * (-332.859) (-329.946) (-328.542) [-333.809] -- 0:00:34
504500 -- [-328.840] (-330.184) (-329.535) (-329.956) * (-329.844) [-327.862] (-329.555) (-327.977) -- 0:00:34
505000 -- (-328.742) (-328.560) (-331.039) [-329.029] * (-328.761) (-329.529) (-333.335) [-327.766] -- 0:00:34
Average standard deviation of split frequencies: 0.009899
505500 -- (-331.194) [-331.268] (-332.185) (-334.884) * (-329.256) [-328.202] (-333.344) (-327.839) -- 0:00:34
506000 -- (-329.580) (-332.118) (-332.618) [-328.064] * [-329.511] (-328.494) (-331.428) (-331.249) -- 0:00:34
506500 -- (-330.457) (-328.605) [-330.565] (-329.964) * [-334.052] (-329.070) (-331.684) (-330.793) -- 0:00:34
507000 -- (-332.666) (-328.680) [-330.901] (-332.088) * (-334.397) (-335.705) [-330.734] (-336.066) -- 0:00:34
507500 -- (-331.746) (-328.824) [-332.028] (-331.005) * (-329.478) [-329.996] (-329.364) (-333.334) -- 0:00:33
508000 -- (-328.799) (-330.026) (-337.670) [-330.132] * (-330.711) [-331.350] (-330.747) (-330.796) -- 0:00:33
508500 -- (-329.041) (-331.101) [-331.018] (-333.794) * [-328.905] (-330.606) (-332.285) (-333.225) -- 0:00:33
509000 -- (-331.883) (-328.904) (-331.997) [-329.058] * (-331.669) (-331.926) (-329.570) [-335.144] -- 0:00:33
509500 -- (-328.660) [-328.425] (-330.427) (-330.204) * (-335.044) (-329.268) (-332.239) [-328.849] -- 0:00:33
510000 -- (-328.842) (-331.141) [-330.685] (-334.879) * (-330.514) (-328.744) (-330.268) [-330.191] -- 0:00:33
Average standard deviation of split frequencies: 0.009520
510500 -- [-330.015] (-327.683) (-330.364) (-333.131) * (-328.300) (-328.048) [-328.647] (-332.199) -- 0:00:33
511000 -- (-328.728) [-332.925] (-328.998) (-331.472) * (-331.202) (-328.414) [-328.623] (-329.022) -- 0:00:33
511500 -- (-329.456) (-330.715) [-327.935] (-328.932) * (-330.255) [-328.773] (-333.507) (-329.915) -- 0:00:33
512000 -- (-328.719) (-332.414) [-328.049] (-330.282) * (-329.506) (-328.762) [-331.240] (-329.237) -- 0:00:33
512500 -- (-329.373) (-329.560) (-330.689) [-329.421] * (-332.889) (-332.766) (-330.885) [-329.748] -- 0:00:33
513000 -- (-334.276) (-332.435) (-329.231) [-329.423] * [-327.728] (-330.232) (-329.575) (-330.351) -- 0:00:33
513500 -- (-329.482) (-331.897) (-330.409) [-329.062] * [-332.871] (-328.197) (-328.382) (-327.997) -- 0:00:33
514000 -- (-331.273) [-328.264] (-333.836) (-329.243) * [-330.344] (-329.603) (-329.103) (-327.821) -- 0:00:33
514500 -- (-329.553) (-332.533) [-328.081] (-332.714) * (-330.462) (-331.359) [-327.584] (-328.400) -- 0:00:33
515000 -- (-327.912) [-328.164] (-329.880) (-330.193) * (-330.312) (-330.424) [-329.483] (-330.865) -- 0:00:32
Average standard deviation of split frequencies: 0.009421
515500 -- (-328.836) (-328.855) [-328.983] (-329.146) * [-334.394] (-332.903) (-328.740) (-336.574) -- 0:00:32
516000 -- [-330.899] (-332.604) (-334.367) (-328.418) * [-330.461] (-333.457) (-328.514) (-339.896) -- 0:00:32
516500 -- [-329.729] (-328.717) (-330.956) (-330.522) * (-329.982) (-328.301) (-335.350) [-333.653] -- 0:00:32
517000 -- [-331.096] (-329.257) (-331.817) (-329.229) * (-328.659) (-336.930) (-329.684) [-330.969] -- 0:00:32
517500 -- (-327.511) (-329.927) (-331.075) [-329.264] * (-328.768) (-328.252) (-329.558) [-330.405] -- 0:00:33
518000 -- [-328.602] (-330.134) (-330.891) (-332.364) * (-330.265) (-329.601) [-328.492] (-332.970) -- 0:00:33
518500 -- (-332.358) [-329.241] (-329.625) (-329.788) * (-331.101) (-329.882) (-328.270) [-329.889] -- 0:00:33
519000 -- (-329.055) (-328.296) [-329.841] (-332.575) * (-333.311) [-327.842] (-329.430) (-329.457) -- 0:00:33
519500 -- [-327.838] (-328.893) (-329.681) (-330.647) * (-329.889) (-329.653) [-331.086] (-329.688) -- 0:00:33
520000 -- (-330.665) (-330.683) [-330.761] (-330.351) * [-334.613] (-329.307) (-329.270) (-332.469) -- 0:00:33
Average standard deviation of split frequencies: 0.009450
520500 -- [-328.320] (-330.994) (-330.187) (-334.639) * [-329.148] (-330.498) (-329.370) (-329.577) -- 0:00:33
521000 -- (-330.130) (-329.578) (-331.395) [-329.405] * (-329.585) [-331.157] (-331.725) (-330.600) -- 0:00:33
521500 -- (-332.236) (-329.614) [-330.014] (-331.297) * (-328.622) (-329.375) (-328.561) [-330.265] -- 0:00:33
522000 -- [-328.402] (-329.604) (-330.134) (-330.930) * (-333.043) (-327.774) (-332.611) [-329.249] -- 0:00:32
522500 -- (-329.457) (-328.511) [-327.857] (-332.687) * (-332.418) [-332.292] (-333.602) (-331.289) -- 0:00:32
523000 -- [-330.081] (-328.940) (-331.735) (-331.384) * (-330.784) (-331.950) (-329.412) [-328.734] -- 0:00:32
523500 -- [-329.781] (-328.695) (-331.601) (-331.188) * [-330.526] (-329.056) (-330.249) (-330.207) -- 0:00:32
524000 -- (-330.931) (-330.166) (-330.155) [-329.182] * [-330.000] (-328.202) (-330.524) (-331.822) -- 0:00:32
524500 -- (-329.322) [-329.562] (-331.476) (-327.745) * (-331.764) (-329.068) (-330.185) [-329.267] -- 0:00:32
525000 -- [-331.516] (-329.288) (-330.286) (-328.895) * (-329.826) (-328.250) [-331.130] (-330.005) -- 0:00:32
Average standard deviation of split frequencies: 0.009410
525500 -- (-332.319) [-333.827] (-332.982) (-329.310) * [-330.231] (-332.633) (-328.814) (-330.307) -- 0:00:32
526000 -- [-330.795] (-332.877) (-331.692) (-328.425) * [-330.544] (-332.873) (-328.472) (-330.247) -- 0:00:32
526500 -- [-328.818] (-332.453) (-331.850) (-331.961) * (-332.696) (-328.586) (-331.458) [-332.039] -- 0:00:32
527000 -- (-328.974) (-329.715) (-331.859) [-329.920] * [-329.358] (-328.058) (-330.061) (-331.310) -- 0:00:32
527500 -- (-329.063) (-329.892) [-330.428] (-329.477) * [-330.473] (-329.532) (-329.034) (-328.383) -- 0:00:32
528000 -- (-327.649) (-327.878) (-330.503) [-330.617] * [-328.368] (-329.647) (-330.359) (-329.517) -- 0:00:32
528500 -- (-329.754) (-328.341) [-331.951] (-328.169) * (-328.132) (-331.460) [-330.197] (-330.557) -- 0:00:32
529000 -- [-329.740] (-329.668) (-332.855) (-327.757) * (-331.809) [-330.896] (-329.003) (-331.152) -- 0:00:32
529500 -- (-328.792) (-331.137) (-330.218) [-329.497] * (-334.147) (-330.211) (-328.417) [-327.853] -- 0:00:31
530000 -- (-328.097) [-327.663] (-334.992) (-331.351) * (-332.082) (-329.439) [-328.035] (-332.832) -- 0:00:31
Average standard deviation of split frequencies: 0.008495
530500 -- (-328.002) (-329.915) (-330.854) [-328.327] * (-328.807) (-334.348) [-329.606] (-329.830) -- 0:00:31
531000 -- (-330.142) [-330.563] (-328.651) (-331.551) * [-328.200] (-328.034) (-331.740) (-330.956) -- 0:00:31
531500 -- (-327.445) (-330.135) (-330.096) [-327.940] * (-327.780) (-330.204) (-331.775) [-331.665] -- 0:00:31
532000 -- (-328.116) (-329.590) (-331.449) [-328.316] * (-332.065) [-328.394] (-329.201) (-332.685) -- 0:00:32
532500 -- (-329.209) (-328.806) (-329.019) [-330.037] * (-330.846) (-328.009) (-329.339) [-328.500] -- 0:00:32
533000 -- (-336.224) (-330.418) [-330.665] (-331.912) * (-330.045) [-329.351] (-327.753) (-330.427) -- 0:00:32
533500 -- [-331.046] (-330.976) (-328.417) (-332.492) * (-336.585) [-328.488] (-328.693) (-336.289) -- 0:00:32
534000 -- (-332.987) [-333.265] (-330.195) (-328.395) * [-329.609] (-328.005) (-328.267) (-328.915) -- 0:00:32
534500 -- [-332.827] (-331.143) (-330.731) (-328.109) * (-332.841) [-329.067] (-329.285) (-331.458) -- 0:00:32
535000 -- (-331.528) (-329.442) (-328.924) [-328.124] * (-331.970) (-330.325) [-328.311] (-330.029) -- 0:00:32
Average standard deviation of split frequencies: 0.008685
535500 -- (-328.703) [-329.587] (-330.432) (-328.209) * (-331.779) (-332.248) [-327.783] (-331.351) -- 0:00:32
536000 -- (-329.320) (-329.408) (-330.711) [-330.562] * [-328.925] (-330.214) (-327.771) (-329.005) -- 0:00:32
536500 -- (-332.436) (-334.779) (-333.631) [-328.535] * [-334.242] (-330.926) (-328.950) (-331.742) -- 0:00:31
537000 -- (-329.781) (-329.010) [-329.773] (-333.277) * [-329.962] (-328.782) (-329.435) (-330.758) -- 0:00:31
537500 -- (-331.792) (-330.981) [-330.528] (-331.897) * (-329.310) (-329.895) [-331.468] (-329.857) -- 0:00:31
538000 -- (-331.878) (-330.801) [-331.437] (-327.836) * (-327.684) (-330.981) [-328.921] (-328.388) -- 0:00:31
538500 -- (-329.985) (-329.310) (-329.062) [-327.470] * (-329.029) (-332.906) (-329.532) [-330.352] -- 0:00:31
539000 -- (-331.958) (-330.179) (-331.280) [-328.208] * (-329.991) (-335.136) [-329.131] (-333.620) -- 0:00:31
539500 -- (-328.164) (-330.197) [-329.223] (-334.282) * (-332.077) (-336.048) [-331.241] (-333.608) -- 0:00:31
540000 -- (-329.734) (-329.447) [-328.545] (-328.187) * (-328.955) (-335.556) (-329.614) [-328.074] -- 0:00:31
Average standard deviation of split frequencies: 0.008446
540500 -- (-332.039) (-331.687) (-329.020) [-329.193] * (-330.712) (-333.274) [-328.379] (-329.403) -- 0:00:31
541000 -- [-330.864] (-330.611) (-331.259) (-329.926) * (-329.648) [-335.189] (-328.913) (-327.751) -- 0:00:31
541500 -- (-331.799) (-330.099) (-332.848) [-332.532] * (-329.646) (-333.158) (-327.767) [-328.674] -- 0:00:31
542000 -- (-332.017) [-332.780] (-335.439) (-329.037) * [-329.694] (-331.386) (-331.624) (-327.882) -- 0:00:31
542500 -- (-330.061) (-331.489) [-328.719] (-329.255) * [-328.742] (-328.106) (-330.105) (-327.889) -- 0:00:31
543000 -- [-330.631] (-328.101) (-328.083) (-331.968) * (-328.643) (-329.051) (-328.682) [-331.306] -- 0:00:31
543500 -- (-333.289) [-333.208] (-328.318) (-330.595) * (-331.397) [-328.829] (-328.873) (-330.769) -- 0:00:31
544000 -- [-332.904] (-331.755) (-331.967) (-329.221) * [-328.779] (-328.433) (-331.121) (-330.485) -- 0:00:31
544500 -- (-331.362) (-330.592) (-330.970) [-329.444] * (-331.114) [-332.328] (-334.719) (-331.934) -- 0:00:30
545000 -- [-330.018] (-327.829) (-330.583) (-330.599) * [-328.825] (-329.464) (-330.505) (-329.866) -- 0:00:30
Average standard deviation of split frequencies: 0.008202
545500 -- (-329.496) (-331.011) (-332.497) [-329.478] * (-330.540) (-330.812) [-329.022] (-329.703) -- 0:00:30
546000 -- [-328.885] (-330.349) (-330.392) (-329.189) * [-329.937] (-329.229) (-332.228) (-331.743) -- 0:00:30
546500 -- (-331.082) (-331.218) (-331.476) [-331.366] * (-330.898) [-328.509] (-328.257) (-330.902) -- 0:00:30
547000 -- (-330.126) (-332.068) (-328.338) [-328.247] * (-332.047) [-329.317] (-328.367) (-329.300) -- 0:00:31
547500 -- [-329.490] (-329.934) (-329.234) (-328.682) * [-330.750] (-330.061) (-329.424) (-329.487) -- 0:00:31
548000 -- (-333.583) [-329.617] (-334.572) (-329.417) * (-334.733) (-330.517) [-328.164] (-328.619) -- 0:00:31
548500 -- (-328.052) [-328.466] (-328.051) (-328.302) * (-327.878) [-331.226] (-329.763) (-329.180) -- 0:00:31
549000 -- [-329.700] (-329.326) (-328.306) (-328.580) * (-332.331) (-330.855) (-329.922) [-329.096] -- 0:00:31
549500 -- (-327.916) [-329.670] (-329.356) (-328.688) * (-330.494) [-333.724] (-330.129) (-328.593) -- 0:00:31
550000 -- (-329.742) [-331.234] (-330.507) (-331.006) * (-329.985) (-329.593) [-330.803] (-329.869) -- 0:00:31
Average standard deviation of split frequencies: 0.008882
550500 -- (-332.661) [-332.004] (-330.977) (-329.062) * (-329.153) (-330.758) (-334.453) [-329.323] -- 0:00:31
551000 -- (-332.957) (-330.195) [-329.048] (-331.581) * (-329.647) (-327.997) (-331.969) [-329.937] -- 0:00:30
551500 -- [-331.389] (-330.370) (-331.129) (-329.279) * (-328.899) [-337.574] (-329.133) (-331.357) -- 0:00:30
552000 -- (-328.495) (-333.832) (-329.680) [-330.052] * (-328.903) (-332.719) (-329.120) [-329.044] -- 0:00:30
552500 -- [-330.814] (-331.075) (-328.979) (-330.771) * [-329.893] (-329.531) (-329.530) (-329.799) -- 0:00:30
553000 -- [-329.601] (-334.922) (-329.864) (-328.989) * (-331.354) (-327.792) (-335.417) [-329.552] -- 0:00:30
553500 -- (-328.949) (-329.937) (-329.488) [-328.187] * (-329.818) (-328.183) (-331.070) [-329.662] -- 0:00:30
554000 -- (-330.270) (-332.658) (-330.155) [-329.263] * (-329.522) [-330.675] (-328.953) (-328.496) -- 0:00:30
554500 -- (-330.245) (-329.474) (-328.174) [-328.171] * (-330.087) (-333.833) [-329.751] (-329.186) -- 0:00:30
555000 -- [-329.356] (-329.097) (-331.788) (-328.837) * (-330.368) [-331.241] (-331.439) (-330.047) -- 0:00:30
Average standard deviation of split frequencies: 0.008955
555500 -- (-328.372) (-327.665) (-330.210) [-332.956] * (-330.022) (-328.434) (-331.945) [-327.731] -- 0:00:30
556000 -- (-329.138) (-327.983) (-327.595) [-328.421] * (-331.951) [-328.088] (-329.617) (-329.460) -- 0:00:30
556500 -- (-330.044) (-330.411) [-330.149] (-328.948) * [-328.564] (-327.684) (-329.484) (-331.861) -- 0:00:30
557000 -- [-327.786] (-329.846) (-331.485) (-330.815) * (-330.912) (-330.359) [-331.500] (-330.130) -- 0:00:30
557500 -- (-329.775) (-330.807) (-331.676) [-331.172] * (-330.087) (-329.064) [-328.498] (-328.585) -- 0:00:30
558000 -- (-332.572) (-329.112) [-333.498] (-330.059) * [-330.373] (-328.613) (-329.787) (-330.138) -- 0:00:30
558500 -- (-334.321) [-329.985] (-332.051) (-332.384) * (-330.373) (-330.001) [-333.741] (-331.255) -- 0:00:30
559000 -- (-328.723) [-329.552] (-334.369) (-333.264) * (-328.020) (-331.147) [-330.311] (-330.423) -- 0:00:29
559500 -- (-328.541) (-329.563) (-331.825) [-331.409] * (-329.511) [-329.588] (-329.845) (-330.006) -- 0:00:29
560000 -- [-331.714] (-332.188) (-332.272) (-333.703) * [-330.735] (-328.608) (-332.146) (-330.327) -- 0:00:29
Average standard deviation of split frequencies: 0.009091
560500 -- [-329.112] (-327.991) (-333.202) (-332.971) * (-328.586) [-329.108] (-329.383) (-331.314) -- 0:00:29
561000 -- (-329.963) [-328.645] (-333.622) (-332.315) * [-329.803] (-327.914) (-330.841) (-331.509) -- 0:00:29
561500 -- (-330.577) (-328.687) (-329.116) [-330.650] * [-328.257] (-330.686) (-328.611) (-330.421) -- 0:00:30
562000 -- (-331.192) (-331.162) (-328.636) [-330.256] * (-330.049) [-329.397] (-329.537) (-332.233) -- 0:00:30
562500 -- (-329.996) (-328.167) (-329.894) [-328.937] * (-328.746) (-330.967) (-328.495) [-328.983] -- 0:00:30
563000 -- (-328.900) [-329.007] (-331.807) (-327.766) * (-329.466) (-329.335) (-328.790) [-329.450] -- 0:00:30
563500 -- (-330.548) (-330.491) (-331.136) [-327.678] * (-327.692) (-334.138) [-330.204] (-333.365) -- 0:00:30
564000 -- (-330.628) [-332.116] (-328.432) (-329.314) * (-329.748) (-328.171) [-330.487] (-332.581) -- 0:00:30
564500 -- (-330.138) (-332.107) (-331.358) [-328.115] * (-329.030) (-328.849) [-329.095] (-330.964) -- 0:00:30
565000 -- (-331.567) (-329.081) (-329.795) [-328.669] * (-330.163) (-329.232) (-328.172) [-329.007] -- 0:00:30
Average standard deviation of split frequencies: 0.009266
565500 -- [-329.367] (-328.094) (-328.230) (-332.336) * (-329.955) (-328.585) (-328.045) [-328.808] -- 0:00:29
566000 -- (-330.654) (-327.851) (-327.554) [-328.982] * (-329.351) (-328.597) (-333.217) [-328.397] -- 0:00:29
566500 -- (-328.952) (-329.107) (-331.580) [-333.709] * [-331.518] (-328.346) (-336.380) (-328.533) -- 0:00:29
567000 -- (-331.944) [-332.933] (-329.846) (-329.783) * [-328.742] (-328.989) (-329.653) (-328.823) -- 0:00:29
567500 -- (-328.900) (-328.178) [-328.325] (-328.840) * (-329.154) [-329.717] (-329.003) (-330.806) -- 0:00:29
568000 -- [-332.218] (-328.392) (-330.033) (-332.670) * [-329.723] (-330.698) (-331.367) (-328.730) -- 0:00:29
568500 -- (-329.780) (-329.881) [-328.689] (-330.813) * [-328.266] (-330.672) (-334.979) (-329.336) -- 0:00:29
569000 -- (-330.816) [-329.917] (-328.560) (-330.007) * (-329.755) (-328.881) (-330.953) [-331.429] -- 0:00:29
569500 -- (-330.311) (-330.471) [-328.346] (-329.754) * (-329.126) (-333.546) [-329.584] (-332.136) -- 0:00:29
570000 -- (-331.617) (-331.401) [-330.799] (-332.369) * (-333.029) (-328.333) (-329.640) [-329.162] -- 0:00:29
Average standard deviation of split frequencies: 0.009809
570500 -- (-331.669) (-330.362) (-330.017) [-329.862] * [-331.341] (-328.908) (-329.581) (-329.400) -- 0:00:29
571000 -- (-330.749) [-329.847] (-327.603) (-331.381) * (-330.836) (-327.489) (-331.363) [-329.038] -- 0:00:29
571500 -- (-327.510) (-329.557) [-329.483] (-330.666) * (-327.962) (-329.812) (-333.082) [-328.115] -- 0:00:29
572000 -- [-332.178] (-332.344) (-335.468) (-331.737) * (-327.694) (-332.587) (-332.220) [-328.428] -- 0:00:29
572500 -- (-332.247) (-328.179) (-331.417) [-328.727] * [-329.577] (-335.166) (-334.084) (-329.187) -- 0:00:29
573000 -- (-330.305) (-329.599) (-330.880) [-328.375] * (-334.058) (-329.527) [-330.896] (-328.162) -- 0:00:29
573500 -- (-328.489) (-332.246) [-328.065] (-330.211) * [-330.720] (-330.543) (-328.965) (-330.440) -- 0:00:29
574000 -- (-329.178) (-329.304) (-329.934) [-327.487] * (-328.106) [-328.725] (-329.981) (-331.580) -- 0:00:28
574500 -- [-331.730] (-328.346) (-331.505) (-332.356) * [-330.210] (-329.570) (-328.480) (-328.705) -- 0:00:28
575000 -- (-329.541) (-331.914) [-328.755] (-331.800) * (-328.957) [-329.105] (-328.074) (-334.045) -- 0:00:28
Average standard deviation of split frequencies: 0.009719
575500 -- (-329.378) [-330.288] (-329.398) (-334.000) * (-328.186) (-331.103) (-329.556) [-331.677] -- 0:00:28
576000 -- [-330.426] (-328.396) (-337.420) (-329.601) * (-328.413) [-331.696] (-329.154) (-327.857) -- 0:00:29
576500 -- [-332.694] (-329.198) (-339.725) (-327.891) * [-328.342] (-330.974) (-329.664) (-333.012) -- 0:00:29
