>C1
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C2
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C3
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C4
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C5
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C6
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=253
C1 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C2 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C3 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C4 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C5 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C6 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
**************************************************
C1 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C2 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C3 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C4 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C5 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C6 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
**************************************************
C1 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C2 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C3 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C4 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C5 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C6 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
**************************************************
C1 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C2 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C3 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C4 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C5 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C6 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
**************************************************
C1 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C2 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C3 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C4 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C5 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C6 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
**************************************************
C1 AGL
C2 AGL
C3 AGL
C4 AGL
C5 AGL
C6 AGL
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 253 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 253 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7590]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7590]--->[7590]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.796 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C2 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C3 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C4 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C5 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
C6 MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
**************************************************
C1 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C2 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C3 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C4 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C5 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
C6 LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
**************************************************
C1 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C2 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C3 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C4 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C5 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
C6 FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
**************************************************
C1 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C2 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C3 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C4 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C5 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
C6 IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
**************************************************
C1 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C2 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C3 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C4 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C5 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
C6 HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
**************************************************
C1 AGL
C2 AGL
C3 AGL
C4 AGL
C5 AGL
C6 AGL
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
C2 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
C3 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
C4 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
C5 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
C6 ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
**************************************************
C1 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
C2 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
C3 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
C4 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
C5 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
C6 CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
**************************************************
C1 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
C2 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
C3 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
C4 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
C5 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
C6 AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
**************************************************
C1 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
C2 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
C3 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
C4 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
C5 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
C6 TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
**************************************************
C1 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
C2 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
C3 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
C4 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
C5 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
C6 CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
**************************************************
C1 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
C2 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
C3 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
C4 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
C5 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
C6 TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
**************************************************
C1 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
C2 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
C3 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
C4 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
C5 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
C6 TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
**************************************************
C1 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
C2 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
C3 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
C4 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
C5 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
C6 GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
**************************************************
C1 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
C2 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
C3 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
C4 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
C5 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
C6 CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
**************************************************
C1 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
C2 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
C3 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
C4 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
C5 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
C6 ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
**************************************************
C1 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
C2 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
C3 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
C4 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
C5 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
C6 GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
**************************************************
C1 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
C2 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
C3 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
C4 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
C5 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
C6 AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
**************************************************
C1 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
C2 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
C3 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
C4 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
C5 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
C6 CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
**************************************************
C1 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
C2 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
C3 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
C4 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
C5 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
C6 ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
**************************************************
C1 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
C2 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
C3 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
C4 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
C5 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
C6 TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
**************************************************
C1 GCTGGACTA
C2 GCTGGACTA
C3 GCTGGACTA
C4 GCTGGACTA
C5 GCTGGACTA
C6 GCTGGACTA
*********
>C1
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C2
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C3
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C4
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C5
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C6
ATGCCCCTCACGCCTGGTGTCGACGTGGCCCGGCGCTGGTCCGGGGAAAC
CAGACTGGGTTTGGTGCGACGGGCGCGGAGGATGAATCGTGCATTGGCGC
AAGCATTTCCGCATGTGTACTGTGAATTGGATTTCACGTCGCCGCTGGAG
TTGACGGTGGCCACCATCCTTTCGGCGCAGAGCACCGATAAGCGGGTGAA
CTTGACGACACCAGCTGTGTTTGCGCGTTACCGGTCGGCGCTGGACTACA
TGCAAGCGGATCGCGCTGAACTAGAAAACTTCATACGTCCTACGGGTTTC
TTCCGTAACAAGGCGGCTTCGCTTATCAGGCTCGGGCAGGCCTTGGTCGA
GCGGTTCGATGGCGAGGTGCCCTCGACCATGGTTGACCTGTTTACGTTAC
CCGGTGTAGGACGCAAGACCGCTAATGTCATTCTGGGAAATGCGTTCGGT
ATCCCCGGGATCACTGTCGACACGCATTTTGGACGATTAGTGCGGCGATG
GCGTTGGACGGCCGAAGAGGATCCAGTCAAGGTGGAGCATGCTGTCGGTG
AACTGATCGAACGCGATCAGTGGACTTTGCTGAGCCACCGAGTGATCTTC
CACGGTCGTCGGGTGTGCCACGCGCGCAAACCGGCATGCGGTGTTTGCGT
ACTTGCCAAGGACTGTCCCTCCTTCGGCCTTGGCCCCACTGAACCGCTGC
TGGCCGCGCCTCTCGTCCAAGGCCCGGAAGCCGGGCACTTGCTGGCCCTG
GCTGGACTA
>C1
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C2
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C3
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C4
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C5
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
>C6
MPLTPGVDVARRWSGETRLGLVRRARRMNRALAQAFPHVYCELDFTSPLE
LTVATILSAQSTDKRVNLTTPAVFARYRSALDYMQADRAELENFIRPTGF
FRNKAASLIRLGQALVERFDGEVPSTMVDLFTLPGVGRKTANVILGNAFG
IPGITVDTHFGRLVRRWRWTAEEDPVKVEHAVGELIERDQWTLLSHRVIF
HGRRVCHARKPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPEAGHLLAL
AGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 759 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784441
Setting output file names to "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1523837478
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9152377271
Seed = 74843224
Swapseed = 1579784441
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1698.678384 -- -24.965149
Chain 2 -- -1698.678384 -- -24.965149
Chain 3 -- -1698.678384 -- -24.965149
Chain 4 -- -1698.678285 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1698.678125 -- -24.965149
Chain 2 -- -1698.678384 -- -24.965149
Chain 3 -- -1698.678285 -- -24.965149
Chain 4 -- -1698.678285 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1698.678] (-1698.678) (-1698.678) (-1698.678) * [-1698.678] (-1698.678) (-1698.678) (-1698.678)
500 -- (-1058.651) (-1051.698) (-1038.289) [-1040.070] * [-1046.592] (-1043.110) (-1052.820) (-1062.321) -- 0:00:00
1000 -- (-1047.961) (-1043.722) (-1045.866) [-1037.077] * (-1040.979) (-1041.927) (-1053.847) [-1043.984] -- 0:00:00
1500 -- [-1049.050] (-1047.806) (-1045.267) (-1045.232) * (-1044.649) (-1045.300) (-1055.636) [-1042.511] -- 0:00:00
2000 -- (-1045.685) (-1041.683) (-1042.988) [-1042.321] * (-1045.761) (-1045.542) (-1047.639) [-1047.486] -- 