577000 -- (-330.465) (-330.998) [-334.090] (-328.504) * (-330.768) [-328.328] (-330.564) (-333.808) -- 0:00:29
577500 -- (-329.170) (-331.772) [-330.746] (-329.263) * (-328.723) (-329.509) (-331.356) [-329.612] -- 0:00:29
578000 -- [-328.717] (-332.806) (-339.315) (-334.118) * [-328.596] (-333.922) (-330.545) (-330.036) -- 0:00:29
578500 -- (-332.311) [-328.886] (-335.447) (-328.199) * (-328.743) [-327.696] (-329.565) (-329.184) -- 0:00:29
579000 -- [-329.425] (-328.002) (-331.125) (-333.820) * (-331.549) (-328.858) [-329.327] (-332.608) -- 0:00:29
579500 -- (-338.885) [-330.718] (-331.192) (-328.630) * (-330.382) (-331.652) (-328.563) [-329.164] -- 0:00:29
580000 -- (-334.697) (-328.970) [-328.841] (-330.030) * [-330.666] (-332.132) (-330.587) (-328.881) -- 0:00:28
Average standard deviation of split frequencies: 0.009285
580500 -- (-334.500) [-330.124] (-328.784) (-329.679) * (-329.897) [-330.496] (-327.683) (-330.299) -- 0:00:28
581000 -- (-334.810) (-332.765) [-329.689] (-329.803) * [-328.894] (-329.028) (-327.484) (-328.708) -- 0:00:28
581500 -- (-329.470) (-336.410) [-330.661] (-333.283) * (-332.035) [-328.912] (-327.835) (-329.416) -- 0:00:28
582000 -- (-331.597) (-332.177) [-331.441] (-329.284) * [-330.075] (-329.877) (-330.590) (-330.658) -- 0:00:28
582500 -- (-330.409) [-328.797] (-330.744) (-328.726) * [-328.481] (-331.128) (-329.109) (-330.390) -- 0:00:28
583000 -- (-334.191) (-329.764) (-329.618) [-334.617] * (-330.557) (-332.288) (-329.407) [-328.493] -- 0:00:28
583500 -- (-330.110) [-328.371] (-329.659) (-335.240) * (-331.191) (-331.253) (-328.651) [-329.096] -- 0:00:28
584000 -- (-329.070) [-329.569] (-332.569) (-329.305) * (-329.889) (-329.404) (-329.154) [-328.412] -- 0:00:28
584500 -- (-329.955) (-330.048) (-331.763) [-328.049] * (-332.573) (-331.212) (-329.036) [-327.892] -- 0:00:28
585000 -- (-329.121) (-330.279) (-328.911) [-329.837] * [-329.750] (-329.808) (-328.745) (-330.345) -- 0:00:28
Average standard deviation of split frequencies: 0.009603
585500 -- (-330.558) [-332.339] (-329.262) (-331.315) * (-329.853) (-328.886) [-330.065] (-328.538) -- 0:00:28
586000 -- (-332.237) (-329.710) (-328.925) [-329.649] * (-331.337) (-330.875) (-328.946) [-327.767] -- 0:00:28
586500 -- (-332.151) [-331.940] (-329.265) (-328.412) * (-329.217) (-328.314) [-330.261] (-327.715) -- 0:00:28
587000 -- (-330.113) [-328.425] (-330.872) (-329.896) * [-331.226] (-329.669) (-332.072) (-329.066) -- 0:00:28
587500 -- (-327.868) (-328.267) [-330.092] (-329.615) * (-328.335) [-329.135] (-327.598) (-331.468) -- 0:00:28
588000 -- (-328.046) [-328.471] (-333.773) (-331.276) * (-334.255) [-328.790] (-328.181) (-329.937) -- 0:00:28
588500 -- (-328.877) (-328.438) (-329.872) [-329.504] * (-330.241) [-330.851] (-328.288) (-328.903) -- 0:00:27
589000 -- [-329.244] (-327.376) (-329.589) (-332.154) * (-329.951) (-329.118) (-328.635) [-327.618] -- 0:00:27
589500 -- (-328.351) (-329.719) [-334.183] (-332.387) * (-329.427) [-331.633] (-329.242) (-330.368) -- 0:00:27
590000 -- (-329.156) [-329.674] (-334.769) (-327.508) * (-329.560) [-328.089] (-330.252) (-329.499) -- 0:00:27
Average standard deviation of split frequencies: 0.009477
590500 -- [-331.177] (-332.837) (-333.529) (-330.683) * (-330.349) (-328.794) [-329.368] (-329.367) -- 0:00:28
591000 -- (-328.694) (-330.165) (-329.814) [-328.228] * (-328.932) [-329.412] (-327.872) (-328.904) -- 0:00:28
591500 -- [-330.521] (-328.884) (-331.467) (-329.484) * (-327.980) (-328.726) (-329.257) [-327.723] -- 0:00:28
592000 -- [-328.966] (-329.266) (-329.141) (-331.869) * (-328.180) (-327.981) [-328.148] (-328.375) -- 0:00:28
592500 -- [-330.079] (-330.125) (-331.220) (-328.086) * (-330.184) (-330.163) (-328.530) [-330.089] -- 0:00:28
593000 -- (-328.604) (-330.782) (-332.168) [-329.362] * (-335.133) [-329.554] (-329.633) (-332.596) -- 0:00:28
593500 -- (-331.904) (-330.954) [-331.060] (-327.765) * [-330.651] (-331.227) (-331.098) (-332.612) -- 0:00:28
594000 -- (-330.584) (-330.947) (-337.096) [-328.790] * (-330.617) (-328.778) [-328.917] (-330.094) -- 0:00:28
594500 -- [-335.389] (-331.997) (-339.240) (-328.825) * (-331.269) [-328.273] (-329.398) (-327.726) -- 0:00:27
595000 -- [-329.436] (-331.441) (-329.047) (-331.433) * [-329.479] (-328.713) (-332.090) (-327.996) -- 0:00:27
Average standard deviation of split frequencies: 0.010035
595500 -- (-332.596) (-330.785) (-330.425) [-328.797] * (-333.134) [-328.987] (-331.777) (-329.868) -- 0:00:27
596000 -- (-328.303) (-331.250) (-328.721) [-330.373] * (-329.768) [-328.561] (-335.948) (-329.283) -- 0:00:27
596500 -- (-328.197) (-332.292) [-328.557] (-328.676) * (-328.608) (-333.037) (-331.503) [-329.368] -- 0:00:27
597000 -- (-328.775) (-331.768) [-331.220] (-328.642) * (-328.212) [-329.310] (-333.428) (-329.983) -- 0:00:27
597500 -- (-328.891) [-332.113] (-331.368) (-328.662) * (-331.080) (-329.510) (-333.326) [-330.041] -- 0:00:27
598000 -- (-330.660) [-331.146] (-329.140) (-333.449) * (-330.878) [-328.744] (-328.522) (-330.368) -- 0:00:27
598500 -- (-332.939) (-331.352) [-328.408] (-328.348) * (-334.784) [-328.482] (-332.167) (-333.082) -- 0:00:27
599000 -- [-330.405] (-332.028) (-331.376) (-328.935) * (-334.386) (-335.002) [-331.412] (-329.709) -- 0:00:27
599500 -- (-334.516) [-329.241] (-332.055) (-327.727) * (-331.254) (-331.921) [-330.736] (-329.210) -- 0:00:27
600000 -- [-329.815] (-329.356) (-330.681) (-329.672) * (-332.657) [-327.727] (-331.121) (-330.701) -- 0:00:27
Average standard deviation of split frequencies: 0.010791
600500 -- (-329.357) (-328.200) (-329.708) [-328.147] * [-332.066] (-329.437) (-331.098) (-328.040) -- 0:00:27
601000 -- (-329.218) (-328.266) [-327.628] (-328.539) * (-335.853) [-331.887] (-330.885) (-329.470) -- 0:00:27
601500 -- (-329.480) [-330.029] (-330.135) (-328.127) * (-332.996) (-332.035) (-333.038) [-328.736] -- 0:00:27
602000 -- (-329.311) [-330.088] (-330.458) (-328.726) * (-329.523) [-329.830] (-328.728) (-329.043) -- 0:00:27
602500 -- [-329.509] (-333.933) (-331.445) (-331.471) * (-329.106) (-329.032) (-328.786) [-329.216] -- 0:00:27
603000 -- (-330.127) [-331.146] (-330.928) (-328.381) * [-330.180] (-330.435) (-330.292) (-329.862) -- 0:00:26
603500 -- (-328.091) (-330.306) [-328.505] (-328.596) * (-329.567) (-328.845) (-329.378) [-330.892] -- 0:00:26
604000 -- (-328.113) (-329.184) (-331.362) [-330.542] * (-328.230) (-329.322) (-329.225) [-328.596] -- 0:00:26
604500 -- (-332.540) [-329.834] (-329.988) (-330.223) * (-328.683) [-328.178] (-330.982) (-330.488) -- 0:00:26
605000 -- (-331.463) (-330.715) (-330.210) [-328.171] * [-327.979] (-328.480) (-332.377) (-330.443) -- 0:00:27
Average standard deviation of split frequencies: 0.010647
605500 -- (-333.245) (-328.337) (-329.496) [-328.540] * (-330.457) (-329.996) [-331.240] (-329.515) -- 0:00:27
606000 -- [-329.448] (-329.063) (-332.782) (-327.991) * [-331.637] (-329.631) (-330.260) (-330.698) -- 0:00:27
606500 -- (-328.210) [-328.276] (-332.027) (-330.878) * [-329.105] (-327.885) (-335.532) (-328.389) -- 0:00:27
607000 -- (-330.752) (-332.895) (-331.091) [-328.507] * (-329.122) [-327.655] (-334.080) (-331.802) -- 0:00:27
607500 -- (-331.245) (-331.220) [-327.854] (-329.617) * [-327.827] (-331.020) (-330.144) (-329.618) -- 0:00:27
608000 -- [-334.600] (-328.646) (-331.130) (-331.807) * (-332.930) [-329.735] (-329.517) (-331.480) -- 0:00:27
608500 -- (-334.544) (-328.274) [-329.486] (-333.146) * (-331.095) (-329.217) [-329.525] (-331.895) -- 0:00:27
609000 -- (-333.974) [-328.981] (-329.706) (-327.965) * (-331.673) (-328.952) [-330.072] (-335.369) -- 0:00:26
609500 -- (-331.528) (-328.169) (-329.107) [-328.435] * (-332.517) (-328.944) (-330.396) [-331.072] -- 0:00:26
610000 -- (-329.948) (-329.260) [-327.887] (-329.741) * [-328.225] (-331.635) (-329.614) (-329.953) -- 0:00:26
Average standard deviation of split frequencies: 0.010373
610500 -- [-327.893] (-329.026) (-331.975) (-331.093) * (-328.819) (-330.024) [-330.475] (-330.038) -- 0:00:26
611000 -- (-328.853) [-331.326] (-329.727) (-330.187) * (-331.150) (-328.726) [-330.918] (-331.340) -- 0:00:26
611500 -- (-331.047) (-331.292) [-328.136] (-328.590) * (-331.083) [-329.574] (-330.172) (-331.349) -- 0:00:26
612000 -- [-329.253] (-329.387) (-335.394) (-330.867) * (-334.043) (-329.876) [-328.575] (-332.696) -- 0:00:26
612500 -- (-329.335) [-327.680] (-329.093) (-329.591) * (-329.605) (-329.701) (-329.331) [-329.705] -- 0:00:26
613000 -- [-328.087] (-331.036) (-329.139) (-328.410) * (-328.887) (-329.498) (-328.391) [-328.540] -- 0:00:26
613500 -- (-335.493) (-329.808) [-329.538] (-331.130) * (-328.772) (-329.398) (-331.935) [-329.401] -- 0:00:26
614000 -- (-331.146) [-327.579] (-330.832) (-328.550) * (-327.926) [-329.715] (-333.354) (-328.587) -- 0:00:26
614500 -- (-329.328) [-329.434] (-329.413) (-330.130) * (-328.408) (-328.467) [-328.962] (-328.927) -- 0:00:26
615000 -- (-328.896) (-333.949) [-332.550] (-330.312) * (-328.857) [-327.778] (-332.532) (-331.084) -- 0:00:26
Average standard deviation of split frequencies: 0.009805
615500 -- (-328.872) (-331.351) [-331.921] (-331.391) * (-329.739) (-331.846) (-328.729) [-334.656] -- 0:00:26
616000 -- (-330.323) [-331.089] (-330.203) (-330.046) * [-330.814] (-329.090) (-330.011) (-331.350) -- 0:00:26
616500 -- (-329.343) (-330.027) (-332.847) [-327.766] * (-330.510) [-328.181] (-330.004) (-332.317) -- 0:00:26
617000 -- (-328.864) [-331.496] (-332.329) (-329.788) * (-330.468) (-327.801) [-327.773] (-333.681) -- 0:00:26
617500 -- (-330.885) [-328.598] (-327.829) (-330.754) * (-328.024) (-331.303) [-328.989] (-328.718) -- 0:00:26
618000 -- (-331.634) [-328.775] (-330.109) (-330.785) * (-328.762) (-330.994) (-330.869) [-329.566] -- 0:00:25
618500 -- [-332.438] (-331.662) (-329.082) (-330.818) * (-329.747) (-329.217) (-336.500) [-328.247] -- 0:00:25
619000 -- [-329.744] (-329.473) (-331.055) (-334.371) * (-329.744) (-329.444) [-329.914] (-329.748) -- 0:00:25
619500 -- (-328.976) [-327.615] (-328.694) (-330.891) * (-329.186) [-329.058] (-328.618) (-332.985) -- 0:00:26
620000 -- [-329.743] (-328.006) (-331.065) (-330.758) * (-340.344) [-332.972] (-328.684) (-329.413) -- 0:00:26
Average standard deviation of split frequencies: 0.009257
620500 -- [-331.199] (-329.750) (-329.628) (-329.523) * (-331.073) [-330.034] (-329.937) (-327.894) -- 0:00:26
621000 -- (-332.632) [-328.955] (-329.297) (-328.462) * (-332.751) [-329.734] (-331.000) (-330.149) -- 0:00:26
621500 -- (-333.812) (-330.605) (-331.076) [-329.003] * (-329.552) (-329.112) (-328.759) [-329.654] -- 0:00:26
622000 -- (-332.626) (-329.941) [-329.568] (-329.036) * (-328.893) (-331.883) [-329.909] (-328.266) -- 0:00:26
622500 -- (-333.712) [-330.023] (-331.085) (-328.827) * (-337.715) (-328.529) (-329.000) [-330.871] -- 0:00:26
623000 -- (-328.170) (-337.165) (-334.458) [-331.227] * [-330.467] (-328.987) (-329.399) (-329.549) -- 0:00:26
623500 -- [-328.926] (-328.527) (-328.410) (-329.417) * (-333.304) (-331.530) [-332.071] (-329.372) -- 0:00:25
624000 -- (-331.631) [-327.603] (-328.730) (-329.206) * (-329.157) [-328.336] (-328.025) (-331.147) -- 0:00:25
624500 -- [-331.609] (-328.980) (-330.972) (-328.570) * (-329.994) [-330.710] (-329.899) (-328.899) -- 0:00:25
625000 -- (-331.850) [-330.027] (-330.585) (-328.243) * (-331.992) (-338.189) (-332.637) [-328.017] -- 0:00:25
Average standard deviation of split frequencies: 0.008895
625500 -- [-328.050] (-328.370) (-328.429) (-329.445) * (-330.183) [-334.965] (-330.509) (-329.362) -- 0:00:25
626000 -- (-327.601) (-328.843) [-328.261] (-331.222) * (-333.500) [-330.008] (-328.409) (-334.726) -- 0:00:25
626500 -- [-328.736] (-332.900) (-328.274) (-328.461) * (-330.570) (-330.836) [-327.648] (-333.715) -- 0:00:25
627000 -- (-328.145) (-331.918) [-329.344] (-329.493) * (-328.761) (-328.921) (-329.347) [-328.194] -- 0:00:25
627500 -- [-328.922] (-331.674) (-330.444) (-328.793) * (-332.363) (-328.545) [-329.188] (-330.108) -- 0:00:25
628000 -- [-328.319] (-329.223) (-331.509) (-328.254) * (-329.239) [-328.295] (-330.722) (-334.036) -- 0:00:25
628500 -- (-330.156) [-329.774] (-329.399) (-328.596) * (-327.594) (-329.430) [-329.685] (-329.755) -- 0:00:25
629000 -- [-327.773] (-333.004) (-335.632) (-328.479) * [-329.276] (-329.413) (-331.479) (-329.525) -- 0:00:25
629500 -- (-327.547) (-331.798) [-332.169] (-328.535) * (-330.115) [-328.346] (-333.767) (-331.509) -- 0:00:25
630000 -- (-327.790) [-332.607] (-333.366) (-331.929) * (-334.752) (-329.360) (-330.388) [-328.829] -- 0:00:25
Average standard deviation of split frequencies: 0.009484
630500 -- (-330.359) (-329.088) [-329.259] (-329.366) * (-331.524) (-336.770) (-330.037) [-329.583] -- 0:00:25
631000 -- [-328.722] (-327.747) (-328.711) (-329.559) * (-328.211) (-330.933) (-331.054) [-329.532] -- 0:00:25
631500 -- (-330.900) (-331.023) (-328.484) [-329.115] * (-328.984) (-330.046) [-332.007] (-328.963) -- 0:00:25
632000 -- (-331.086) [-330.248] (-331.696) (-334.628) * (-329.243) [-327.785] (-328.143) (-333.349) -- 0:00:25
632500 -- [-330.666] (-331.126) (-332.142) (-330.282) * (-329.490) [-328.864] (-330.104) (-329.890) -- 0:00:24
633000 -- [-328.594] (-331.882) (-332.285) (-334.000) * (-330.323) (-331.053) [-330.837] (-331.477) -- 0:00:24
633500 -- (-330.049) (-329.824) [-330.997] (-334.004) * (-329.125) [-327.895] (-328.981) (-331.336) -- 0:00:24
634000 -- (-331.199) [-329.766] (-328.256) (-328.768) * (-333.694) [-329.153] (-328.790) (-328.734) -- 0:00:25
634500 -- [-331.929] (-329.130) (-329.523) (-329.675) * (-328.809) (-329.766) [-328.116] (-330.542) -- 0:00:25
635000 -- (-327.630) [-329.909] (-329.955) (-329.398) * (-329.349) [-329.976] (-328.670) (-328.263) -- 0:00:25
Average standard deviation of split frequencies: 0.010562
635500 -- (-327.762) (-330.666) [-329.225] (-329.231) * (-328.357) (-328.496) (-328.908) [-328.815] -- 0:00:25
636000 -- (-331.127) (-331.820) [-331.690] (-329.548) * (-329.884) (-329.458) (-330.890) [-328.719] -- 0:00:25
636500 -- (-329.530) [-329.284] (-331.095) (-327.855) * [-328.404] (-332.539) (-331.246) (-329.115) -- 0:00:25
637000 -- (-330.415) (-328.933) [-329.233] (-331.685) * (-328.074) [-331.531] (-331.760) (-329.604) -- 0:00:25
637500 -- (-332.456) (-328.617) (-330.918) [-330.542] * (-329.371) (-328.913) [-332.629] (-329.166) -- 0:00:25
638000 -- (-332.306) (-333.207) [-332.133] (-330.435) * (-329.701) [-329.673] (-331.581) (-328.408) -- 0:00:24
638500 -- [-327.759] (-330.936) (-328.603) (-332.067) * [-328.978] (-332.158) (-335.366) (-331.086) -- 0:00:24
639000 -- (-330.694) (-329.525) [-328.197] (-328.348) * [-332.221] (-330.276) (-332.057) (-329.895) -- 0:00:24
639500 -- (-327.815) (-330.060) (-329.779) [-328.161] * (-328.718) (-330.918) [-329.016] (-329.893) -- 0:00:24
640000 -- (-328.977) (-328.611) [-328.353] (-328.516) * [-331.682] (-327.888) (-329.908) (-328.283) -- 0:00:24
Average standard deviation of split frequencies: 0.010531
640500 -- (-332.633) [-329.387] (-327.878) (-333.300) * [-329.753] (-331.497) (-332.271) (-328.960) -- 0:00:24
641000 -- [-330.649] (-327.669) (-330.616) (-330.626) * [-332.013] (-330.974) (-328.417) (-328.864) -- 0:00:24
641500 -- (-329.782) (-331.845) (-330.744) [-328.495] * (-341.310) (-329.182) [-328.211] (-328.415) -- 0:00:24
642000 -- [-332.241] (-329.125) (-331.345) (-331.516) * (-345.535) (-330.528) (-328.937) [-327.621] -- 0:00:24
642500 -- (-331.247) (-332.865) [-328.409] (-328.314) * (-334.399) (-328.538) [-327.948] (-328.625) -- 0:00:24
643000 -- (-336.257) (-329.876) (-327.659) [-330.475] * [-331.221] (-330.243) (-328.700) (-333.887) -- 0:00:24
643500 -- [-330.065] (-331.584) (-328.296) (-332.536) * (-328.349) (-331.226) [-327.861] (-327.795) -- 0:00:24
644000 -- [-329.194] (-329.574) (-334.008) (-328.205) * [-328.336] (-328.490) (-327.848) (-331.949) -- 0:00:24
644500 -- (-330.204) (-328.910) (-329.002) [-330.449] * (-331.892) (-329.347) (-329.665) [-327.738] -- 0:00:24
645000 -- [-331.284] (-331.361) (-328.162) (-329.096) * [-332.632] (-328.915) (-329.292) (-328.434) -- 0:00:24
Average standard deviation of split frequencies: 0.010535
645500 -- (-332.462) (-327.751) [-330.881] (-330.536) * (-330.745) (-329.782) (-328.011) [-327.932] -- 0:00:24
646000 -- (-334.813) (-333.863) [-333.033] (-331.513) * [-331.113] (-331.804) (-329.521) (-328.885) -- 0:00:24
646500 -- [-327.658] (-328.811) (-327.590) (-330.634) * (-329.930) [-338.422] (-328.356) (-331.638) -- 0:00:24
647000 -- (-327.774) (-329.876) (-330.760) [-330.359] * (-332.513) (-333.570) [-328.745] (-328.723) -- 0:00:24
647500 -- (-328.768) (-329.171) (-330.571) [-328.813] * (-329.833) (-331.586) (-328.536) [-331.707] -- 0:00:23
648000 -- (-330.226) [-329.127] (-329.753) (-329.602) * (-331.505) (-332.238) (-332.517) [-328.508] -- 0:00:23
648500 -- (-332.618) [-328.273] (-329.719) (-330.364) * (-330.621) [-330.522] (-332.083) (-329.060) -- 0:00:23
649000 -- (-335.844) (-329.803) (-332.061) [-328.996] * [-330.357] (-327.540) (-330.093) (-329.863) -- 0:00:24
649500 -- (-330.494) (-331.401) [-329.213] (-329.017) * (-330.191) (-327.882) (-330.507) [-328.189] -- 0:00:24
650000 -- (-332.123) (-333.232) (-328.404) [-329.413] * (-334.334) [-331.404] (-329.493) (-330.703) -- 0:00:24
Average standard deviation of split frequencies: 0.010143
650500 -- [-329.679] (-332.067) (-329.365) (-331.680) * (-330.159) (-327.900) (-327.679) [-330.053] -- 0:00:24
651000 -- (-331.504) (-330.235) [-327.851] (-331.110) * [-328.454] (-329.454) (-330.288) (-332.286) -- 0:00:24
651500 -- (-331.044) [-327.751] (-329.314) (-330.802) * (-328.254) [-329.106] (-329.045) (-331.215) -- 0:00:24
652000 -- (-329.531) (-330.656) [-327.737] (-328.523) * [-329.615] (-329.164) (-328.230) (-334.473) -- 0:00:24
652500 -- (-329.565) [-331.681] (-329.479) (-331.267) * [-334.228] (-328.364) (-328.916) (-331.702) -- 0:00:23
653000 -- [-328.810] (-329.057) (-328.334) (-329.673) * (-328.728) (-330.441) (-329.868) [-329.406] -- 0:00:23
653500 -- (-328.762) (-328.923) (-329.060) [-329.285] * (-329.375) (-328.596) (-329.266) [-329.973] -- 0:00:23
654000 -- [-328.478] (-328.236) (-331.787) (-329.137) * [-329.991] (-328.423) (-331.460) (-329.611) -- 0:00:23
654500 -- (-328.059) (-329.671) (-331.520) [-329.088] * [-328.642] (-328.070) (-331.576) (-332.159) -- 0:00:23
655000 -- (-330.623) (-329.910) (-328.375) [-328.682] * (-331.490) (-328.020) (-330.970) [-330.954] -- 0:00:23
Average standard deviation of split frequencies: 0.010644
655500 -- (-330.844) (-333.348) [-334.059] (-330.433) * (-329.618) (-328.985) [-328.955] (-328.613) -- 0:00:23
656000 -- (-331.234) (-330.726) [-327.813] (-330.181) * (-328.519) [-328.436] (-328.260) (-331.991) -- 0:00:23
656500 -- (-330.774) (-329.979) (-334.159) [-329.503] * (-329.318) (-333.048) [-331.762] (-328.545) -- 0:00:23
657000 -- (-330.340) (-330.200) (-331.934) [-328.848] * (-331.780) [-330.819] (-329.144) (-330.247) -- 0:00:23
657500 -- (-332.520) (-328.365) (-329.348) [-329.148] * (-330.288) [-331.759] (-329.826) (-331.825) -- 0:00:23
658000 -- (-331.922) [-329.165] (-330.164) (-331.422) * (-330.700) (-331.096) (-328.990) [-328.107] -- 0:00:23
658500 -- (-330.428) (-328.069) (-328.026) [-329.987] * (-329.223) (-336.190) (-331.207) [-330.062] -- 0:00:23
659000 -- (-330.217) (-328.745) [-327.484] (-331.655) * (-335.433) (-334.939) [-332.418] (-330.054) -- 0:00:23
659500 -- (-332.007) [-328.248] (-328.500) (-336.562) * (-336.749) [-327.620] (-327.913) (-328.803) -- 0:00:23
660000 -- (-330.240) (-327.588) [-328.318] (-331.209) * (-330.002) (-330.485) (-328.364) [-329.336] -- 0:00:23
Average standard deviation of split frequencies: 0.010346
660500 -- (-329.400) [-329.582] (-332.443) (-338.975) * [-327.961] (-331.198) (-329.381) (-332.082) -- 0:00:23
661000 -- (-329.184) (-327.588) [-328.856] (-331.511) * [-328.422] (-330.417) (-327.905) (-328.039) -- 0:00:23
661500 -- (-330.238) (-329.838) (-329.556) [-328.976] * (-330.417) (-329.898) [-328.947] (-328.179) -- 0:00:23
662000 -- [-327.427] (-331.707) (-330.208) (-329.263) * [-331.764] (-331.836) (-330.307) (-329.514) -- 0:00:22
662500 -- [-329.554] (-328.662) (-331.169) (-329.514) * [-327.882] (-330.930) (-331.713) (-328.779) -- 0:00:22
663000 -- (-329.053) (-328.859) [-329.519] (-333.666) * [-328.658] (-332.709) (-329.123) (-331.626) -- 0:00:22
663500 -- (-328.679) (-331.150) [-328.320] (-334.026) * (-333.182) (-331.170) (-329.972) [-333.118] -- 0:00:23
664000 -- [-328.544] (-328.265) (-328.920) (-329.831) * (-328.310) (-328.070) [-328.016] (-330.408) -- 0:00:23
664500 -- (-329.813) (-332.925) (-328.487) [-328.243] * (-330.263) (-329.419) (-329.330) [-329.252] -- 0:00:23
665000 -- (-327.752) (-330.813) [-328.966] (-328.681) * (-328.051) [-329.995] (-331.815) (-328.810) -- 0:00:23
Average standard deviation of split frequencies: 0.009511
665500 -- [-330.810] (-329.879) (-330.429) (-328.646) * (-329.021) (-329.436) (-331.982) [-329.017] -- 0:00:23
666000 -- (-329.744) (-331.065) (-329.361) [-329.798] * (-328.659) (-330.140) (-332.450) [-330.444] -- 0:00:23
666500 -- [-329.026] (-334.327) (-332.351) (-329.910) * (-328.447) (-330.092) [-332.708] (-330.482) -- 0:00:23
667000 -- (-328.982) (-328.600) [-329.351] (-329.349) * (-331.233) [-328.235] (-328.390) (-330.321) -- 0:00:22
667500 -- (-329.122) [-330.775] (-329.754) (-328.587) * [-329.538] (-328.938) (-329.119) (-333.669) -- 0:00:22
668000 -- (-332.455) (-328.851) [-328.968] (-328.807) * (-329.825) (-330.420) [-327.659] (-335.309) -- 0:00:22
668500 -- (-330.339) (-329.351) (-331.577) [-328.921] * (-329.004) (-330.846) [-327.692] (-329.723) -- 0:00:22
669000 -- (-330.423) (-331.145) [-328.042] (-328.724) * (-330.569) (-328.938) (-330.458) [-331.402] -- 0:00:22
669500 -- (-330.336) (-335.763) [-328.951] (-331.090) * [-329.773] (-333.312) (-330.292) (-328.555) -- 0:00:22
670000 -- (-328.985) (-330.715) [-330.565] (-336.509) * (-328.752) [-334.283] (-330.286) (-330.610) -- 0:00:22
Average standard deviation of split frequencies: 0.009006
670500 -- (-327.606) [-329.136] (-328.940) (-332.627) * (-328.459) (-328.398) (-329.260) [-328.115] -- 0:00:22
671000 -- (-327.574) (-329.083) (-328.465) [-328.526] * (-330.681) [-329.684] (-330.050) (-329.000) -- 0:00:22
671500 -- (-329.473) (-328.987) [-329.422] (-333.343) * (-330.654) [-329.394] (-328.658) (-329.320) -- 0:00:22
672000 -- (-329.517) (-331.579) (-328.683) [-331.403] * (-329.839) (-330.915) (-327.959) [-329.801] -- 0:00:22
672500 -- (-330.511) (-334.074) [-328.086] (-328.390) * (-330.506) [-332.267] (-329.111) (-329.321) -- 0:00:22
673000 -- (-332.628) (-330.656) (-329.738) [-329.541] * (-329.311) (-330.916) [-328.615] (-330.571) -- 0:00:22
673500 -- (-328.566) (-328.253) (-328.226) [-331.379] * [-328.272] (-331.503) (-329.265) (-329.218) -- 0:00:22
674000 -- (-329.249) (-330.195) [-328.071] (-329.928) * (-329.553) (-330.576) [-329.007] (-329.346) -- 0:00:22
674500 -- (-328.846) [-329.174] (-328.969) (-330.829) * (-334.690) (-330.560) (-328.990) [-331.299] -- 0:00:22
675000 -- [-331.267] (-329.454) (-328.018) (-328.563) * (-330.766) (-329.807) (-328.530) [-329.892] -- 0:00:22
Average standard deviation of split frequencies: 0.009458
675500 -- (-330.514) (-331.467) [-328.210] (-330.052) * (-332.968) (-327.881) (-330.664) [-334.640] -- 0:00:22
676000 -- (-331.067) (-330.655) (-328.084) [-331.314] * (-329.728) [-328.254] (-330.201) (-329.302) -- 0:00:22
676500 -- (-328.167) [-330.137] (-330.872) (-328.263) * [-328.280] (-327.945) (-328.271) (-328.234) -- 0:00:21
677000 -- (-330.053) [-329.429] (-329.232) (-330.568) * (-328.201) (-327.774) [-328.398] (-330.435) -- 0:00:21
677500 -- (-332.998) (-330.716) (-331.062) [-330.419] * (-330.708) (-328.881) (-328.227) [-329.191] -- 0:00:21
678000 -- (-332.342) (-332.321) [-329.633] (-329.783) * (-329.282) (-332.103) [-329.834] (-327.858) -- 0:00:22
678500 -- (-331.761) (-329.274) (-328.390) [-329.963] * (-331.564) (-327.421) [-329.835] (-328.600) -- 0:00:22
679000 -- (-327.924) (-330.246) (-328.749) [-331.233] * [-327.677] (-332.099) (-329.895) (-329.119) -- 0:00:22
679500 -- (-329.586) (-330.494) (-328.215) [-327.689] * (-330.232) (-331.911) (-329.775) [-328.860] -- 0:00:22
680000 -- (-327.931) (-332.520) (-332.757) [-328.274] * [-330.606] (-329.475) (-329.924) (-329.147) -- 0:00:22
Average standard deviation of split frequencies: 0.009739
680500 -- (-328.838) [-328.091] (-330.150) (-329.645) * (-331.080) (-331.095) (-329.955) [-328.130] -- 0:00:22
681000 -- (-330.325) (-329.800) (-328.653) [-330.552] * (-328.688) (-331.669) (-328.271) [-328.280] -- 0:00:22
681500 -- [-328.607] (-330.228) (-331.591) (-328.281) * (-328.481) [-329.510] (-330.536) (-332.545) -- 0:00:21
682000 -- (-329.454) [-331.732] (-329.800) (-334.232) * (-329.517) (-331.292) [-330.928] (-331.995) -- 0:00:21
682500 -- (-328.725) (-329.354) [-328.553] (-331.246) * [-332.927] (-329.079) (-329.144) (-328.123) -- 0:00:21
683000 -- [-327.894] (-330.027) (-328.600) (-328.040) * (-329.679) [-336.876] (-329.775) (-331.372) -- 0:00:21
683500 -- (-329.069) (-329.339) (-329.185) [-328.757] * [-328.412] (-331.853) (-330.570) (-328.252) -- 0:00:21
684000 -- [-330.965] (-328.682) (-329.184) (-332.714) * (-327.962) (-328.990) (-330.458) [-330.343] -- 0:00:21
684500 -- (-329.328) (-334.408) [-332.607] (-330.596) * (-329.490) (-328.891) (-331.188) [-329.907] -- 0:00:21
685000 -- (-330.241) [-330.157] (-330.978) (-331.109) * (-328.248) (-330.196) [-328.136] (-329.572) -- 0:00:21
Average standard deviation of split frequencies: 0.009449
685500 -- (-329.176) (-328.619) [-328.649] (-331.244) * (-328.360) [-328.567] (-330.185) (-330.832) -- 0:00:21
686000 -- (-331.293) [-331.169] (-333.117) (-327.653) * (-327.558) (-329.905) (-330.542) [-329.671] -- 0:00:21
686500 -- (-332.526) [-328.740] (-333.899) (-328.280) * [-327.743] (-331.119) (-328.920) (-328.259) -- 0:00:21
687000 -- [-328.927] (-330.767) (-328.379) (-329.218) * [-330.683] (-331.095) (-329.758) (-328.711) -- 0:00:21
687500 -- (-327.999) [-328.924] (-328.736) (-330.414) * [-328.777] (-330.298) (-327.928) (-329.115) -- 0:00:21
688000 -- (-329.579) (-331.194) (-329.253) [-330.092] * (-329.969) (-332.235) [-330.289] (-330.930) -- 0:00:21
688500 -- (-329.886) [-334.780] (-331.094) (-329.248) * (-330.881) (-330.070) (-330.972) [-329.273] -- 0:00:21
689000 -- [-333.604] (-331.991) (-328.752) (-331.007) * (-332.628) [-328.420] (-329.219) (-330.047) -- 0:00:21
689500 -- (-328.921) (-329.802) (-331.817) [-330.008] * (-330.873) (-328.486) (-329.740) [-329.652] -- 0:00:21
690000 -- (-331.073) (-329.558) [-330.012] (-329.536) * (-333.276) (-327.806) (-328.221) [-328.682] -- 0:00:21
Average standard deviation of split frequencies: 0.009641
690500 -- (-329.910) (-329.453) [-334.450] (-334.445) * (-330.388) (-327.662) [-332.035] (-329.308) -- 0:00:21
691000 -- (-332.552) (-331.786) [-332.970] (-331.261) * (-331.815) (-329.101) (-329.923) [-329.538] -- 0:00:21
691500 -- [-333.627] (-329.199) (-331.280) (-330.127) * (-328.183) (-328.306) [-329.194] (-329.846) -- 0:00:20
692000 -- (-334.015) (-330.612) [-332.807] (-329.915) * (-331.321) [-328.107] (-329.034) (-329.486) -- 0:00:20
692500 -- (-328.049) (-330.281) [-329.685] (-330.657) * (-332.184) [-330.371] (-329.132) (-329.040) -- 0:00:21
693000 -- [-329.465] (-329.737) (-331.693) (-336.811) * (-333.906) (-329.577) [-328.323] (-328.126) -- 0:00:21
693500 -- (-329.048) [-328.616] (-328.335) (-327.852) * (-335.652) (-329.144) [-329.292] (-327.995) -- 0:00:21
694000 -- (-328.904) [-329.120] (-329.310) (-328.435) * (-333.567) (-331.130) [-329.355] (-328.737) -- 0:00:21
694500 -- (-329.893) (-330.887) [-328.698] (-332.170) * (-331.568) [-328.854] (-328.541) (-329.897) -- 0:00:21
695000 -- (-329.907) (-329.747) (-328.612) [-328.443] * [-331.355] (-331.402) (-329.112) (-332.811) -- 0:00:21
Average standard deviation of split frequencies: 0.009017
695500 -- (-329.964) [-328.330] (-328.264) (-329.018) * (-329.530) (-330.267) (-328.840) [-329.536] -- 0:00:21
696000 -- [-328.659] (-327.665) (-329.729) (-330.024) * (-329.302) (-328.967) (-332.065) [-327.845] -- 0:00:20
696500 -- [-328.615] (-332.967) (-328.250) (-327.752) * (-330.991) (-333.004) (-331.591) [-330.535] -- 0:00:20
697000 -- (-330.685) [-331.116] (-329.198) (-327.935) * [-329.998] (-331.723) (-329.509) (-332.207) -- 0:00:20
697500 -- [-331.275] (-330.100) (-328.236) (-331.611) * (-329.475) (-328.653) (-327.576) [-335.784] -- 0:00:20
698000 -- (-329.880) (-331.746) (-328.087) [-332.326] * (-329.719) (-328.339) [-328.006] (-329.216) -- 0:00:20
698500 -- (-329.961) [-327.752] (-328.980) (-330.906) * (-328.149) (-328.013) (-332.917) [-329.566] -- 0:00:20
699000 -- (-331.109) (-329.561) (-330.348) [-329.940] * (-334.363) (-328.076) (-333.868) [-331.221] -- 0:00:20
699500 -- (-330.202) (-328.565) [-330.243] (-333.390) * [-327.613] (-331.674) (-330.622) (-329.590) -- 0:00:20
700000 -- (-332.717) [-336.017] (-330.855) (-330.767) * [-330.112] (-331.069) (-328.844) (-329.607) -- 0:00:20
Average standard deviation of split frequencies: 0.008208
700500 -- (-335.704) [-329.012] (-332.196) (-333.969) * (-329.661) [-329.388] (-328.905) (-332.081) -- 0:00:20
701000 -- (-328.884) (-327.955) [-331.935] (-329.286) * (-328.504) (-332.443) [-328.414] (-331.680) -- 0:00:20
701500 -- (-328.855) [-328.153] (-329.177) (-333.630) * [-330.470] (-331.134) (-333.983) (-329.164) -- 0:00:20
702000 -- [-330.290] (-328.526) (-328.825) (-328.444) * [-328.024] (-332.773) (-329.029) (-329.522) -- 0:00:20
702500 -- (-330.477) [-330.105] (-331.907) (-331.721) * (-331.430) (-331.838) [-331.691] (-330.391) -- 0:00:20
703000 -- [-328.812] (-328.379) (-331.033) (-331.924) * (-329.622) (-331.779) [-328.175] (-332.413) -- 0:00:20
703500 -- [-330.290] (-328.807) (-330.781) (-329.172) * (-330.348) [-328.277] (-328.153) (-330.856) -- 0:00:20
704000 -- (-329.506) [-328.906] (-329.538) (-336.546) * [-328.226] (-328.525) (-329.769) (-329.641) -- 0:00:20
704500 -- (-329.632) (-329.576) [-329.053] (-330.781) * [-328.399] (-329.064) (-330.504) (-329.451) -- 0:00:20
705000 -- [-329.822] (-330.508) (-329.220) (-331.206) * [-330.422] (-329.655) (-329.484) (-332.234) -- 0:00:20
Average standard deviation of split frequencies: 0.008191
705500 -- (-329.757) (-327.810) (-328.902) [-333.344] * [-329.472] (-330.785) (-329.510) (-327.493) -- 0:00:20
706000 -- (-328.007) (-333.336) [-328.397] (-328.905) * (-329.201) (-328.641) (-331.412) [-328.488] -- 0:00:19
706500 -- (-330.789) (-329.309) [-328.788] (-330.584) * [-329.393] (-329.230) (-330.361) (-328.487) -- 0:00:19
707000 -- [-330.874] (-331.248) (-328.311) (-329.659) * (-330.968) (-329.973) (-330.414) [-328.960] -- 0:00:20
707500 -- (-327.991) (-330.912) (-329.750) [-333.483] * (-334.645) [-331.436] (-333.780) (-328.514) -- 0:00:20
708000 -- (-328.118) [-330.667] (-329.391) (-332.281) * (-331.701) (-332.058) [-328.925] (-330.308) -- 0:00:20
708500 -- (-328.961) (-330.148) (-328.628) [-330.738] * (-328.450) [-330.452] (-331.890) (-328.049) -- 0:00:20
709000 -- [-333.422] (-329.682) (-329.974) (-330.109) * [-329.309] (-328.904) (-330.788) (-331.571) -- 0:00:20
709500 -- [-330.633] (-331.380) (-328.449) (-329.495) * (-330.824) [-328.029] (-329.680) (-330.701) -- 0:00:20
710000 -- [-328.516] (-328.857) (-328.822) (-327.951) * (-330.598) (-328.334) (-332.614) [-328.625] -- 0:00:20
Average standard deviation of split frequencies: 0.007916
710500 -- [-332.973] (-329.137) (-329.330) (-328.646) * (-331.971) (-328.780) (-330.445) [-330.856] -- 0:00:19
711000 -- (-329.339) [-329.603] (-330.155) (-330.624) * (-328.224) (-328.882) (-330.559) [-330.761] -- 0:00:19
711500 -- (-327.875) (-327.716) [-329.672] (-332.122) * [-330.787] (-332.316) (-329.284) (-329.371) -- 0:00:19
712000 -- [-328.070] (-328.062) (-330.248) (-328.824) * (-329.928) (-332.141) (-331.317) [-328.893] -- 0:00:19
712500 -- (-329.235) [-329.285] (-336.078) (-329.080) * (-327.749) (-331.339) (-329.247) [-328.705] -- 0:00:19
713000 -- (-330.958) [-330.191] (-333.913) (-329.839) * (-330.345) (-329.295) (-329.115) [-328.626] -- 0:00:19
713500 -- (-331.803) [-328.806] (-334.439) (-336.649) * (-333.248) (-327.892) (-331.424) [-328.773] -- 0:00:19
714000 -- [-328.897] (-332.876) (-330.914) (-330.128) * (-335.178) (-329.519) (-336.710) [-327.820] -- 0:00:19
714500 -- (-328.687) (-329.807) [-329.062] (-332.866) * (-330.000) (-328.822) [-330.851] (-331.216) -- 0:00:19
715000 -- [-328.614] (-329.257) (-329.726) (-332.325) * [-330.950] (-327.792) (-329.341) (-329.929) -- 0:00:19
Average standard deviation of split frequencies: 0.007857
715500 -- (-330.253) [-332.153] (-329.396) (-334.431) * (-333.005) [-327.662] (-327.903) (-329.423) -- 0:00:19
716000 -- (-328.615) (-328.976) (-332.579) [-329.324] * (-330.058) (-327.705) (-329.586) [-327.668] -- 0:00:19
716500 -- (-333.027) [-330.893] (-330.337) (-328.221) * (-330.843) [-329.972] (-334.451) (-329.507) -- 0:00:19
717000 -- (-330.660) (-329.055) [-332.918] (-330.308) * (-329.043) [-331.188] (-329.927) (-330.438) -- 0:00:19
717500 -- [-333.755] (-329.792) (-335.895) (-332.310) * [-330.386] (-327.982) (-333.767) (-330.185) -- 0:00:19
718000 -- (-330.493) [-329.058] (-334.882) (-330.366) * (-327.899) (-332.361) (-334.381) [-330.389] -- 0:00:19
718500 -- (-330.486) [-329.042] (-333.777) (-328.884) * [-330.432] (-329.597) (-329.035) (-330.216) -- 0:00:19
719000 -- [-331.000] (-330.579) (-332.305) (-328.606) * (-330.943) [-329.681] (-329.450) (-328.368) -- 0:00:19
719500 -- (-331.730) [-329.052] (-332.503) (-330.537) * (-328.679) (-330.852) (-328.254) [-328.144] -- 0:00:19
720000 -- (-327.697) (-331.142) (-331.006) [-329.195] * (-327.988) (-329.900) [-327.711] (-329.197) -- 0:00:19
Average standard deviation of split frequencies: 0.007152
720500 -- (-331.126) [-329.398] (-329.097) (-328.936) * (-330.081) [-328.347] (-328.551) (-330.272) -- 0:00:19
721000 -- (-330.248) (-328.601) (-330.983) [-328.884] * [-329.590] (-328.419) (-328.413) (-331.589) -- 0:00:18
721500 -- [-330.501] (-331.162) (-327.994) (-332.498) * (-331.597) (-329.389) [-330.920] (-327.916) -- 0:00:19
722000 -- (-331.871) [-331.182] (-330.977) (-327.828) * (-332.881) (-327.398) (-329.637) [-328.324] -- 0:00:19
722500 -- (-329.536) (-331.735) [-329.888] (-329.076) * [-332.194] (-328.686) (-329.981) (-328.449) -- 0:00:19
723000 -- (-330.394) (-331.293) (-328.754) [-331.154] * (-330.581) (-329.713) (-328.121) [-328.004] -- 0:00:19
723500 -- (-328.298) [-329.980] (-329.957) (-328.031) * (-328.288) (-330.389) [-331.212] (-327.569) -- 0:00:19
724000 -- (-328.466) (-328.749) (-329.623) [-328.622] * (-329.062) (-328.381) (-331.979) [-327.752] -- 0:00:19
724500 -- (-329.191) [-328.609] (-331.173) (-330.878) * [-328.239] (-331.660) (-331.314) (-328.920) -- 0:00:19
725000 -- (-330.592) (-330.699) [-328.443] (-330.715) * (-329.103) [-329.704] (-331.375) (-329.694) -- 0:00:18
Average standard deviation of split frequencies: 0.007792
725500 -- (-330.223) (-330.155) [-329.875] (-329.293) * [-329.528] (-328.552) (-329.596) (-330.057) -- 0:00:18
726000 -- (-329.994) (-330.869) (-329.833) [-328.811] * (-330.236) [-329.957] (-329.253) (-333.504) -- 0:00:18
726500 -- (-328.618) [-328.952] (-331.241) (-331.579) * [-334.397] (-329.025) (-328.712) (-332.209) -- 0:00:18
727000 -- (-329.861) [-332.034] (-329.381) (-332.169) * [-329.762] (-328.702) (-328.165) (-334.194) -- 0:00:18
727500 -- (-333.612) (-328.883) [-329.111] (-333.845) * (-329.306) (-336.753) (-327.869) [-330.762] -- 0:00:18
728000 -- (-329.027) (-331.115) [-329.990] (-329.975) * [-330.738] (-329.818) (-328.192) (-328.509) -- 0:00:18
728500 -- (-329.138) (-329.184) [-328.466] (-329.370) * [-330.366] (-333.151) (-327.817) (-328.837) -- 0:00:18
729000 -- (-328.278) (-329.003) (-332.709) [-328.597] * (-329.057) (-328.915) [-330.557] (-327.947) -- 0:00:18
729500 -- (-330.042) (-333.197) (-331.098) [-328.086] * (-332.345) (-330.319) (-329.769) [-328.567] -- 0:00:18
730000 -- (-329.936) (-328.839) [-331.424] (-328.618) * (-328.751) (-328.678) (-329.609) [-329.017] -- 0:00:18
Average standard deviation of split frequencies: 0.008731
730500 -- (-331.173) [-328.263] (-327.895) (-329.968) * [-328.877] (-332.702) (-327.846) (-327.978) -- 0:00:18
731000 -- (-330.165) [-328.003] (-328.985) (-330.505) * [-330.516] (-330.180) (-329.658) (-329.746) -- 0:00:18
731500 -- (-329.423) (-328.664) [-329.157] (-329.929) * (-333.265) (-327.897) [-328.870] (-337.811) -- 0:00:18
732000 -- [-330.092] (-327.968) (-329.165) (-328.295) * (-329.616) (-327.581) (-332.089) [-328.170] -- 0:00:18
732500 -- (-332.222) (-329.236) (-329.604) [-331.480] * (-328.569) [-328.502] (-327.860) (-331.255) -- 0:00:18
733000 -- (-328.230) [-328.509] (-329.801) (-332.852) * [-328.675] (-328.885) (-328.061) (-330.682) -- 0:00:18
733500 -- [-328.060] (-329.617) (-327.893) (-330.310) * (-330.279) (-331.665) [-331.482] (-331.050) -- 0:00:18
734000 -- (-332.574) (-329.038) (-328.564) [-330.314] * [-332.298] (-332.047) (-331.741) (-328.373) -- 0:00:18
734500 -- (-331.882) (-330.375) [-331.638] (-329.965) * (-329.959) (-331.281) (-327.886) [-328.764] -- 0:00:18
735000 -- [-329.216] (-329.713) (-332.177) (-329.012) * (-331.761) (-333.713) (-328.065) [-329.289] -- 0:00:18
Average standard deviation of split frequencies: 0.008625
735500 -- (-327.997) [-330.012] (-328.994) (-329.419) * (-332.353) [-327.718] (-331.149) (-329.202) -- 0:00:17
736000 -- (-329.649) [-329.451] (-339.184) (-330.282) * (-328.816) (-329.784) [-329.134] (-331.319) -- 0:00:18
736500 -- (-330.076) [-332.194] (-332.280) (-328.069) * (-331.293) (-330.893) (-328.731) [-331.288] -- 0:00:18
737000 -- (-329.758) (-333.811) (-333.828) [-330.527] * (-327.921) [-328.097] (-332.956) (-333.302) -- 0:00:18
737500 -- [-331.431] (-329.972) (-333.610) (-329.685) * (-328.694) (-331.102) (-332.246) [-328.632] -- 0:00:18
738000 -- (-333.495) (-329.202) (-333.998) [-329.635] * (-334.600) (-330.923) (-331.026) [-331.990] -- 0:00:18
738500 -- [-329.451] (-329.605) (-332.890) (-328.639) * (-331.196) [-328.084] (-329.886) (-329.489) -- 0:00:18
739000 -- (-328.931) [-328.779] (-329.116) (-329.986) * (-330.629) [-329.335] (-328.749) (-328.397) -- 0:00:18
739500 -- (-331.002) [-329.124] (-330.630) (-336.690) * (-330.592) [-331.115] (-330.383) (-329.018) -- 0:00:17
740000 -- (-329.730) (-330.249) [-331.800] (-330.777) * (-331.521) (-332.696) (-333.560) [-328.240] -- 0:00:17
Average standard deviation of split frequencies: 0.008232
740500 -- (-328.213) (-330.020) (-332.423) [-330.357] * (-328.550) (-332.020) (-332.753) [-330.609] -- 0:00:17
741000 -- [-331.557] (-330.880) (-331.007) (-327.987) * (-329.120) (-331.846) (-328.529) [-329.083] -- 0:00:17
741500 -- (-329.844) [-327.559] (-329.780) (-330.563) * (-331.741) (-328.758) (-329.896) [-331.068] -- 0:00:17
742000 -- (-329.419) [-327.745] (-329.334) (-331.437) * (-334.233) [-329.553] (-329.407) (-331.459) -- 0:00:17
742500 -- [-330.396] (-329.620) (-329.509) (-331.728) * (-328.946) (-329.783) (-331.717) [-330.118] -- 0:00:17
743000 -- (-328.763) (-331.077) (-328.959) [-330.299] * [-328.717] (-328.704) (-331.147) (-332.071) -- 0:00:17
743500 -- [-328.925] (-329.644) (-330.990) (-327.851) * (-330.111) [-328.159] (-328.875) (-329.549) -- 0:00:17
744000 -- (-331.500) (-329.243) [-328.917] (-330.536) * [-330.802] (-329.436) (-328.885) (-329.718) -- 0:00:17
744500 -- [-330.349] (-329.642) (-328.415) (-334.895) * [-327.896] (-328.744) (-328.290) (-328.822) -- 0:00:17
745000 -- (-331.771) (-328.820) (-329.782) [-331.003] * (-328.340) (-328.434) (-329.759) [-328.522] -- 0:00:17
Average standard deviation of split frequencies: 0.008215
745500 -- [-331.092] (-328.266) (-329.688) (-329.245) * (-330.084) (-328.493) (-329.086) [-329.456] -- 0:00:17
746000 -- (-334.653) [-328.578] (-333.070) (-329.429) * (-328.434) (-331.776) [-328.509] (-331.859) -- 0:00:17
746500 -- (-333.345) (-330.620) (-332.998) [-327.774] * (-329.125) (-329.448) (-329.612) [-329.848] -- 0:00:17
747000 -- (-332.524) [-328.895] (-328.601) (-331.667) * (-329.170) [-328.237] (-329.804) (-328.588) -- 0:00:17
747500 -- (-331.300) (-328.025) (-329.118) [-329.617] * (-328.308) (-328.826) [-329.101] (-328.581) -- 0:00:17
748000 -- (-329.042) [-329.356] (-331.012) (-328.379) * (-328.961) [-328.380] (-327.981) (-328.778) -- 0:00:17
748500 -- (-331.780) (-333.169) (-329.096) [-328.991] * (-329.510) [-333.348] (-328.991) (-329.677) -- 0:00:17
749000 -- [-329.576] (-329.602) (-330.208) (-329.054) * (-328.834) (-331.145) [-331.452] (-328.400) -- 0:00:17
749500 -- [-328.453] (-329.444) (-328.306) (-331.094) * (-331.292) [-327.799] (-329.341) (-329.845) -- 0:00:17
750000 -- (-330.680) [-329.463] (-328.323) (-331.396) * [-329.908] (-329.134) (-329.566) (-329.448) -- 0:00:17
Average standard deviation of split frequencies: 0.008708
750500 -- (-330.338) [-331.518] (-330.555) (-329.169) * [-328.633] (-329.827) (-330.311) (-328.420) -- 0:00:17
751000 -- (-331.378) (-328.741) [-330.211] (-329.376) * [-330.952] (-329.950) (-329.937) (-329.493) -- 0:00:17
751500 -- [-331.549] (-332.233) (-328.396) (-327.983) * (-333.292) (-330.433) (-333.260) [-330.042] -- 0:00:17
752000 -- [-329.397] (-327.406) (-330.033) (-327.995) * (-335.058) (-331.930) (-330.115) [-330.098] -- 0:00:17
752500 -- [-333.045] (-330.198) (-333.374) (-331.506) * (-336.224) (-330.081) [-329.663] (-332.643) -- 0:00:17
753000 -- (-329.570) (-330.345) [-329.638] (-331.850) * (-331.958) (-329.907) [-330.736] (-334.386) -- 0:00:17
753500 -- [-329.279] (-328.629) (-328.653) (-330.361) * (-335.136) [-328.473] (-329.861) (-329.082) -- 0:00:17
754000 -- (-330.154) (-328.819) (-328.999) [-327.820] * (-332.959) (-328.810) [-328.195] (-329.129) -- 0:00:16
754500 -- [-327.970] (-328.921) (-330.637) (-329.287) * (-332.675) [-333.093] (-328.100) (-331.669) -- 0:00:16
755000 -- (-332.649) (-329.906) [-329.483] (-328.439) * [-331.064] (-335.497) (-329.036) (-330.377) -- 0:00:16
Average standard deviation of split frequencies: 0.008771
755500 -- (-330.905) (-328.781) (-327.969) [-330.821] * [-328.186] (-330.533) (-334.995) (-331.483) -- 0:00:16
756000 -- (-329.986) [-331.817] (-327.594) (-331.380) * [-330.587] (-328.936) (-328.119) (-332.269) -- 0:00:16
756500 -- [-330.218] (-328.381) (-330.381) (-328.525) * [-330.588] (-331.804) (-328.977) (-332.276) -- 0:00:16
757000 -- (-333.667) (-330.113) [-328.989] (-329.815) * (-329.587) (-332.542) [-328.833] (-330.820) -- 0:00:16
757500 -- [-331.513] (-331.122) (-331.496) (-332.406) * [-328.783] (-330.034) (-327.810) (-327.711) -- 0:00:16
758000 -- [-329.295] (-333.869) (-329.587) (-329.070) * [-328.511] (-330.344) (-327.919) (-330.033) -- 0:00:16
758500 -- [-333.715] (-327.580) (-331.559) (-328.323) * (-328.953) (-332.111) [-330.568] (-330.320) -- 0:00:16
759000 -- [-330.215] (-331.603) (-328.059) (-332.058) * [-328.190] (-330.510) (-329.459) (-331.365) -- 0:00:16
759500 -- [-327.624] (-332.478) (-329.757) (-329.980) * (-330.814) [-330.870] (-333.190) (-328.767) -- 0:00:16
760000 -- (-332.606) (-334.173) (-327.592) [-328.021] * (-329.385) [-329.707] (-334.172) (-332.371) -- 0:00:16
Average standard deviation of split frequencies: 0.009048
760500 -- (-332.725) [-336.733] (-336.351) (-328.791) * [-331.386] (-330.029) (-332.805) (-334.065) -- 0:00:16
761000 -- [-331.823] (-330.953) (-332.146) (-328.863) * [-330.802] (-336.878) (-328.896) (-331.457) -- 0:00:16
761500 -- (-332.038) (-331.585) (-330.750) [-328.903] * [-331.884] (-330.288) (-329.220) (-328.843) -- 0:00:16
762000 -- (-330.740) (-329.504) [-331.008] (-329.029) * (-328.982) [-328.063] (-328.523) (-329.509) -- 0:00:16
762500 -- [-328.526] (-332.185) (-331.689) (-328.749) * (-330.261) (-328.094) (-330.126) [-331.124] -- 0:00:16
763000 -- (-327.741) (-332.889) [-330.116] (-328.963) * [-331.130] (-329.421) (-332.209) (-337.569) -- 0:00:16
763500 -- [-328.645] (-330.450) (-331.393) (-331.775) * [-329.817] (-333.099) (-332.654) (-329.958) -- 0:00:16
764000 -- [-328.525] (-327.977) (-330.150) (-330.670) * (-334.028) [-333.649] (-332.263) (-333.227) -- 0:00:16
764500 -- (-329.672) [-329.492] (-331.451) (-330.141) * (-335.924) [-328.317] (-330.242) (-329.552) -- 0:00:16
765000 -- (-331.183) [-329.172] (-328.459) (-330.519) * (-331.881) (-329.860) (-334.528) [-328.932] -- 0:00:15
Average standard deviation of split frequencies: 0.008985
765500 -- (-329.661) [-330.498] (-329.368) (-329.810) * (-329.164) (-327.671) (-337.736) [-330.448] -- 0:00:16
766000 -- (-332.257) [-331.676] (-331.056) (-333.754) * (-331.323) (-327.589) [-329.321] (-330.999) -- 0:00:16
766500 -- (-329.012) (-331.719) [-331.006] (-334.250) * (-331.636) [-328.441] (-330.931) (-330.031) -- 0:00:16
767000 -- [-328.370] (-332.771) (-331.708) (-329.048) * (-330.310) [-328.899] (-332.159) (-327.933) -- 0:00:16
767500 -- (-328.931) (-331.624) (-330.505) [-331.427] * (-330.084) (-330.366) (-328.085) [-329.458] -- 0:00:16
768000 -- (-332.776) (-331.011) [-331.746] (-331.257) * (-328.735) (-330.331) [-328.052] (-332.195) -- 0:00:16
768500 -- (-332.291) [-329.860] (-329.156) (-330.968) * (-329.807) (-328.752) [-329.399] (-333.755) -- 0:00:15
769000 -- [-332.513] (-328.910) (-328.774) (-328.846) * (-329.265) [-331.512] (-329.943) (-332.777) -- 0:00:15
769500 -- [-328.572] (-328.270) (-329.228) (-330.551) * [-335.727] (-331.205) (-331.190) (-330.727) -- 0:00:15
770000 -- (-330.768) [-331.709] (-330.245) (-328.895) * (-329.031) (-332.078) [-330.099] (-327.784) -- 0:00:15
Average standard deviation of split frequencies: 0.008849
770500 -- [-331.267] (-329.079) (-330.123) (-329.863) * (-328.362) (-330.300) [-330.959] (-332.293) -- 0:00:15
771000 -- (-329.123) (-330.335) [-329.560] (-331.378) * (-328.058) (-332.692) [-332.494] (-331.383) -- 0:00:15
771500 -- [-330.775] (-327.947) (-330.393) (-332.938) * [-329.585] (-328.659) (-330.547) (-329.671) -- 0:00:15
772000 -- (-328.166) (-331.540) [-329.924] (-335.234) * (-329.300) (-329.408) (-339.283) [-329.185] -- 0:00:15
772500 -- (-329.280) (-330.033) [-328.165] (-332.163) * [-335.759] (-331.960) (-331.955) (-332.173) -- 0:00:15
773000 -- (-329.690) (-329.758) [-328.010] (-335.056) * [-329.153] (-331.361) (-329.250) (-329.275) -- 0:00:15
773500 -- (-330.274) [-330.322] (-330.999) (-328.479) * (-338.032) [-330.981] (-329.678) (-330.444) -- 0:00:15
774000 -- (-328.465) (-329.066) [-327.983] (-329.978) * (-329.065) (-330.154) [-328.768] (-332.814) -- 0:00:15
774500 -- [-328.287] (-332.660) (-331.638) (-328.055) * (-331.354) [-329.057] (-330.370) (-329.648) -- 0:00:15
775000 -- (-332.174) (-329.468) [-330.137] (-329.930) * (-328.852) (-327.768) (-327.482) [-331.249] -- 0:00:15
Average standard deviation of split frequencies: 0.008829
775500 -- [-329.636] (-331.131) (-328.903) (-331.655) * [-332.995] (-332.602) (-331.051) (-333.628) -- 0:00:15
776000 -- (-331.071) (-328.654) [-328.530] (-332.595) * (-329.545) [-329.245] (-331.661) (-329.891) -- 0:00:15
776500 -- (-328.633) (-328.066) [-330.155] (-330.344) * (-331.368) (-328.908) (-328.986) [-334.589] -- 0:00:15
777000 -- (-328.390) [-329.235] (-331.899) (-329.167) * [-330.331] (-330.327) (-331.874) (-328.715) -- 0:00:15
777500 -- (-331.887) [-329.362] (-330.514) (-330.324) * (-327.664) (-335.066) (-333.903) [-329.705] -- 0:00:15
778000 -- (-329.364) [-331.083] (-331.539) (-329.931) * (-330.141) (-330.664) (-328.515) [-333.325] -- 0:00:15
778500 -- (-330.096) (-332.681) (-333.697) [-331.019] * [-328.169] (-331.941) (-330.202) (-332.294) -- 0:00:15
779000 -- [-328.296] (-334.646) (-329.985) (-330.432) * (-328.398) (-332.997) [-330.192] (-328.877) -- 0:00:15
779500 -- (-328.448) [-328.987] (-329.041) (-330.610) * (-328.791) [-331.312] (-329.290) (-332.758) -- 0:00:14
780000 -- (-331.098) (-328.902) [-331.929] (-330.561) * (-328.470) (-337.947) (-329.557) [-330.197] -- 0:00:15
Average standard deviation of split frequencies: 0.009098
780500 -- [-331.188] (-330.086) (-333.770) (-331.675) * (-330.407) [-329.439] (-328.938) (-328.776) -- 0:00:15
781000 -- [-328.964] (-329.750) (-330.840) (-329.065) * (-328.674) [-327.860] (-332.584) (-331.523) -- 0:00:15
781500 -- (-327.440) (-331.333) (-329.114) [-327.922] * [-329.052] (-330.084) (-328.879) (-331.463) -- 0:00:15
782000 -- (-332.981) (-330.554) (-331.705) [-330.695] * (-330.074) (-327.835) [-328.221] (-332.030) -- 0:00:15
782500 -- (-332.030) (-329.371) [-335.109] (-330.009) * (-330.967) (-327.607) [-329.151] (-331.447) -- 0:00:15
783000 -- (-327.811) [-330.829] (-331.811) (-329.315) * [-328.770] (-332.041) (-328.787) (-330.096) -- 0:00:14
783500 -- [-328.123] (-330.464) (-331.849) (-331.919) * [-328.100] (-331.851) (-332.118) (-327.823) -- 0:00:14
784000 -- (-327.927) (-329.146) (-328.746) [-329.026] * (-327.467) (-331.409) (-328.469) [-329.346] -- 0:00:14
784500 -- (-330.875) (-333.396) (-330.146) [-328.179] * (-327.379) [-331.710] (-330.572) (-332.871) -- 0:00:14
785000 -- (-328.914) [-329.470] (-327.848) (-328.397) * (-328.513) (-330.959) (-334.295) [-328.973] -- 0:00:14
Average standard deviation of split frequencies: 0.009316
785500 -- (-331.224) (-329.427) (-328.525) [-328.615] * (-329.527) [-328.435] (-331.995) (-330.167) -- 0:00:14
786000 -- [-329.184] (-328.319) (-328.717) (-328.051) * (-329.499) (-330.990) (-331.691) [-329.319] -- 0:00:14
786500 -- (-330.177) (-335.329) (-328.498) [-330.276] * (-333.211) (-329.921) (-332.368) [-330.236] -- 0:00:14
787000 -- (-331.434) [-328.578] (-331.448) (-331.676) * (-335.205) (-332.617) [-328.621] (-328.966) -- 0:00:14
787500 -- (-329.365) (-329.319) (-332.555) [-331.447] * (-330.483) [-335.737] (-330.257) (-329.906) -- 0:00:14
788000 -- (-336.293) (-328.979) (-328.390) [-330.333] * (-329.788) [-332.797] (-328.312) (-330.456) -- 0:00:14
788500 -- (-328.407) (-328.299) (-329.434) [-329.166] * [-331.074] (-329.710) (-328.368) (-328.557) -- 0:00:14
789000 -- [-329.283] (-330.934) (-330.012) (-329.056) * (-329.296) (-332.297) [-329.201] (-329.631) -- 0:00:14
789500 -- (-327.767) (-331.363) (-332.444) [-331.411] * (-333.925) (-332.565) [-328.448] (-328.510) -- 0:00:14
790000 -- (-327.962) (-332.085) [-327.707] (-332.330) * (-329.599) [-330.508] (-332.484) (-331.293) -- 0:00:14
Average standard deviation of split frequencies: 0.009182
790500 -- (-329.995) [-327.467] (-327.498) (-338.540) * (-335.103) (-328.662) [-332.287] (-328.870) -- 0:00:14
791000 -- (-329.319) (-331.271) (-331.494) [-330.045] * (-332.991) (-328.113) [-330.247] (-330.582) -- 0:00:14
791500 -- (-329.500) [-329.687] (-328.558) (-329.451) * (-330.320) [-330.537] (-329.757) (-328.151) -- 0:00:14
792000 -- (-329.624) (-338.377) [-331.525] (-329.044) * (-327.786) (-330.182) [-330.066] (-330.178) -- 0:00:14
792500 -- [-330.071] (-329.394) (-332.687) (-330.336) * [-328.505] (-330.153) (-331.972) (-327.982) -- 0:00:14
793000 -- (-332.151) (-331.873) (-328.961) [-330.466] * [-328.187] (-329.159) (-331.115) (-328.651) -- 0:00:14
793500 -- (-331.122) [-330.696] (-328.343) (-330.885) * (-330.131) [-329.424] (-331.056) (-331.151) -- 0:00:14
794000 -- (-329.442) (-333.199) (-330.772) [-333.656] * (-331.250) (-328.711) [-328.585] (-328.193) -- 0:00:14
794500 -- (-329.757) (-329.836) (-328.957) [-336.788] * (-332.285) (-327.611) [-328.233] (-328.615) -- 0:00:14
795000 -- [-329.607] (-328.737) (-329.656) (-327.782) * (-330.669) [-328.687] (-333.013) (-330.388) -- 0:00:14
Average standard deviation of split frequencies: 0.008962
795500 -- (-328.444) (-328.769) (-329.430) [-328.502] * (-330.439) [-329.737] (-332.116) (-334.386) -- 0:00:14
796000 -- (-328.639) (-338.409) [-329.082] (-328.643) * (-329.583) (-329.377) (-334.347) [-329.950] -- 0:00:14
796500 -- (-329.129) [-332.277] (-329.789) (-329.228) * [-328.126] (-329.840) (-329.373) (-328.995) -- 0:00:14
797000 -- (-328.541) (-329.587) [-329.761] (-330.139) * (-327.820) [-332.117] (-331.145) (-328.295) -- 0:00:14
797500 -- (-330.145) [-329.460] (-329.444) (-328.855) * (-329.370) (-334.540) [-329.088] (-327.531) -- 0:00:13
798000 -- (-330.437) [-328.534] (-327.437) (-332.354) * [-329.438] (-328.821) (-329.862) (-332.424) -- 0:00:13
798500 -- (-334.818) [-332.332] (-329.704) (-332.447) * (-330.067) (-330.081) [-328.927] (-328.619) -- 0:00:13
799000 -- [-332.438] (-329.462) (-328.438) (-328.958) * (-330.622) (-332.906) [-328.982] (-328.656) -- 0:00:13
799500 -- (-329.978) [-329.007] (-330.789) (-328.446) * [-330.449] (-331.356) (-332.032) (-331.816) -- 0:00:13
800000 -- [-329.077] (-330.352) (-331.667) (-332.408) * [-334.118] (-327.988) (-329.416) (-327.854) -- 0:00:13
Average standard deviation of split frequencies: 0.009106
800500 -- (-331.187) [-328.799] (-329.563) (-329.953) * (-332.423) (-328.842) [-334.367] (-329.302) -- 0:00:13
801000 -- (-328.990) [-329.561] (-329.568) (-327.975) * (-335.086) [-327.785] (-328.771) (-331.384) -- 0:00:13
801500 -- (-330.716) [-328.974] (-330.206) (-329.847) * [-328.411] (-327.581) (-327.929) (-329.404) -- 0:00:13
802000 -- [-328.281] (-327.652) (-330.924) (-329.855) * (-329.620) [-327.905] (-330.143) (-329.999) -- 0:00:13
802500 -- (-328.115) (-332.694) (-329.681) [-328.410] * (-333.407) (-327.836) [-329.512] (-328.064) -- 0:00:13
803000 -- (-331.902) [-331.257] (-333.701) (-333.441) * (-332.624) (-328.142) (-330.642) [-328.808] -- 0:00:13
803500 -- (-329.714) (-329.787) [-327.618] (-331.590) * (-332.844) (-328.246) [-332.675] (-328.191) -- 0:00:13
804000 -- (-330.201) [-328.686] (-328.202) (-328.238) * (-329.360) (-327.835) (-329.343) [-330.598] -- 0:00:13
804500 -- (-331.632) [-329.612] (-330.124) (-329.151) * [-328.262] (-328.928) (-331.351) (-329.638) -- 0:00:13
805000 -- (-328.753) (-327.949) [-328.923] (-329.131) * [-327.626] (-329.416) (-334.825) (-332.737) -- 0:00:13
Average standard deviation of split frequencies: 0.008617
805500 -- (-330.106) (-328.496) [-328.770] (-330.679) * (-328.505) [-329.868] (-333.772) (-329.028) -- 0:00:13
806000 -- [-331.546] (-329.505) (-328.373) (-331.667) * (-328.770) [-328.487] (-332.904) (-329.800) -- 0:00:13
806500 -- (-331.757) [-327.935] (-328.526) (-333.912) * (-330.236) (-330.523) [-330.997] (-328.649) -- 0:00:13
807000 -- (-327.678) (-332.990) (-328.726) [-333.698] * (-329.436) [-331.884] (-328.679) (-330.717) -- 0:00:13
807500 -- (-327.787) [-329.125] (-328.735) (-331.488) * (-330.141) (-335.236) [-329.843] (-329.545) -- 0:00:13
808000 -- (-330.295) (-330.446) (-331.981) [-331.348] * (-330.085) (-331.071) (-330.619) [-328.575] -- 0:00:13
808500 -- (-329.228) [-328.444] (-328.218) (-331.009) * (-331.536) (-331.016) (-328.467) [-330.624] -- 0:00:13
809000 -- [-329.365] (-328.867) (-331.207) (-329.314) * (-328.822) (-333.518) (-331.094) [-329.948] -- 0:00:13
809500 -- [-331.412] (-329.208) (-328.969) (-328.251) * (-329.029) (-330.288) (-329.447) [-330.835] -- 0:00:13
810000 -- (-328.569) (-331.749) [-333.279] (-329.037) * (-329.065) [-328.299] (-330.706) (-330.354) -- 0:00:13
Average standard deviation of split frequencies: 0.008490
810500 -- (-329.067) (-329.248) (-331.045) [-329.845] * (-328.572) (-329.654) (-329.258) [-329.365] -- 0:00:13
811000 -- (-328.364) (-329.222) (-333.455) [-329.982] * (-327.672) [-330.190] (-330.705) (-328.590) -- 0:00:13
811500 -- [-331.214] (-331.242) (-330.276) (-328.376) * (-329.112) (-329.210) (-332.710) [-332.658] -- 0:00:13
812000 -- [-328.694] (-332.667) (-329.781) (-331.142) * [-328.894] (-330.847) (-327.835) (-332.657) -- 0:00:12
812500 -- (-331.874) (-331.870) (-335.587) [-329.817] * (-329.455) [-328.325] (-329.155) (-330.230) -- 0:00:12
813000 -- (-330.104) (-332.308) (-337.832) [-334.362] * (-330.563) [-330.186] (-328.635) (-333.799) -- 0:00:12
813500 -- (-331.164) (-333.311) (-332.615) [-329.132] * [-330.393] (-329.538) (-330.157) (-327.832) -- 0:00:12
814000 -- (-330.470) [-332.652] (-335.940) (-328.449) * (-333.259) (-328.145) [-330.613] (-331.748) -- 0:00:12
814500 -- (-328.964) (-330.239) [-328.751] (-328.647) * (-329.360) [-329.653] (-330.946) (-330.500) -- 0:00:12
815000 -- (-332.715) (-328.291) (-327.476) [-329.677] * (-332.497) [-331.017] (-329.484) (-328.845) -- 0:00:12
Average standard deviation of split frequencies: 0.008242
815500 -- (-332.061) [-330.326] (-332.598) (-329.949) * [-328.053] (-332.601) (-330.212) (-332.662) -- 0:00:12
816000 -- (-331.801) (-328.872) (-329.951) [-327.816] * (-329.096) [-329.577] (-329.885) (-333.045) -- 0:00:12
816500 -- (-336.563) (-329.863) [-328.917] (-331.040) * (-331.036) (-331.542) (-330.330) [-331.006] -- 0:00:12
817000 -- (-330.149) (-328.874) [-328.138] (-331.937) * (-329.107) [-330.491] (-328.754) (-328.896) -- 0:00:12
817500 -- [-327.692] (-328.785) (-330.808) (-331.884) * (-330.126) (-328.709) (-331.590) [-327.851] -- 0:00:12
818000 -- (-329.146) (-328.762) [-329.781] (-330.550) * (-328.737) (-329.159) (-329.513) [-331.022] -- 0:00:12
818500 -- (-330.080) (-328.337) (-328.699) [-329.950] * (-328.437) (-330.387) [-329.114] (-332.041) -- 0:00:12
819000 -- [-328.343] (-330.812) (-331.822) (-329.857) * [-333.610] (-333.650) (-331.579) (-332.328) -- 0:00:12
819500 -- (-331.699) (-333.783) (-333.666) [-330.564] * (-330.041) (-329.306) [-328.250] (-334.528) -- 0:00:12
820000 -- [-328.898] (-329.656) (-334.641) (-333.324) * (-329.525) (-328.174) [-328.994] (-329.620) -- 0:00:12
Average standard deviation of split frequencies: 0.008846
820500 -- (-329.654) (-330.273) [-330.103] (-330.989) * [-330.805] (-331.140) (-330.080) (-329.133) -- 0:00:12
821000 -- [-328.804] (-329.389) (-329.294) (-329.197) * (-330.224) (-337.491) [-328.440] (-329.541) -- 0:00:12
821500 -- (-330.130) (-328.045) [-329.169] (-332.705) * (-330.856) [-329.349] (-334.499) (-327.495) -- 0:00:12
822000 -- (-328.413) [-329.636] (-329.174) (-333.586) * (-330.283) (-328.747) [-328.320] (-328.780) -- 0:00:12
822500 -- (-328.830) (-328.775) [-330.907] (-331.474) * (-329.218) [-328.532] (-331.984) (-328.569) -- 0:00:12
823000 -- [-330.114] (-333.193) (-332.720) (-334.407) * (-328.140) [-328.848] (-329.182) (-329.262) -- 0:00:12
823500 -- (-330.483) (-328.839) [-330.344] (-330.278) * (-330.047) (-328.787) [-330.999] (-330.687) -- 0:00:12
824000 -- [-327.939] (-329.286) (-334.466) (-333.563) * (-332.435) (-328.875) [-328.260] (-331.709) -- 0:00:12
824500 -- [-327.852] (-328.554) (-334.074) (-330.669) * (-328.308) (-330.370) [-329.433] (-334.992) -- 0:00:12
825000 -- (-328.328) (-329.859) (-334.562) [-331.819] * [-331.130] (-328.050) (-330.792) (-333.045) -- 0:00:12
Average standard deviation of split frequencies: 0.008941
825500 -- (-328.988) (-329.785) [-328.853] (-328.842) * (-334.220) [-327.771] (-329.508) (-327.688) -- 0:00:12
826000 -- (-329.465) [-331.179] (-330.889) (-328.306) * (-331.516) (-329.500) [-329.071] (-330.831) -- 0:00:12
826500 -- (-327.753) [-328.642] (-331.246) (-330.496) * [-328.132] (-333.686) (-329.934) (-328.727) -- 0:00:11
827000 -- (-329.658) [-327.656] (-328.005) (-329.753) * (-327.906) (-330.231) [-329.309] (-328.981) -- 0:00:11
827500 -- (-328.985) (-329.967) (-328.169) [-327.659] * (-329.558) (-328.660) [-328.729] (-327.673) -- 0:00:11
828000 -- [-327.824] (-328.582) (-329.186) (-328.185) * [-334.742] (-329.128) (-330.401) (-328.279) -- 0:00:11
828500 -- [-329.442] (-330.706) (-331.307) (-330.561) * (-329.627) (-327.824) (-331.933) [-330.301] -- 0:00:11
829000 -- [-327.771] (-329.061) (-328.335) (-329.692) * [-330.155] (-328.254) (-330.869) (-330.171) -- 0:00:11
829500 -- (-328.308) (-328.874) (-328.422) [-333.583] * (-329.008) [-328.835] (-338.631) (-329.704) -- 0:00:11
830000 -- [-328.339] (-332.157) (-330.684) (-331.092) * (-328.508) [-328.507] (-328.610) (-331.644) -- 0:00:11
Average standard deviation of split frequencies: 0.009231
830500 -- (-328.247) (-330.856) (-329.633) [-329.490] * (-334.618) [-330.141] (-329.768) (-329.518) -- 0:00:11
831000 -- [-329.361] (-328.326) (-333.422) (-328.855) * (-331.311) [-330.170] (-330.166) (-329.123) -- 0:00:11
831500 -- (-330.696) [-328.888] (-330.554) (-328.108) * (-328.953) (-332.074) (-329.308) [-328.752] -- 0:00:11
832000 -- (-328.115) (-328.029) (-328.501) [-328.967] * (-334.966) [-330.548] (-329.340) (-327.593) -- 0:00:11
832500 -- (-328.384) (-330.054) [-328.008] (-327.604) * (-331.074) [-331.184] (-328.582) (-330.593) -- 0:00:11
833000 -- [-328.779] (-333.733) (-328.215) (-328.837) * (-335.876) (-332.899) [-328.489] (-328.406) -- 0:00:11
833500 -- [-332.256] (-328.481) (-328.615) (-331.858) * (-339.524) (-332.745) (-333.240) [-327.994] -- 0:00:11
834000 -- (-330.263) (-327.549) [-327.774] (-328.040) * [-329.405] (-329.661) (-331.752) (-328.361) -- 0:00:11
834500 -- (-328.905) (-330.177) (-329.651) [-330.197] * (-328.131) (-328.124) (-329.285) [-328.890] -- 0:00:11
835000 -- (-333.523) [-329.851] (-330.998) (-331.039) * [-330.170] (-331.820) (-330.596) (-330.647) -- 0:00:11
Average standard deviation of split frequencies: 0.008759
835500 -- [-329.765] (-330.888) (-328.651) (-333.149) * (-330.418) [-331.001] (-328.511) (-329.338) -- 0:00:11
836000 -- (-328.828) [-329.546] (-328.437) (-328.503) * (-334.820) (-329.479) (-328.688) [-328.033] -- 0:00:11
836500 -- [-328.270] (-329.668) (-328.775) (-329.481) * (-327.432) [-330.718] (-327.585) (-328.690) -- 0:00:11
837000 -- [-328.202] (-329.947) (-330.002) (-328.020) * (-331.267) [-328.323] (-330.947) (-332.237) -- 0:00:11
837500 -- [-328.186] (-330.065) (-328.573) (-328.356) * (-329.836) [-330.513] (-332.632) (-333.355) -- 0:00:11
838000 -- [-329.378] (-333.976) (-329.061) (-329.781) * (-332.414) (-331.078) (-328.446) [-328.773] -- 0:00:11
838500 -- [-332.604] (-327.873) (-331.364) (-329.654) * (-332.424) (-329.528) (-331.188) [-327.839] -- 0:00:11
839000 -- (-335.844) (-330.635) [-329.856] (-329.121) * (-331.098) (-328.125) (-329.586) [-329.576] -- 0:00:11
839500 -- [-328.411] (-332.546) (-331.059) (-328.910) * (-327.724) [-329.120] (-329.158) (-329.705) -- 0:00:11
840000 -- [-328.546] (-332.409) (-330.115) (-328.508) * [-329.726] (-329.570) (-330.585) (-330.450) -- 0:00:11
Average standard deviation of split frequencies: 0.009047
840500 -- (-329.148) (-332.552) (-329.225) [-333.300] * (-329.879) (-330.254) (-328.313) [-330.417] -- 0:00:11
841000 -- (-329.679) (-334.808) [-330.456] (-331.288) * (-329.110) [-329.212] (-333.969) (-332.789) -- 0:00:10
841500 -- (-331.972) (-332.021) (-332.761) [-329.646] * (-328.049) [-330.239] (-331.799) (-331.354) -- 0:00:10
842000 -- (-331.379) (-331.845) (-331.182) [-329.345] * (-338.208) (-331.675) (-328.962) [-328.522] -- 0:00:10
842500 -- (-332.689) (-330.572) (-328.676) [-328.552] * (-330.856) (-327.894) [-331.661] (-328.708) -- 0:00:10
843000 -- [-328.137] (-329.461) (-329.078) (-328.893) * (-327.643) (-328.533) (-331.488) [-328.843] -- 0:00:10
843500 -- (-331.164) (-330.949) [-330.044] (-328.779) * [-328.180] (-328.501) (-329.962) (-328.830) -- 0:00:10
844000 -- (-331.727) (-333.052) [-330.155] (-328.029) * (-330.505) (-328.546) (-331.566) [-329.835] -- 0:00:10
844500 -- (-332.049) (-330.096) (-328.488) [-328.601] * (-331.714) (-329.375) [-333.131] (-329.080) -- 0:00:10
845000 -- (-330.401) (-330.271) [-328.074] (-330.045) * (-328.799) [-329.728] (-330.859) (-330.850) -- 0:00:10
Average standard deviation of split frequencies: 0.008804
845500 -- (-329.480) (-329.603) (-332.211) [-330.131] * (-329.948) (-330.232) [-329.466] (-329.585) -- 0:00:10
846000 -- [-329.069] (-330.633) (-329.154) (-329.614) * (-331.223) (-329.600) (-331.923) [-327.722] -- 0:00:10
846500 -- (-333.267) (-333.758) (-329.963) [-330.848] * (-330.094) [-330.900] (-329.784) (-329.364) -- 0:00:10
847000 -- [-329.287] (-328.240) (-330.630) (-332.656) * (-332.406) (-330.598) [-328.943] (-328.785) -- 0:00:10
847500 -- (-330.019) [-331.945] (-329.185) (-329.721) * (-336.157) [-328.549] (-328.942) (-328.349) -- 0:00:10
848000 -- (-329.000) (-329.501) (-329.463) [-329.557] * (-329.793) (-329.170) [-330.058] (-329.374) -- 0:00:10
848500 -- [-333.777] (-329.438) (-329.759) (-331.304) * (-329.309) (-331.203) (-330.557) [-328.982] -- 0:00:10
849000 -- (-338.229) (-328.220) [-328.673] (-329.888) * (-329.903) [-330.970] (-331.043) (-331.621) -- 0:00:10
849500 -- (-334.839) (-331.686) (-327.645) [-328.563] * (-331.648) (-329.659) [-330.317] (-329.562) -- 0:00:10
850000 -- (-330.448) (-328.701) (-328.660) [-328.798] * (-329.294) (-328.634) [-330.030] (-327.806) -- 0:00:10
Average standard deviation of split frequencies: 0.008497
850500 -- (-334.008) (-331.565) (-329.891) [-327.812] * (-332.320) (-330.629) (-329.654) [-327.952] -- 0:00:10
851000 -- (-327.852) (-330.459) [-329.812] (-329.493) * (-341.260) (-329.780) (-332.557) [-328.895] -- 0:00:10
851500 -- [-329.030] (-331.346) (-328.256) (-330.948) * (-335.188) [-331.601] (-331.246) (-327.968) -- 0:00:10
852000 -- (-328.635) (-331.538) [-331.390] (-327.945) * (-334.146) (-332.655) [-330.931] (-329.653) -- 0:00:10
852500 -- [-328.162] (-329.391) (-329.457) (-328.803) * (-330.215) (-329.996) (-327.941) [-329.230] -- 0:00:10
853000 -- (-328.589) [-328.279] (-330.772) (-330.175) * [-329.458] (-329.062) (-327.926) (-331.038) -- 0:00:10
853500 -- [-333.291] (-329.674) (-332.857) (-331.897) * [-328.656] (-330.145) (-328.604) (-330.093) -- 0:00:10
854000 -- (-333.023) [-330.234] (-332.553) (-331.129) * (-330.497) [-333.890] (-329.322) (-330.443) -- 0:00:10
854500 -- (-332.400) (-328.532) (-330.280) [-328.019] * (-330.946) (-331.791) [-329.074] (-334.499) -- 0:00:10
855000 -- (-332.009) [-327.665] (-329.750) (-330.705) * (-331.308) (-330.576) [-328.815] (-330.133) -- 0:00:10
Average standard deviation of split frequencies: 0.008664
855500 -- (-329.821) (-329.995) (-328.177) [-329.982] * (-330.257) (-330.952) (-330.101) [-328.567] -- 0:00:09
856000 -- (-330.340) (-330.194) (-329.333) [-329.207] * (-334.363) (-328.995) (-329.227) [-329.438] -- 0:00:09
856500 -- (-331.626) (-330.438) (-328.238) [-329.900] * (-332.300) (-328.883) [-337.474] (-327.933) -- 0:00:09
857000 -- (-328.559) (-330.714) [-330.105] (-331.560) * (-330.632) [-328.734] (-329.210) (-329.012) -- 0:00:09
857500 -- (-332.576) [-328.820] (-327.948) (-329.600) * (-331.595) (-331.539) [-329.611] (-332.033) -- 0:00:09
858000 -- [-332.332] (-329.598) (-328.303) (-336.967) * (-336.820) [-329.377] (-332.484) (-330.800) -- 0:00:09
858500 -- (-331.754) (-329.260) (-329.764) [-328.337] * (-332.438) (-328.170) (-330.932) [-331.932] -- 0:00:09
859000 -- (-333.112) (-330.333) (-328.132) [-328.931] * (-329.018) [-327.649] (-331.425) (-332.179) -- 0:00:09
859500 -- (-332.848) [-333.164] (-329.547) (-331.004) * (-327.730) (-334.170) (-329.528) [-331.425] -- 0:00:09
860000 -- (-331.770) (-327.492) [-328.861] (-330.106) * [-327.984] (-329.844) (-335.421) (-331.328) -- 0:00:09
Average standard deviation of split frequencies: 0.008654
860500 -- (-328.525) [-328.894] (-329.426) (-331.536) * (-328.697) [-327.915] (-331.012) (-328.889) -- 0:00:09
861000 -- [-330.907] (-329.774) (-328.762) (-329.287) * (-328.851) (-331.121) [-329.485] (-329.601) -- 0:00:09
861500 -- [-329.437] (-327.817) (-330.839) (-331.178) * (-334.090) (-329.030) (-330.032) [-329.343] -- 0:00:09
862000 -- (-328.858) [-328.410] (-334.610) (-338.481) * (-328.419) [-328.779] (-328.147) (-329.309) -- 0:00:09
862500 -- (-328.620) (-328.583) [-332.078] (-331.964) * [-331.558] (-329.421) (-331.363) (-329.528) -- 0:00:09
863000 -- (-333.245) (-328.891) (-329.099) [-328.996] * (-330.173) [-331.087] (-328.656) (-333.602) -- 0:00:09
863500 -- (-329.740) [-329.640] (-330.019) (-331.716) * (-331.463) (-329.823) (-329.382) [-329.866] -- 0:00:09
864000 -- (-330.695) [-329.795] (-328.881) (-329.639) * (-332.056) (-329.350) [-327.639] (-329.017) -- 0:00:09
864500 -- [-330.638] (-328.082) (-328.494) (-339.031) * [-329.178] (-332.886) (-327.505) (-330.463) -- 0:00:09
865000 -- (-330.613) [-331.379] (-333.498) (-331.809) * (-329.804) (-332.251) (-332.537) [-329.465] -- 0:00:09
Average standard deviation of split frequencies: 0.008456
865500 -- (-328.968) (-332.432) (-329.418) [-329.322] * (-334.820) [-332.060] (-329.022) (-330.924) -- 0:00:09
866000 -- (-329.858) (-329.370) (-329.378) [-334.972] * (-329.655) (-332.312) (-329.469) [-328.491] -- 0:00:09
866500 -- (-330.801) [-333.454] (-330.413) (-330.685) * [-330.292] (-330.528) (-329.139) (-328.841) -- 0:00:09
867000 -- [-330.525] (-328.123) (-330.996) (-330.980) * [-328.287] (-329.513) (-330.214) (-329.047) -- 0:00:09
867500 -- (-332.707) [-328.912] (-330.779) (-332.703) * (-330.848) (-328.333) (-333.266) [-329.115] -- 0:00:09
868000 -- (-328.708) (-329.333) (-330.051) [-327.799] * (-328.450) (-332.556) (-328.154) [-329.138] -- 0:00:09
868500 -- (-341.120) (-327.635) [-328.207] (-327.799) * [-328.409] (-330.691) (-329.985) (-331.871) -- 0:00:09
869000 -- (-331.151) [-328.143] (-328.030) (-329.780) * (-328.214) (-330.896) [-329.291] (-329.717) -- 0:00:09
869500 -- (-331.702) (-331.305) [-331.879] (-327.650) * [-327.337] (-330.220) (-329.867) (-329.055) -- 0:00:09
870000 -- (-329.068) [-331.676] (-329.553) (-328.482) * (-330.592) (-328.950) [-330.221] (-331.112) -- 0:00:08
Average standard deviation of split frequencies: 0.008302
870500 -- [-330.104] (-328.769) (-329.320) (-329.484) * [-331.242] (-333.534) (-329.555) (-333.244) -- 0:00:08
871000 -- (-330.697) (-329.037) [-331.901] (-328.474) * (-332.639) [-329.506] (-328.576) (-331.979) -- 0:00:08
871500 -- (-331.218) (-329.114) [-329.814] (-328.464) * (-330.997) (-331.359) [-333.545] (-332.743) -- 0:00:08
872000 -- (-329.352) (-328.275) [-328.977] (-328.013) * (-328.823) [-329.546] (-330.538) (-330.996) -- 0:00:08
872500 -- (-329.848) [-330.848] (-328.842) (-331.403) * (-328.326) [-329.997] (-331.264) (-331.485) -- 0:00:08
873000 -- (-332.393) (-329.091) [-330.742] (-329.446) * [-328.793] (-330.306) (-329.021) (-331.035) -- 0:00:08
873500 -- (-328.343) (-328.189) [-328.343] (-329.681) * [-328.720] (-328.555) (-329.441) (-329.250) -- 0:00:08
874000 -- (-335.679) (-328.637) (-332.100) [-327.942] * (-328.314) [-332.088] (-328.924) (-330.163) -- 0:00:08
874500 -- [-330.072] (-336.637) (-329.071) (-329.047) * (-327.909) (-329.810) (-329.028) [-331.065] -- 0:00:08
875000 -- (-331.951) (-331.351) (-330.089) [-330.002] * [-330.909] (-329.308) (-329.075) (-333.814) -- 0:00:08
Average standard deviation of split frequencies: 0.008395
875500 -- (-335.991) [-328.055] (-328.730) (-333.877) * (-329.900) (-327.648) (-329.655) [-328.337] -- 0:00:08
876000 -- [-331.922] (-330.141) (-328.510) (-329.185) * [-334.264] (-330.680) (-330.818) (-332.516) -- 0:00:08
876500 -- (-331.833) [-329.879] (-328.218) (-330.817) * [-330.367] (-332.288) (-330.297) (-328.635) -- 0:00:08
877000 -- (-333.434) [-329.167] (-332.163) (-330.869) * (-328.675) [-330.499] (-331.412) (-327.919) -- 0:00:08
877500 -- [-331.204] (-328.720) (-337.186) (-328.671) * (-328.955) (-329.159) (-332.368) [-329.419] -- 0:00:08
878000 -- [-327.965] (-330.649) (-329.776) (-329.376) * (-330.783) (-331.680) (-329.258) [-330.703] -- 0:00:08
878500 -- [-331.120] (-331.384) (-327.858) (-332.773) * (-328.190) (-329.713) [-333.524] (-329.775) -- 0:00:08
879000 -- (-329.777) (-329.676) [-329.393] (-330.089) * (-328.910) [-329.727] (-329.856) (-329.937) -- 0:00:08
879500 -- (-332.603) [-328.911] (-331.037) (-329.169) * [-327.841] (-329.675) (-327.834) (-331.393) -- 0:00:08
880000 -- (-328.980) [-327.766] (-332.750) (-332.522) * (-329.511) (-333.592) [-329.005] (-330.599) -- 0:00:08
Average standard deviation of split frequencies: 0.007958
880500 -- [-328.923] (-328.542) (-330.780) (-330.458) * (-330.585) (-331.997) [-336.758] (-328.322) -- 0:00:08
881000 -- (-329.514) [-330.011] (-327.683) (-328.292) * (-330.169) (-333.600) [-333.996] (-329.111) -- 0:00:08
881500 -- [-329.660] (-332.062) (-328.175) (-328.294) * [-328.370] (-328.613) (-328.604) (-331.649) -- 0:00:08
882000 -- (-328.408) (-330.578) [-328.546] (-329.154) * (-328.222) (-329.100) (-329.935) [-328.666] -- 0:00:08
882500 -- (-328.049) (-328.859) (-328.811) [-328.196] * (-328.925) (-328.225) [-328.774] (-329.069) -- 0:00:08
883000 -- (-329.416) (-330.048) (-330.281) [-328.218] * (-328.941) (-329.505) (-328.321) [-329.319] -- 0:00:08
883500 -- (-330.966) (-332.009) (-334.682) [-327.808] * [-327.738] (-333.141) (-332.917) (-333.546) -- 0:00:08
884000 -- (-330.735) [-329.179] (-331.347) (-329.169) * (-333.535) (-329.172) (-335.479) [-330.465] -- 0:00:08
884500 -- [-328.854] (-330.644) (-330.962) (-329.983) * [-333.580] (-327.971) (-329.811) (-329.959) -- 0:00:07
885000 -- (-328.264) (-329.178) (-328.678) [-329.795] * (-329.343) (-328.771) (-329.194) [-330.763] -- 0:00:07
Average standard deviation of split frequencies: 0.008477
885500 -- (-329.328) (-329.644) (-331.781) [-331.942] * (-329.519) [-330.739] (-329.807) (-334.862) -- 0:00:07
886000 -- (-327.557) [-332.886] (-330.673) (-330.930) * (-330.354) [-332.667] (-332.581) (-328.114) -- 0:00:07
886500 -- (-328.502) (-329.777) [-332.540] (-330.910) * (-328.564) (-331.973) (-332.232) [-327.616] -- 0:00:07
887000 -- [-331.288] (-329.760) (-332.004) (-330.617) * (-332.161) (-330.845) [-330.666] (-329.621) -- 0:00:07
887500 -- (-329.052) [-330.190] (-333.750) (-329.763) * (-330.525) (-332.549) (-329.929) [-330.528] -- 0:00:07
888000 -- (-331.708) (-333.238) (-332.231) [-329.133] * (-329.480) (-327.947) (-328.788) [-327.705] -- 0:00:07
888500 -- (-329.132) (-332.153) [-329.480] (-328.043) * (-328.973) [-331.447] (-332.262) (-328.913) -- 0:00:07
889000 -- (-327.973) [-330.128] (-328.367) (-330.401) * (-329.608) (-329.564) [-333.672] (-331.817) -- 0:00:07
889500 -- (-330.322) (-331.324) [-328.352] (-329.547) * (-328.004) (-329.941) [-330.405] (-329.618) -- 0:00:07
890000 -- (-329.449) (-335.483) (-333.894) [-329.729] * (-331.763) (-328.643) [-329.654] (-331.489) -- 0:00:07
Average standard deviation of split frequencies: 0.008398
890500 -- [-328.562] (-333.095) (-329.640) (-334.179) * (-329.652) [-328.733] (-330.840) (-331.328) -- 0:00:07
891000 -- (-329.261) [-336.261] (-329.365) (-328.554) * (-330.513) (-328.139) (-331.195) [-332.857] -- 0:00:07
891500 -- (-329.867) (-331.796) [-331.059] (-333.773) * [-329.606] (-327.859) (-328.353) (-328.078) -- 0:00:07
892000 -- [-330.203] (-329.651) (-331.973) (-334.868) * (-331.635) [-328.682] (-328.726) (-328.163) -- 0:00:07
892500 -- (-331.130) [-329.728] (-328.773) (-332.217) * (-329.492) (-328.912) (-328.645) [-328.639] -- 0:00:07
893000 -- (-328.675) (-328.186) (-327.461) [-328.901] * (-329.603) (-330.662) (-330.274) [-330.456] -- 0:00:07
893500 -- [-331.239] (-329.067) (-330.790) (-329.602) * (-330.271) (-329.734) [-330.980] (-328.570) -- 0:00:07
894000 -- (-330.297) (-329.011) (-331.282) [-330.106] * (-328.664) [-328.367] (-330.897) (-330.564) -- 0:00:07
894500 -- (-333.113) (-329.714) [-331.379] (-330.584) * (-329.198) [-328.286] (-331.663) (-333.087) -- 0:00:07
895000 -- (-332.226) [-330.388] (-330.266) (-334.293) * [-328.480] (-330.588) (-329.052) (-335.336) -- 0:00:07
Average standard deviation of split frequencies: 0.007857
895500 -- [-331.158] (-332.034) (-329.322) (-329.339) * [-328.891] (-329.176) (-329.263) (-337.328) -- 0:00:07
896000 -- (-330.619) (-331.567) [-328.422] (-329.054) * [-328.598] (-327.959) (-329.326) (-331.415) -- 0:00:07
896500 -- (-331.184) (-330.463) [-329.924] (-329.125) * (-329.529) (-327.842) (-333.018) [-327.631] -- 0:00:07
897000 -- (-331.483) (-328.525) [-329.936] (-330.692) * [-328.338] (-329.743) (-331.984) (-329.010) -- 0:00:07
897500 -- (-329.715) [-334.033] (-333.629) (-330.574) * (-328.356) (-329.225) (-329.740) [-330.144] -- 0:00:07
898000 -- (-328.874) (-329.059) [-333.379] (-329.960) * (-328.573) [-329.018] (-329.941) (-329.180) -- 0:00:07
898500 -- (-327.671) (-333.054) [-331.035] (-330.604) * [-328.656] (-328.087) (-328.438) (-328.581) -- 0:00:07
899000 -- (-330.125) (-330.960) [-328.763] (-330.696) * (-330.008) [-330.190] (-328.307) (-330.509) -- 0:00:06
899500 -- (-328.388) [-329.515] (-329.386) (-332.634) * (-330.996) (-330.607) [-329.750] (-329.876) -- 0:00:06
900000 -- [-328.410] (-335.187) (-328.689) (-329.026) * (-329.656) (-329.999) [-328.917] (-330.559) -- 0:00:06
Average standard deviation of split frequencies: 0.007537
900500 -- (-328.435) (-330.811) (-330.432) [-329.668] * (-327.930) (-329.884) [-327.842] (-328.196) -- 0:00:06
901000 -- (-333.543) (-329.337) [-329.335] (-330.612) * (-331.164) (-330.146) (-328.310) [-329.104] -- 0:00:06
901500 -- [-329.543] (-330.440) (-331.215) (-328.186) * (-336.558) (-329.707) [-330.544] (-331.836) -- 0:00:06
902000 -- (-328.230) (-331.961) [-334.203] (-332.366) * [-332.607] (-328.841) (-330.194) (-328.495) -- 0:00:06
902500 -- [-329.663] (-339.866) (-332.963) (-328.142) * (-332.642) (-328.751) (-334.135) [-329.802] -- 0:00:06
903000 -- (-329.942) (-334.944) (-328.814) [-328.308] * (-335.240) (-327.952) (-334.117) [-329.615] -- 0:00:06
903500 -- (-328.832) (-328.050) (-328.208) [-329.299] * (-330.616) (-328.360) (-332.225) [-330.807] -- 0:00:06
904000 -- (-330.339) (-331.020) (-328.416) [-330.101] * (-331.681) [-331.820] (-330.772) (-328.495) -- 0:00:06
904500 -- (-328.519) (-332.246) [-328.255] (-328.380) * (-328.180) (-329.530) [-328.076] (-333.604) -- 0:00:06
905000 -- (-328.985) (-329.198) [-328.147] (-328.815) * (-329.230) [-329.766] (-330.551) (-332.552) -- 0:00:06
Average standard deviation of split frequencies: 0.007111
905500 -- (-330.278) [-328.251] (-328.097) (-332.636) * (-331.144) (-328.609) (-331.174) [-333.955] -- 0:00:06
906000 -- (-329.361) (-333.314) (-331.934) [-332.998] * (-331.663) [-332.576] (-330.327) (-329.470) -- 0:00:06
906500 -- (-329.371) [-330.411] (-334.257) (-328.899) * (-328.604) (-329.530) [-327.902] (-329.288) -- 0:00:06
907000 -- (-329.882) (-332.658) [-329.211] (-330.831) * [-328.180] (-328.651) (-329.434) (-329.130) -- 0:00:06
907500 -- (-331.371) (-331.106) [-328.882] (-332.874) * (-328.617) (-327.580) [-329.500] (-330.124) -- 0:00:06
908000 -- (-329.029) (-332.576) [-328.075] (-329.499) * (-331.370) [-330.792] (-331.603) (-328.378) -- 0:00:06
908500 -- [-329.587] (-333.000) (-331.504) (-328.570) * (-330.137) [-327.616] (-332.734) (-331.841) -- 0:00:06
909000 -- (-333.259) (-330.587) (-331.612) [-330.117] * [-328.253] (-329.806) (-332.000) (-329.374) -- 0:00:06
909500 -- (-329.695) (-332.358) [-332.658] (-328.462) * (-329.828) (-329.210) (-329.349) [-327.951] -- 0:00:06
910000 -- [-328.941] (-333.045) (-328.318) (-329.030) * (-329.994) (-330.948) [-327.674] (-331.597) -- 0:00:06
Average standard deviation of split frequencies: 0.006936
910500 -- [-328.823] (-331.209) (-329.524) (-329.970) * [-327.884] (-328.846) (-329.511) (-327.708) -- 0:00:06
911000 -- [-330.030] (-329.522) (-330.287) (-331.896) * (-329.832) [-329.293] (-329.329) (-328.670) -- 0:00:06
911500 -- (-329.543) (-330.347) (-334.169) [-329.417] * (-329.348) [-329.307] (-329.947) (-331.615) -- 0:00:06
912000 -- (-329.469) (-333.142) (-337.231) [-329.425] * (-330.880) (-329.985) [-329.258] (-342.376) -- 0:00:06
912500 -- (-331.511) [-332.346] (-331.430) (-329.916) * (-333.182) (-330.637) [-331.448] (-328.753) -- 0:00:06
913000 -- [-330.356] (-328.990) (-328.135) (-332.311) * (-335.082) (-331.054) (-330.884) [-331.316] -- 0:00:06
913500 -- (-330.147) [-331.307] (-329.377) (-330.222) * (-329.575) (-327.635) (-329.797) [-331.054] -- 0:00:05
914000 -- (-332.825) (-331.018) [-328.727] (-328.449) * (-330.849) [-327.827] (-327.717) (-330.149) -- 0:00:05
914500 -- (-328.112) (-330.235) [-328.730] (-336.116) * [-329.825] (-330.273) (-328.864) (-330.106) -- 0:00:05
915000 -- (-329.362) (-330.419) [-328.600] (-328.297) * (-332.187) (-331.696) [-331.712] (-328.273) -- 0:00:05
Average standard deviation of split frequencies: 0.007136
915500 -- (-329.212) (-329.162) (-333.023) [-330.301] * (-330.449) (-333.063) [-328.670] (-329.768) -- 0:00:05
916000 -- [-328.610] (-328.936) (-328.166) (-331.840) * [-332.219] (-329.158) (-329.391) (-328.409) -- 0:00:05
916500 -- [-330.503] (-329.050) (-331.737) (-331.448) * (-330.597) (-329.369) (-328.748) [-329.549] -- 0:00:05
917000 -- (-329.909) [-329.665] (-329.574) (-329.109) * [-332.137] (-329.034) (-333.174) (-329.155) -- 0:00:05
917500 -- (-332.497) [-328.390] (-328.086) (-329.766) * [-333.602] (-330.649) (-329.132) (-329.237) -- 0:00:05
918000 -- (-329.574) (-335.572) (-328.723) [-328.402] * (-331.097) (-330.296) (-331.455) [-329.263] -- 0:00:05
918500 -- [-328.657] (-333.858) (-328.738) (-330.009) * [-329.431] (-329.945) (-331.867) (-329.667) -- 0:00:05
919000 -- (-331.984) [-330.041] (-329.615) (-329.827) * (-330.293) (-328.776) (-329.554) [-327.990] -- 0:00:05
919500 -- (-337.185) [-329.984] (-328.485) (-329.885) * [-329.434] (-331.405) (-327.810) (-327.993) -- 0:00:05
920000 -- [-330.087] (-329.123) (-329.265) (-329.565) * (-329.050) [-333.150] (-332.787) (-328.034) -- 0:00:05
Average standard deviation of split frequencies: 0.007100
920500 -- [-328.691] (-329.097) (-329.182) (-330.759) * (-329.254) (-328.590) [-330.972] (-334.577) -- 0:00:05
921000 -- [-327.751] (-330.322) (-331.542) (-329.471) * (-330.914) [-329.674] (-334.312) (-329.665) -- 0:00:05
921500 -- [-329.019] (-332.487) (-330.598) (-333.981) * (-331.392) (-328.905) [-331.557] (-334.880) -- 0:00:05
922000 -- [-329.895] (-328.785) (-329.230) (-331.541) * (-328.224) [-328.705] (-330.018) (-331.763) -- 0:00:05
922500 -- (-331.626) (-331.364) [-328.178] (-333.887) * (-332.533) (-330.493) (-329.422) [-331.468] -- 0:00:05
923000 -- [-328.795] (-329.005) (-331.711) (-328.192) * (-337.464) (-329.279) (-328.072) [-330.942] -- 0:00:05
923500 -- (-333.481) [-330.168] (-329.040) (-329.707) * [-327.909] (-329.061) (-329.396) (-330.710) -- 0:00:05
924000 -- (-329.427) (-329.607) (-330.406) [-328.302] * [-329.213] (-327.949) (-335.108) (-330.006) -- 0:00:05
924500 -- (-329.715) [-330.679] (-328.381) (-328.438) * [-330.539] (-333.125) (-330.084) (-334.746) -- 0:00:05
925000 -- (-328.769) (-332.168) [-332.462] (-334.996) * [-328.686] (-333.052) (-331.360) (-333.078) -- 0:00:05
Average standard deviation of split frequencies: 0.007161
925500 -- (-327.886) (-329.237) [-336.496] (-330.645) * (-327.537) (-336.131) [-331.546] (-331.603) -- 0:00:05
926000 -- [-329.314] (-330.826) (-332.910) (-331.099) * (-329.790) [-328.915] (-333.319) (-331.196) -- 0:00:05
926500 -- [-330.216] (-329.765) (-331.631) (-328.330) * [-331.044] (-327.561) (-329.537) (-328.717) -- 0:00:05
927000 -- (-330.764) [-329.125] (-329.101) (-327.776) * (-331.174) (-329.337) (-335.168) [-331.142] -- 0:00:05
927500 -- (-329.832) (-329.818) (-328.445) [-328.867] * (-332.112) (-328.212) (-333.649) [-327.744] -- 0:00:05
928000 -- (-328.670) (-329.375) [-328.763] (-328.449) * (-331.449) (-332.480) (-327.899) [-327.373] -- 0:00:04
928500 -- (-329.927) (-332.853) (-333.034) [-330.165] * (-332.873) (-333.620) [-330.116] (-328.948) -- 0:00:04
929000 -- (-328.233) [-331.165] (-329.414) (-333.015) * (-331.947) [-330.044] (-336.419) (-330.394) -- 0:00:04
929500 -- (-329.312) (-328.719) (-331.837) [-330.652] * (-329.259) (-327.994) (-331.084) [-328.520] -- 0:00:04
930000 -- (-330.558) (-332.827) (-331.739) [-331.071] * (-334.319) (-333.544) [-330.735] (-330.824) -- 0:00:04
Average standard deviation of split frequencies: 0.007361
930500 -- [-333.774] (-332.254) (-332.386) (-327.784) * (-333.037) (-332.009) [-328.822] (-328.635) -- 0:00:04
931000 -- [-329.947] (-329.525) (-330.244) (-328.484) * (-331.091) [-331.783] (-335.487) (-331.066) -- 0:00:04
931500 -- (-329.093) (-330.868) [-331.266] (-327.564) * (-331.369) (-331.055) (-332.286) [-332.725] -- 0:00:04
932000 -- [-330.636] (-328.725) (-333.144) (-330.399) * (-327.640) (-330.263) (-329.068) [-331.938] -- 0:00:04
932500 -- (-328.375) (-330.638) (-329.579) [-330.261] * [-329.327] (-333.144) (-329.798) (-329.894) -- 0:00:04
933000 -- (-329.844) (-330.300) (-332.574) [-328.401] * (-331.182) (-337.002) (-329.392) [-330.442] -- 0:00:04
933500 -- (-328.689) (-334.214) (-331.587) [-328.622] * [-329.439] (-333.629) (-330.073) (-328.076) -- 0:00:04
934000 -- (-329.592) [-332.135] (-327.911) (-331.355) * (-329.737) [-329.310] (-327.729) (-328.345) -- 0:00:04
934500 -- (-329.958) [-332.362] (-328.434) (-331.244) * (-331.525) [-331.738] (-328.689) (-330.969) -- 0:00:04
935000 -- [-330.206] (-328.339) (-327.935) (-330.468) * [-328.478] (-330.008) (-332.902) (-328.381) -- 0:00:04
Average standard deviation of split frequencies: 0.006883
935500 -- [-331.132] (-328.769) (-328.511) (-329.416) * (-329.670) [-327.519] (-333.032) (-329.746) -- 0:00:04
936000 -- (-330.496) (-330.168) [-330.937] (-329.188) * (-332.012) (-328.963) (-330.154) [-331.894] -- 0:00:04
936500 -- [-330.895] (-328.637) (-330.422) (-329.288) * (-328.410) (-328.828) [-331.208] (-329.021) -- 0:00:04
937000 -- (-330.552) (-332.877) [-332.494] (-330.381) * (-330.604) [-328.575] (-333.114) (-331.535) -- 0:00:04
937500 -- (-331.770) (-331.276) (-331.152) [-328.679] * (-330.642) [-327.953] (-330.120) (-328.429) -- 0:00:04
938000 -- (-331.333) (-334.046) [-332.387] (-332.119) * (-334.685) [-329.732] (-332.380) (-331.643) -- 0:00:04
938500 -- (-328.797) (-333.536) (-329.495) [-332.198] * [-329.582] (-330.358) (-329.475) (-333.145) -- 0:00:04
939000 -- [-330.644] (-327.794) (-329.202) (-328.193) * [-329.828] (-330.040) (-331.624) (-334.427) -- 0:00:04
939500 -- (-330.871) [-327.770] (-331.904) (-328.790) * (-330.304) (-328.764) [-329.721] (-327.936) -- 0:00:04
940000 -- (-329.081) [-333.530] (-329.956) (-327.889) * (-328.744) [-328.203] (-330.560) (-328.636) -- 0:00:04
Average standard deviation of split frequencies: 0.007016
940500 -- (-330.505) (-335.290) (-330.524) [-328.605] * (-331.056) (-329.493) [-333.514] (-331.004) -- 0:00:04
941000 -- (-332.001) (-333.143) (-330.425) [-328.036] * (-332.183) (-330.053) [-329.157] (-331.290) -- 0:00:04
941500 -- (-331.564) (-330.013) (-328.433) [-329.069] * (-329.135) (-328.328) (-330.441) [-327.998] -- 0:00:04
942000 -- [-329.736] (-330.627) (-330.251) (-333.022) * [-330.496] (-333.594) (-330.520) (-329.329) -- 0:00:04
942500 -- [-328.588] (-328.608) (-327.788) (-333.804) * (-327.879) (-332.543) (-330.236) [-329.483] -- 0:00:03
943000 -- (-329.669) (-327.831) [-328.743] (-331.499) * [-330.511] (-330.445) (-330.165) (-330.647) -- 0:00:03
943500 -- (-330.934) (-328.842) [-329.963] (-333.448) * (-329.023) (-329.375) [-330.318] (-330.211) -- 0:00:03
944000 -- (-330.154) [-328.619] (-330.947) (-328.514) * (-331.745) [-328.483] (-329.668) (-335.215) -- 0:00:03
944500 -- (-330.049) [-332.113] (-328.416) (-329.336) * [-329.061] (-329.155) (-330.986) (-330.472) -- 0:00:03
945000 -- [-328.684] (-331.063) (-328.798) (-330.493) * (-329.410) (-330.662) (-334.229) [-329.483] -- 0:00:03
Average standard deviation of split frequencies: 0.006644
945500 -- (-331.006) (-329.138) [-332.306] (-330.852) * (-332.520) [-331.098] (-331.661) (-328.190) -- 0:00:03
946000 -- [-330.632] (-328.057) (-333.347) (-331.006) * (-338.615) (-331.478) (-335.286) [-327.747] -- 0:00:03
946500 -- [-329.547] (-328.044) (-330.194) (-330.242) * (-328.765) (-329.409) [-329.370] (-330.297) -- 0:00:03
947000 -- (-328.560) [-329.943] (-333.025) (-329.835) * (-333.885) (-330.304) [-327.377] (-329.371) -- 0:00:03
947500 -- [-328.766] (-328.654) (-331.650) (-330.982) * (-334.355) [-330.202] (-327.834) (-330.271) -- 0:00:03
948000 -- [-331.750] (-330.065) (-331.366) (-328.958) * (-330.795) (-330.129) (-328.025) [-332.790] -- 0:00:03
948500 -- [-329.507] (-332.191) (-331.134) (-330.240) * (-327.985) (-331.457) [-329.670] (-328.933) -- 0:00:03
949000 -- (-331.962) (-329.650) (-332.174) [-329.333] * (-328.138) (-329.491) [-330.547] (-332.377) -- 0:00:03
949500 -- [-328.015] (-329.971) (-328.540) (-335.014) * [-328.963] (-328.161) (-329.810) (-327.672) -- 0:00:03
950000 -- (-333.011) (-332.317) (-330.952) [-328.758] * (-328.286) (-329.577) [-329.018] (-329.174) -- 0:00:03
Average standard deviation of split frequencies: 0.006446
950500 -- [-328.886] (-332.035) (-331.643) (-330.631) * (-328.324) (-331.048) [-329.266] (-328.326) -- 0:00:03
951000 -- [-328.984] (-328.820) (-330.192) (-330.251) * (-332.271) (-327.956) [-327.632] (-329.153) -- 0:00:03
951500 -- (-327.892) (-331.090) (-332.523) [-331.519] * (-330.357) (-328.778) (-329.371) [-330.424] -- 0:00:03
952000 -- [-328.941] (-329.780) (-330.617) (-328.573) * (-329.133) [-329.157] (-333.853) (-332.602) -- 0:00:03
952500 -- (-331.212) (-328.549) (-327.654) [-329.100] * (-330.598) [-329.848] (-331.200) (-333.558) -- 0:00:03
953000 -- (-331.313) (-333.281) [-328.482] (-329.061) * (-329.584) [-332.361] (-328.823) (-332.689) -- 0:00:03
953500 -- [-333.059] (-332.400) (-328.496) (-328.410) * (-328.886) (-331.895) (-330.449) [-330.181] -- 0:00:03
954000 -- (-332.097) (-329.486) (-327.985) [-331.225] * [-329.234] (-331.971) (-330.252) (-330.336) -- 0:00:03
954500 -- [-329.956] (-329.892) (-329.212) (-332.089) * (-328.695) (-330.510) (-327.746) [-328.416] -- 0:00:03
955000 -- [-328.601] (-329.635) (-327.455) (-329.413) * (-329.035) (-329.329) [-332.411] (-332.763) -- 0:00:03
Average standard deviation of split frequencies: 0.007035
955500 -- (-328.082) [-330.611] (-330.323) (-329.231) * (-331.547) [-329.380] (-328.222) (-329.875) -- 0:00:03
956000 -- (-327.864) (-331.809) (-330.121) [-329.657] * [-329.261] (-331.002) (-329.551) (-329.841) -- 0:00:03
956500 -- (-328.070) (-332.342) [-328.947] (-329.664) * (-329.027) (-330.706) [-335.656] (-330.952) -- 0:00:03
957000 -- [-328.881] (-332.887) (-329.685) (-330.507) * [-329.658] (-329.002) (-329.917) (-329.468) -- 0:00:02
957500 -- (-331.086) [-330.541] (-330.059) (-329.490) * (-333.934) [-329.715] (-328.779) (-331.185) -- 0:00:02
958000 -- (-330.776) (-330.159) (-330.748) [-329.500] * (-330.357) (-328.643) [-328.923] (-333.212) -- 0:00:02
958500 -- (-328.556) (-328.934) [-328.477] (-330.230) * (-335.190) [-330.050] (-330.474) (-333.110) -- 0:00:02
959000 -- (-330.340) (-330.482) [-332.268] (-330.530) * (-329.000) (-331.752) (-330.004) [-329.910] -- 0:00:02
959500 -- (-332.280) [-330.989] (-328.692) (-329.298) * (-330.670) (-335.338) (-331.302) [-329.702] -- 0:00:02
960000 -- (-331.965) (-329.591) (-330.246) [-330.272] * (-333.422) (-329.106) [-331.813] (-328.615) -- 0:00:02
Average standard deviation of split frequencies: 0.007328
960500 -- (-329.331) (-328.174) [-329.266] (-328.839) * (-332.156) (-329.909) [-329.321] (-333.854) -- 0:00:02
961000 -- (-328.607) [-331.266] (-328.638) (-329.113) * (-330.075) (-330.145) (-329.490) [-328.692] -- 0:00:02
961500 -- (-329.149) (-328.762) (-327.908) [-331.591] * (-327.845) [-327.982] (-331.212) (-328.349) -- 0:00:02
962000 -- (-328.131) (-331.707) (-331.246) [-331.397] * (-328.630) (-328.381) [-329.099] (-328.691) -- 0:00:02
962500 -- (-330.499) [-329.372] (-329.814) (-329.094) * [-329.872] (-329.368) (-330.839) (-329.819) -- 0:00:02
963000 -- (-331.475) (-328.126) [-330.413] (-329.290) * (-329.411) (-330.860) [-334.004] (-328.887) -- 0:00:02
963500 -- (-334.457) (-328.816) (-330.133) [-329.224] * (-332.553) (-329.292) [-332.434] (-327.774) -- 0:00:02
964000 -- [-330.000] (-328.223) (-331.883) (-330.060) * [-327.911] (-328.274) (-328.806) (-327.438) -- 0:00:02
964500 -- [-330.689] (-329.430) (-328.825) (-331.154) * (-329.635) (-330.766) (-328.190) [-329.543] -- 0:00:02
965000 -- [-328.320] (-328.425) (-329.147) (-330.946) * [-328.392] (-327.689) (-329.358) (-329.433) -- 0:00:02
Average standard deviation of split frequencies: 0.007287
965500 -- (-331.417) (-328.604) (-327.726) [-328.002] * [-328.932] (-328.704) (-331.758) (-332.534) -- 0:00:02
966000 -- (-335.458) (-328.295) [-328.432] (-328.259) * [-330.357] (-329.582) (-329.501) (-327.601) -- 0:00:02
966500 -- (-329.774) [-332.133] (-328.617) (-328.251) * (-328.063) (-330.794) (-329.088) [-328.357] -- 0:00:02
967000 -- (-330.933) (-333.879) [-328.970] (-330.097) * [-329.418] (-330.099) (-329.551) (-328.367) -- 0:00:02
967500 -- (-332.468) (-329.545) (-331.637) [-328.474] * (-327.569) (-332.225) (-328.950) [-328.723] -- 0:00:02
968000 -- (-334.001) (-328.314) [-328.782] (-333.256) * (-329.112) (-327.869) [-328.946] (-329.681) -- 0:00:02
968500 -- (-331.739) (-328.162) (-328.674) [-331.301] * (-334.252) (-328.828) [-328.124] (-332.722) -- 0:00:02
969000 -- (-327.810) [-328.956] (-329.766) (-329.761) * (-329.665) (-329.839) (-329.211) [-328.285] -- 0:00:02
969500 -- (-331.408) (-332.509) [-331.218] (-327.642) * [-332.477] (-329.447) (-330.793) (-330.129) -- 0:00:02
970000 -- [-330.148] (-328.233) (-331.909) (-329.087) * [-329.916] (-332.284) (-327.891) (-334.682) -- 0:00:02
Average standard deviation of split frequencies: 0.007123
970500 -- (-328.600) [-328.170] (-329.097) (-328.965) * (-329.022) [-329.647] (-328.189) (-330.959) -- 0:00:02
971000 -- (-331.276) (-337.048) [-330.106] (-327.732) * (-329.317) (-329.637) (-329.073) [-328.337] -- 0:00:02
971500 -- (-329.218) [-329.101] (-330.826) (-329.009) * (-329.202) (-335.989) (-331.458) [-328.828] -- 0:00:01
972000 -- (-329.207) [-330.145] (-330.522) (-332.746) * [-328.866] (-331.919) (-331.627) (-329.095) -- 0:00:01
972500 -- (-330.003) (-331.426) [-329.747] (-330.418) * (-327.476) (-331.548) [-331.384] (-333.206) -- 0:00:01
973000 -- (-327.979) (-328.672) (-329.510) [-330.877] * (-329.474) (-330.458) (-328.836) [-329.360] -- 0:00:01
973500 -- [-330.656] (-329.341) (-329.464) (-328.516) * (-328.669) (-329.373) [-329.031] (-330.386) -- 0:00:01
974000 -- [-328.194] (-328.797) (-327.814) (-328.808) * (-327.894) (-328.003) [-333.664] (-331.627) -- 0:00:01
974500 -- (-331.750) (-329.411) [-329.374] (-330.789) * [-329.654] (-329.434) (-335.275) (-328.472) -- 0:00:01
975000 -- (-332.622) (-330.353) (-332.046) [-329.484] * [-328.210] (-330.761) (-328.550) (-328.745) -- 0:00:01
Average standard deviation of split frequencies: 0.007116
975500 -- [-332.566] (-329.057) (-334.900) (-330.900) * [-329.603] (-332.138) (-329.299) (-329.422) -- 0:00:01
976000 -- [-329.773] (-331.484) (-329.666) (-331.751) * (-333.324) (-333.827) [-330.524] (-329.048) -- 0:00:01
976500 -- (-330.060) (-332.244) (-329.628) [-329.102] * (-329.751) (-329.093) [-328.204] (-328.814) -- 0:00:01
977000 -- (-332.364) (-334.519) (-329.085) [-330.198] * [-328.259] (-331.645) (-328.234) (-333.861) -- 0:00:01
977500 -- [-332.374] (-328.377) (-328.210) (-330.935) * (-330.251) (-335.751) (-332.448) [-328.917] -- 0:00:01
978000 -- (-328.492) (-330.838) (-328.645) [-328.102] * (-329.937) [-335.058] (-330.150) (-330.832) -- 0:00:01
978500 -- (-328.195) (-328.381) [-327.622] (-332.968) * (-330.311) (-328.628) (-330.171) [-327.886] -- 0:00:01
979000 -- (-328.241) (-330.515) [-328.319] (-330.650) * (-329.617) (-329.168) [-328.775] (-329.903) -- 0:00:01
979500 -- (-328.129) [-328.560] (-331.489) (-328.031) * (-329.633) (-328.503) [-328.961] (-327.723) -- 0:00:01
980000 -- [-329.832] (-329.091) (-331.695) (-329.390) * [-328.561] (-331.454) (-330.573) (-328.245) -- 0:00:01
Average standard deviation of split frequencies: 0.007243
980500 -- (-327.987) [-329.383] (-333.876) (-329.501) * [-328.968] (-331.591) (-329.078) (-331.035) -- 0:00:01
981000 -- (-328.292) [-330.351] (-331.858) (-328.346) * (-333.122) (-334.703) [-328.469] (-331.077) -- 0:00:01
981500 -- [-334.376] (-331.478) (-332.789) (-328.886) * [-335.131] (-330.904) (-328.343) (-328.178) -- 0:00:01
982000 -- (-328.245) (-331.799) (-331.886) [-328.281] * [-332.492] (-327.578) (-328.134) (-328.717) -- 0:00:01
982500 -- (-329.273) (-329.614) (-331.878) [-330.509] * [-330.551] (-329.899) (-329.681) (-328.052) -- 0:00:01
983000 -- (-330.728) (-330.852) (-328.795) [-332.843] * (-332.252) (-328.274) [-330.139] (-331.456) -- 0:00:01
983500 -- (-328.450) (-330.724) (-331.955) [-329.357] * [-329.198] (-331.280) (-328.637) (-329.807) -- 0:00:01
984000 -- (-328.628) (-328.444) (-328.334) [-329.750] * (-330.982) (-329.931) [-331.823] (-330.460) -- 0:00:01
984500 -- (-329.327) (-328.595) [-329.785] (-329.712) * (-330.884) (-332.358) (-332.016) [-330.002] -- 0:00:01
985000 -- (-329.541) [-327.795] (-330.273) (-328.127) * [-329.450] (-333.173) (-330.349) (-333.871) -- 0:00:01
Average standard deviation of split frequencies: 0.007458
985500 -- (-329.707) [-328.244] (-331.884) (-327.991) * (-330.860) [-328.598] (-330.722) (-330.091) -- 0:00:01
986000 -- [-329.160] (-329.943) (-330.131) (-336.033) * (-330.327) (-328.761) (-328.932) [-328.049] -- 0:00:00
986500 -- [-331.068] (-330.493) (-330.785) (-329.271) * (-330.591) (-329.868) (-330.561) [-329.858] -- 0:00:00
987000 -- (-330.032) (-331.201) (-331.047) [-328.204] * (-329.649) (-329.616) (-330.630) [-328.142] -- 0:00:00
987500 -- (-331.513) [-329.730] (-328.794) (-328.524) * (-329.408) (-329.956) [-332.341] (-332.331) -- 0:00:00
988000 -- (-330.067) [-332.233] (-333.479) (-330.055) * (-329.311) [-329.513] (-329.907) (-329.451) -- 0:00:00
988500 -- (-330.624) (-331.007) [-328.320] (-328.382) * (-335.050) (-334.216) [-330.321] (-327.913) -- 0:00:00
989000 -- (-331.926) (-329.355) (-329.764) [-328.615] * (-331.318) (-330.390) [-331.145] (-329.167) -- 0:00:00
989500 -- [-330.015] (-328.963) (-329.680) (-328.024) * (-331.410) [-332.296] (-331.859) (-328.653) -- 0:00:00
990000 -- [-329.440] (-332.197) (-328.462) (-327.877) * [-329.085] (-329.434) (-330.144) (-328.250) -- 0:00:00
Average standard deviation of split frequencies: 0.007804
990500 -- (-332.144) (-330.387) [-331.399] (-331.052) * (-329.692) [-328.073] (-333.189) (-329.585) -- 0:00:00
991000 -- [-328.676] (-330.560) (-330.965) (-330.962) * (-330.682) (-332.150) [-328.182] (-330.436) -- 0:00:00
991500 -- (-329.909) (-328.731) (-329.591) [-329.898] * (-327.549) (-327.564) [-327.618] (-330.609) -- 0:00:00
992000 -- (-330.458) [-330.770] (-331.443) (-330.578) * (-334.281) (-329.641) (-328.766) [-331.581] -- 0:00:00
992500 -- [-331.928] (-329.936) (-332.395) (-330.585) * [-330.675] (-329.275) (-333.214) (-329.720) -- 0:00:00
993000 -- [-330.688] (-329.841) (-330.902) (-329.919) * (-330.679) (-328.381) [-331.022] (-330.138) -- 0:00:00
993500 -- (-333.181) (-329.964) [-329.616] (-329.421) * (-330.314) (-330.544) [-327.714] (-328.686) -- 0:00:00
994000 -- (-331.305) (-330.944) (-329.029) [-329.520] * (-329.913) [-331.268] (-330.815) (-328.449) -- 0:00:00
994500 -- (-333.714) (-330.201) [-328.531] (-329.076) * [-328.609] (-331.550) (-332.059) (-328.460) -- 0:00:00
995000 -- (-328.935) [-329.479] (-327.777) (-329.499) * (-328.350) (-332.989) [-327.866] (-330.492) -- 0:00:00
Average standard deviation of split frequencies: 0.008078
995500 -- [-328.932] (-332.616) (-330.303) (-327.964) * (-329.580) (-330.957) [-332.359] (-328.709) -- 0:00:00
996000 -- (-330.417) (-329.472) (-327.945) [-329.083] * (-329.279) (-329.331) [-330.956] (-328.076) -- 0:00:00
996500 -- (-329.081) [-331.216] (-328.306) (-328.389) * (-329.820) [-330.194] (-329.328) (-330.935) -- 0:00:00
997000 -- [-329.166] (-331.555) (-330.357) (-329.157) * [-330.372] (-330.077) (-328.736) (-329.726) -- 0:00:00
997500 -- (-330.768) [-329.023] (-330.851) (-329.459) * [-331.569] (-329.298) (-331.055) (-329.512) -- 0:00:00
998000 -- [-328.749] (-330.883) (-329.435) (-328.092) * (-330.964) (-329.529) (-330.917) [-328.647] -- 0:00:00
998500 -- [-328.633] (-333.186) (-334.497) (-328.834) * (-328.173) (-331.360) (-328.859) [-331.146] -- 0:00:00
999000 -- (-330.796) (-327.995) (-329.679) [-331.170] * (-329.681) [-328.602] (-329.372) (-331.497) -- 0:00:00
999500 -- (-331.709) (-328.505) (-330.358) [-328.160] * (-328.026) (-328.788) (-334.072) [-330.273] -- 0:00:00
1000000 -- (-329.635) (-330.352) [-329.471] (-327.855) * (-327.921) (-330.508) [-329.370] (-334.698) -- 0:00:00
Average standard deviation of split frequencies: 0.008323
Analysis completed in 1 mins 9 seconds
Analysis used 67.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -327.33
Likelihood of best state for "cold" chain of run 2 was -327.32
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 59 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.9 % ( 37 %) Dirichlet(Pi{all})
42.2 % ( 29 %) Slider(Pi{all})
78.1 % ( 55 %) Multiplier(Alpha{1,2})
78.0 % ( 55 %) Multiplier(Alpha{3})
27.6 % ( 15 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.7 % ( 18 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 56 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.9 % ( 29 %) Dirichlet(Pi{all})
41.4 % ( 22 %) Slider(Pi{all})
79.2 % ( 51 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
26.9 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166645 0.82 0.67
3 | 166913 166707 0.84
4 | 166779 166397 166559
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166449 0.82 0.67
3 | 166567 166516 0.84
4 | 166932 167038 166498
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -329.03
| 1 1 |
| 2 1 |
| 1 2 2 2 1 221 2 1 2 1 |
|2 12 2 1 |
|1 2 11 *2 2 2 1* 12 1 22 1 |
| 12 * 1 1 1 2 1 111 12 12 2 1 1 2 21|
| 1 * 2 1 2 22 2 11 122 21 |
| 2 1 1 2 2 2 2 1 2 22 212 |
| 1 2 2 2 12 2 2 1 2|
| 2 1 1 1 1 1 1 |
| 2 1 |
| 2 1 12 1 1 2 |
| 1 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -330.85
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -329.05 -331.88
2 -329.00 -332.56
--------------------------------------
TOTAL -329.02 -332.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891557 0.085386 0.350486 1.459238 0.867633 1424.90 1462.95 1.001
r(A<->C){all} 0.157155 0.018467 0.000018 0.434030 0.117488 96.76 210.91 1.000
r(A<->G){all} 0.174476 0.020801 0.000036 0.463031 0.137529 271.91 324.00 1.002
r(A<->T){all} 0.166482 0.020144 0.000092 0.453990 0.129377 163.98 290.16 1.000
r(C<->G){all} 0.165297 0.019253 0.000268 0.448381 0.127883 155.75 234.60 1.000
r(C<->T){all} 0.167980 0.018892 0.000092 0.438739 0.134653 163.22 242.05 1.000
r(G<->T){all} 0.168610 0.021558 0.000003 0.467380 0.126027 146.74 162.21 1.004
pi(A){all} 0.196822 0.000601 0.151634 0.248086 0.195785 1461.63 1481.32 1.001
pi(C){all} 0.286837 0.000843 0.230237 0.343309 0.286140 1351.64 1426.32 1.000
pi(G){all} 0.315853 0.000880 0.258217 0.374486 0.315785 1218.15 1290.05 1.000
pi(T){all} 0.200489 0.000633 0.149760 0.249912 0.200118 1147.13 1221.66 1.000
alpha{1,2} 0.417208 0.235077 0.000231 1.365056 0.248163 1243.91 1294.84 1.000
alpha{3} 0.452233 0.236961 0.000112 1.396547 0.299047 1335.22 1415.85 1.000
pinvar{all} 0.992794 0.000080 0.976256 0.999994 0.995702 1454.91 1477.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .**...
9 -- .*..*.
10 -- ...*.*
11 -- ....**
12 -- .**.**
13 -- .***.*
14 -- ..*.*.
15 -- ..****
16 -- ...**.
17 -- .****.
18 -- .*...*
19 -- .*.*..
20 -- ..**..
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 470 0.156562 0.013191 0.147235 0.165889 2
8 467 0.155563 0.016488 0.143904 0.167222 2
9 451 0.150233 0.006124 0.145903 0.154564 2
10 445 0.148235 0.013662 0.138574 0.157895 2
11 440 0.146569 0.000942 0.145903 0.147235 2
12 440 0.146569 0.023555 0.129913 0.163225 2
13 439 0.146236 0.010835 0.138574 0.153897 2
14 438 0.145903 0.000000 0.145903 0.145903 2
15 433 0.144237 0.006124 0.139907 0.148568 2
16 416 0.138574 0.011306 0.130580 0.146569 2
17 411 0.136909 0.007066 0.131912 0.141905 2
18 407 0.135576 0.006124 0.131246 0.139907 2
19 406 0.135243 0.004711 0.131912 0.138574 2
20 391 0.130247 0.000471 0.129913 0.130580 2
21 389 0.129580 0.004240 0.126582 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095993 0.009280 0.000056 0.289824 0.064555 1.001 2
length{all}[2] 0.098310 0.009480 0.000019 0.286375 0.070997 1.000 2
length{all}[3] 0.102879 0.010471 0.000114 0.308669 0.071103 1.001 2
length{all}[4] 0.097890 0.008936 0.000002 0.287872 0.070434 1.000 2
length{all}[5] 0.100690 0.010025 0.000016 0.305588 0.070346 1.000 2
length{all}[6] 0.098586 0.008883 0.000004 0.290882 0.070133 1.001 2
length{all}[7] 0.100711 0.009182 0.000467 0.307292 0.072684 1.000 2
length{all}[8] 0.092190 0.008591 0.000361 0.274794 0.056893 0.999 2
length{all}[9] 0.106284 0.011672 0.000023 0.323662 0.073260 0.999 2
length{all}[10] 0.106516 0.010066 0.000118 0.299358 0.075005 0.999 2
length{all}[11] 0.100601 0.010491 0.000129 0.307735 0.069287 1.001 2
length{all}[12] 0.099831 0.009177 0.000078 0.275208 0.072063 0.998 2
length{all}[13] 0.097744 0.008851 0.000429 0.292280 0.068757 0.998 2
length{all}[14] 0.096463 0.009102 0.000224 0.272211 0.068935 1.001 2
length{all}[15] 0.091798 0.008523 0.000004 0.308941 0.062881 0.998 2
length{all}[16] 0.101504 0.009723 0.000110 0.285960 0.070262 1.003 2
length{all}[17] 0.101503 0.011373 0.000030 0.296990 0.071865 0.999 2
length{all}[18] 0.101991 0.008908 0.000627 0.275697 0.072340 0.998 2
length{all}[19] 0.092248 0.009490 0.000050 0.290314 0.062498 0.998 2
length{all}[20] 0.105490 0.009983 0.000210 0.294322 0.079200 0.999 2
length{all}[21] 0.105981 0.010632 0.000071 0.305290 0.076460 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008323
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 243
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
2 sites are removed. 1 81
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 79 / 79 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 79 / 79 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058497 0.035448 0.055121 0.050730 0.075941 0.069830 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -331.838700
Iterating by ming2
Initial: fx= 331.838700
x= 0.05850 0.03545 0.05512 0.05073 0.07594 0.06983 0.30000 1.30000
1 h-m-p 0.0000 0.0005 189.9610 +++ 315.360435 m 0.0005 14 | 1/8
2 h-m-p 0.0053 0.0801 14.9475 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 174.4178 +++ 309.364721 m 0.0002 47 | 2/8
4 h-m-p 0.0160 8.0000 12.7289 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 156.3680 ++ 307.980373 m 0.0001 80 | 3/8
6 h-m-p 0.0160 8.0000 10.9311 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 135.4476 ++ 307.181289 m 0.0000 113 | 4/8
8 h-m-p 0.0160 8.0000 8.7385 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 110.5628 ++ 305.388845 m 0.0001 146 | 5/8
10 h-m-p 0.0160 8.0000 6.1429 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 78.3011 ++ 304.903746 m 0.0001 179 | 6/8
12 h-m-p 0.2993 8.0000 0.0000 Y 304.903746 0 0.2993 190 | 6/8
13 h-m-p 0.0160 8.0000 0.0002 +++++ 304.903746 m 8.0000 206 | 6/8
14 h-m-p 0.0116 5.7793 0.4051 +++Y 304.903746 0 0.5215 222 | 6/8
15 h-m-p 1.6000 8.0000 0.0063 Y 304.903746 0 0.9233 235 | 6/8
16 h-m-p 1.6000 8.0000 0.0011 -Y 304.903746 0 0.1719 249 | 6/8
17 h-m-p 1.6000 8.0000 0.0001 Y 304.903746 0 0.4000 262 | 6/8
18 h-m-p 0.3555 8.0000 0.0001 C 304.903746 0 0.3555 275 | 6/8
19 h-m-p 1.6000 8.0000 0.0000 C 304.903746 0 0.4000 288 | 6/8
20 h-m-p 1.5504 8.0000 0.0000 ----------------.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903746 m 8.0000 331 | 6/8
22 h-m-p 0.0120 5.9896 0.1451 --------C 304.903746 0 0.0000 352 | 6/8
23 h-m-p 0.0160 8.0000 0.0000 ---Y 304.903746 0 0.0001 368 | 6/8
24 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903746 m 8.0000 384 | 6/8
25 h-m-p 0.0160 8.0000 0.2878 +++++ 304.903741 m 8.0000 400 | 6/8
26 h-m-p 0.1931 0.9653 0.3293 ++ 304.903741 m 0.9653 413 | 6/8
27 h-m-p 0.0000 0.0000 1.3310
h-m-p: 2.33550571e-18 1.16775285e-17 1.33103605e+00 304.903741
.. | 6/8
28 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903741 m 8.0000 437 | 6/8
29 h-m-p 0.0887 8.0000 0.0003 ++++ 304.903741 m 8.0000 452 | 6/8
30 h-m-p 0.0160 8.0000 0.4996 +++++ 304.903737 m 8.0000 468 | 6/8
31 h-m-p 1.6000 8.0000 0.4970 ++ 304.903737 m 8.0000 481 | 6/8
32 h-m-p 1.6000 8.0000 1.7540 ++ 304.903736 m 8.0000 494 | 6/8
33 h-m-p 1.2190 6.0949 3.6108 ---------Y 304.903736 0 0.0000 514 | 6/8
34 h-m-p 1.6000 8.0000 0.0000 ------C 304.903736 0 0.0001 531 | 6/8
35 h-m-p 0.0160 8.0000 0.0000 ----------Y 304.903736 0 0.0000 554
Out..
lnL = -304.903736
555 lfun, 555 eigenQcodon, 3330 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087518 0.019470 0.062309 0.069649 0.095033 0.048978 20.688955 0.522596 0.483796
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.945375
np = 9
lnL0 = -333.872961
Iterating by ming2
Initial: fx= 333.872961
x= 0.08752 0.01947 0.06231 0.06965 0.09503 0.04898 20.68896 0.52260 0.48380
1 h-m-p 0.0000 0.0003 180.6435 +++ 325.347985 m 0.0003 15 | 1/9
2 h-m-p 0.0005 0.0026 75.1164 ++ 313.713064 m 0.0026 27 | 2/9
3 h-m-p 0.0000 0.0000 2868.5846 ++ 309.802679 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0004 217.1342 ++ 307.760383 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0000 19420.6485 ++ 305.578497 m 0.0000 63 | 5/9
6 h-m-p 0.0216 0.9416 1.4783 -------------.. | 5/9
7 h-m-p 0.0000 0.0000 109.3028 ++ 305.302449 m 0.0000 98 | 6/9
8 h-m-p 0.0015 0.3926 1.1527 -----------.. | 6/9
9 h-m-p 0.0000 0.0001 77.4148 ++ 304.903735 m 0.0001 131 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 304.903735 0 0.4000 143 | 7/9
11 h-m-p 0.0546 8.0000 0.0000 ---------Y 304.903735 0 0.0000 166
Out..
lnL = -304.903735
167 lfun, 501 eigenQcodon, 2004 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089172 0.036723 0.032673 0.040385 0.075444 0.062075 20.689774 1.280984 0.133377 0.376830 13.479515
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.311942
np = 11
lnL0 = -321.710077
Iterating by ming2
Initial: fx= 321.710077
x= 0.08917 0.03672 0.03267 0.04039 0.07544 0.06207 20.68977 1.28098 0.13338 0.37683 13.47952
1 h-m-p 0.0000 0.0009 83.2317 ++++ 313.843769 m 0.0009 18 | 1/11
2 h-m-p 0.0057 0.0286 11.3803 ++ 310.669287 m 0.0286 32 | 2/11
3 h-m-p 0.0002 0.0011 211.6339 ++ 308.676683 m 0.0011 46 | 3/11
4 h-m-p 0.0001 0.0003 1002.5108 ++ 306.939869 m 0.0003 60 | 4/11
5 h-m-p 0.0064 0.0322 1.6289 ------------.. | 4/11
6 h-m-p 0.0000 0.0001 117.5937 ++ 305.510255 m 0.0001 98 | 5/11
7 h-m-p 0.0160 8.0000 0.8670 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 105.6102 ++ 305.045057 m 0.0000 143 | 6/11
9 h-m-p 0.0160 8.0000 0.2593 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 77.0223 ++ 304.903736 m 0.0000 187 | 7/11
11 h-m-p 0.0371 8.0000 0.0000 Y 304.903736 0 0.0371 201 | 7/11
12 h-m-p 0.3231 8.0000 0.0000 --Y 304.903736 0 0.0050 221
Out..
lnL = -304.903736
222 lfun, 888 eigenQcodon, 3996 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -304.903894 S = -304.902106 -0.000683
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:02
did 20 / 39 patterns 0:02
did 30 / 39 patterns 0:02
did 39 / 39 patterns 0:02
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072551 0.050973 0.103062 0.028069 0.023741 0.053737 20.690291 1.179706 1.331794
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.274104
np = 9
lnL0 = -329.769119
Iterating by ming2
Initial: fx= 329.769119
x= 0.07255 0.05097 0.10306 0.02807 0.02374 0.05374 20.69029 1.17971 1.33179
1 h-m-p 0.0000 0.0003 177.2490 +++ 319.453480 m 0.0003 15 | 1/9
2 h-m-p 0.0044 0.1012 11.8869 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 166.4451 ++ 317.846222 m 0.0001 49 | 2/9
4 h-m-p 0.0011 0.1506 8.0924 -----------.. | 2/9
5 h-m-p 0.0000 0.0003 149.0370 +++ 310.908686 m 0.0003 83 | 3/9
6 h-m-p 0.0073 0.2301 5.4531 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 131.8302 ++ 310.268551 m 0.0000 118 | 4/9
8 h-m-p 0.0012 0.4149 3.2765 -----------.. | 4/9
9 h-m-p 0.0000 0.0003 107.3144 +++ 307.340674 m 0.0003 152 | 5/9
10 h-m-p 0.0087 0.6851 2.1826 -------------.. | 5/9
11 h-m-p 0.0000 0.0004 76.4251 +++ 304.903735 m 0.0004 188 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 304.903735 m 8.0000 200 | 6/9
13 h-m-p 0.5587 8.0000 0.0000 ++ 304.903735 m 8.0000 215 | 6/9
14 h-m-p 0.0160 8.0000 0.0070 +++++ 304.903735 m 8.0000 233 | 6/9
15 h-m-p 0.0216 8.0000 2.5962 +++++ 304.903734 m 8.0000 251 | 6/9
16 h-m-p 1.6000 8.0000 6.2246 ++ 304.903733 m 8.0000 263 | 6/9
17 h-m-p 0.1769 0.8843 50.4778 ++ 304.903733 m 0.8843 275 | 7/9
18 h-m-p 0.3827 1.9136 33.0719 C 304.903733 0 0.5464 287 | 7/9
19 h-m-p 0.4986 3.5993 36.2366 ----------C 304.903733 0 0.0000 309 | 7/9
20 h-m-p 0.0491 8.0000 0.0001 --------------.. | 7/9
21 h-m-p 0.0160 8.0000 0.0000 ---------Y 304.903733 0 0.0000 356 | 7/9
22 h-m-p 0.0160 8.0000 0.0000 ---------Y 304.903733 0 0.0000 379
Out..
lnL = -304.903733
380 lfun, 4180 eigenQcodon, 22800 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080577 0.016053 0.085298 0.064840 0.064931 0.105672 56.320776 0.900000 0.719576 1.600440 11.257905
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.221460
np = 11
lnL0 = -322.889178
Iterating by ming2
Initial: fx= 322.889178
x= 0.08058 0.01605 0.08530 0.06484 0.06493 0.10567 56.32078 0.90000 0.71958 1.60044 11.25790
1 h-m-p 0.0000 0.0005 75.2048 +++ 319.944169 m 0.0005 17 | 1/11
2 h-m-p 0.0000 0.0001 851.8246 ++ 310.077456 m 0.0001 31 | 2/11
3 h-m-p 0.0042 0.0210 6.5012 ++ 309.552619 m 0.0210 45 | 3/11
4 h-m-p 0.0001 0.0005 161.4482 ++ 307.437716 m 0.0005 59 | 4/11
5 h-m-p 0.0013 0.0064 16.8305 ++ 307.255926 m 0.0064 73 | 5/11
6 h-m-p 0.0054 0.0310 19.7871 ++ 306.811238 m 0.0310 87 | 6/11
7 h-m-p 0.0204 0.1748 12.4067 -------------.. | 6/11
8 h-m-p 0.0000 0.0005 54.1944 +++ 304.903734 m 0.0005 127 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 304.903734 m 8.0000 141 | 7/11
10 h-m-p 0.0160 8.0000 0.0005 +++++ 304.903734 m 8.0000 162 | 7/11
11 h-m-p 0.0160 8.0000 0.9065 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903734 m 8.0000 212 | 7/11
13 h-m-p 0.0160 8.0000 0.0473 ---------Y 304.903734 0 0.0000 239 | 7/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 304.903734 m 8.0000 260 | 7/11
15 h-m-p 0.0296 8.0000 0.0491 --------C 304.903734 0 0.0000 286 | 7/11
16 h-m-p 0.0160 8.0000 0.0002 ----N 304.903734 0 0.0000 308 | 7/11
17 h-m-p 0.0160 8.0000 0.0002 +++++ 304.903734 m 8.0000 329 | 7/11
18 h-m-p 0.0256 8.0000 0.0484 ---------Y 304.903734 0 0.0000 356 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903734 m 8.0000 377 | 7/11
20 h-m-p 0.0160 8.0000 0.0470 --------C 304.903734 0 0.0000 403 | 7/11
21 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 304.903734 m 8.0000 453 | 7/11
23 h-m-p 0.0160 8.0000 0.0453 ---------N 304.903734 0 0.0000 480 | 7/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 304.903734 m 8.0000 501 | 7/11
25 h-m-p 0.0160 8.0000 0.0626 --------Y 304.903734 0 0.0000 527 | 7/11
26 h-m-p 0.0160 8.0000 0.0011 +++++ 304.903734 m 8.0000 548 | 7/11
27 h-m-p 0.1432 8.0000 0.0587 ----------Y 304.903734 0 0.0000 576 | 7/11
28 h-m-p 0.0160 8.0000 0.0001 -------C 304.903734 0 0.0000 601 | 7/11
29 h-m-p 0.0160 8.0000 0.0007 ---------C 304.903734 0 0.0000 628
Out..
lnL = -304.903734
629 lfun, 7548 eigenQcodon, 41514 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -304.909258 S = -304.902565 -0.002933
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:19
did 20 / 39 patterns 0:19
did 30 / 39 patterns 0:19
did 39 / 39 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=81
NC_011896_1_WP_041322946_1_1847_MLBR_RS08770 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
NC_002677_1_NP_302197_1_1069_nrdH VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL
*************************************************
NC_011896_1_WP_041322946_1_1847_MLBR_RS08770 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
NC_002677_1_NP_302197_1_1069_nrdH QAPVVVAGNNHWSGFRPDRIKALAGAVLTA-
NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785 QAPVVVAGNNHWSGFRPDRIKALAGAVLTAo
******************************
>NC_011896_1_WP_041322946_1_1847_MLBR_RS08770 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG--- >NC_002677_1_NP_302197_1_1069_nrdH GTGATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG--- >NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG--- >NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG--- >NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG--- >NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785 ---ATGAACATCACCGTGTACACCAAGCCCGCGTGTGTGCAGTGTAGTGC CACTTACAAGGCGCTGGATAAACAAGGTATCCCCTACCAGACGGTCGACA TCAGCCTCGATTCTGAGGCGCGTGACTACGTGATGGCGTTGGGTTACTTG CAGGCGCCGGTTGTGGTGGCCGGAAACAACCACTGGTCGGGTTTCCGGCC CGATCGCATCAAGGCACTCGCCGGGGCCGTGCTGACCGCG---
>NC_011896_1_WP_041322946_1_1847_MLBR_RS08770 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA >NC_002677_1_NP_302197_1_1069_nrdH VMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA >NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA >NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA >NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA >NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785 -MNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYL QAPVVVAGNNHWSGFRPDRIKALAGAVLTA
#NEXUS
[ID: 9061336601]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_041322946_1_1847_MLBR_RS08770
NC_002677_1_NP_302197_1_1069_nrdH
NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730
NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060
NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535
NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785
;
end;
begin trees;
translate
1 NC_011896_1_WP_041322946_1_1847_MLBR_RS08770,
2 NC_002677_1_NP_302197_1_1069_nrdH,
3 NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730,
4 NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060,
5 NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535,
6 NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06455455,2:0.07099661,3:0.07110251,4:0.07043429,5:0.07034579,6:0.07013258);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06455455,2:0.07099661,3:0.07110251,4:0.07043429,5:0.07034579,6:0.07013258);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -329.05 -331.88
2 -329.00 -332.56
--------------------------------------
TOTAL -329.02 -332.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nrdH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891557 0.085386 0.350486 1.459238 0.867633 1424.90 1462.95 1.001
r(A<->C){all} 0.157155 0.018467 0.000018 0.434030 0.117488 96.76 210.91 1.000
r(A<->G){all} 0.174476 0.020801 0.000036 0.463031 0.137529 271.91 324.00 1.002
r(A<->T){all} 0.166482 0.020144 0.000092 0.453990 0.129377 163.98 290.16 1.000
r(C<->G){all} 0.165297 0.019253 0.000268 0.448381 0.127883 155.75 234.60 1.000
r(C<->T){all} 0.167980 0.018892 0.000092 0.438739 0.134653 163.22 242.05 1.000
r(G<->T){all} 0.168610 0.021558 0.000003 0.467380 0.126027 146.74 162.21 1.004
pi(A){all} 0.196822 0.000601 0.151634 0.248086 0.195785 1461.63 1481.32 1.001
pi(C){all} 0.286837 0.000843 0.230237 0.343309 0.286140 1351.64 1426.32 1.000
pi(G){all} 0.315853 0.000880 0.258217 0.374486 0.315785 1218.15 1290.05 1.000
pi(T){all} 0.200489 0.000633 0.149760 0.249912 0.200118 1147.13 1221.66 1.000
alpha{1,2} 0.417208 0.235077 0.000231 1.365056 0.248163 1243.91 1294.84 1.000
alpha{3} 0.452233 0.236961 0.000112 1.396547 0.299047 1335.22 1415.85 1.000
pinvar{all} 0.992794 0.000080 0.976256 0.999994 0.995702 1454.91 1477.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/nrdH/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 79
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 5 5 5 5 5 5 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 3 3 3 3 3 3 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 3 3 3 3 3 3 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 6 6 6 6 6 6 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_041322946_1_1847_MLBR_RS08770
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
#2: NC_002677_1_NP_302197_1_1069_nrdH
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
#3: NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
#4: NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
#5: NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
#6: NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 12
TTC 6 | TCC 0 | TAC 30 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 12 | CCC 18 | CAC 6 | CGC 6
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 12 | CCG 6 | CAG 18 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 24 | ACC 18 | AAC 18 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 18 | Gly G GGT 18
GTC 6 | GCC 24 | GAC 12 | GGC 0
GTA 0 | GCA 6 | Glu E GAA 0 | GGA 6
GTG 36 | GCG 36 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16456 C:0.20253 A:0.25316 G:0.37975
position 2: T:0.26582 C:0.27848 A:0.29114 G:0.16456
position 3: T:0.16456 C:0.39241 A:0.05063 G:0.39241
Average T:0.19831 C:0.29114 A:0.19831 G:0.31224
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -304.903736 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.688955 11.257905
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322946_1_1847_MLBR_RS08770: 0.000004, NC_002677_1_NP_302197_1_1069_nrdH: 0.000004, NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730: 0.000004, NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060: 0.000004, NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535: 0.000004, NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.68896
omega (dN/dS) = 11.25790
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
7..2 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
7..3 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
7..4 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
7..5 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
7..6 0.000 185.1 51.9 11.2579 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -304.903735 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.689774 0.593597 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322946_1_1847_MLBR_RS08770: 0.000004, NC_002677_1_NP_302197_1_1069_nrdH: 0.000004, NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730: 0.000004, NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060: 0.000004, NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535: 0.000004, NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.68977
MLEs of dN/dS (w) for site classes (K=2)
p: 0.59360 0.40640
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
7..2 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
7..3 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
7..4 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
7..5 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
7..6 0.000 185.1 51.9 0.4064 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -304.903736 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.690291 0.668194 0.175850 0.000001 13.507222
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322946_1_1847_MLBR_RS08770: 0.000004, NC_002677_1_NP_302197_1_1069_nrdH: 0.000004, NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730: 0.000004, NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060: 0.000004, NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535: 0.000004, NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.69029
MLEs of dN/dS (w) for site classes (K=3)
p: 0.66819 0.17585 0.15596
w: 0.00000 1.00000 13.50722
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
7..2 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
7..3 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
7..4 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
7..5 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
7..6 0.000 185.1 51.9 2.2824 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322946_1_1847_MLBR_RS08770)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322946_1_1847_MLBR_RS08770)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -304.903733 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 56.320776 25.490388 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322946_1_1847_MLBR_RS08770: 0.000004, NC_002677_1_NP_302197_1_1069_nrdH: 0.000004, NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730: 0.000004, NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060: 0.000004, NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535: 0.000004, NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 56.32078
Parameters in M7 (beta):
p = 25.49039 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.14830 0.16751 0.17956 0.18950 0.19866 0.20774 0.21732 0.22824 0.24226 0.26663
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
7..2 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
7..3 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
7..4 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
7..5 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
7..6 0.000 184.4 52.6 0.2046 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -304.903734 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 56.321701 0.946503 0.005000 1.896257 11.366049
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322946_1_1847_MLBR_RS08770: 0.000004, NC_002677_1_NP_302197_1_1069_nrdH: 0.000004, NZ_LVXE01000029_1_WP_041322946_1_1178_A3216_RS08730: 0.000004, NZ_LYPH01000032_1_WP_041322946_1_1258_A8144_RS06060: 0.000004, NZ_CP029543_1_WP_041322946_1_1873_DIJ64_RS09535: 0.000004, NZ_AP014567_1_WP_041322946_1_1923_JK2ML_RS09785: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 56.32170
Parameters in M8 (beta&w>1):
p0 = 0.94650 p = 0.00500 q = 1.89626
(p1 = 0.05350) w = 11.36605
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09465 0.09465 0.09465 0.09465 0.09465 0.09465 0.09465 0.09465 0.09465 0.09465 0.05350
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 11.36605
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
7..2 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
7..3 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
7..4 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
7..5 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
7..6 0.000 184.4 52.6 0.6081 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322946_1_1847_MLBR_RS08770)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322946_1_1847_MLBR_RS08770)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:19
Model 1: NearlyNeutral -304.903735 Model 2: PositiveSelection -304.903736 Model 0: one-ratio -304.903736 Model 7: beta -304.903733 Model 8: beta&w>1 -304.903734 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
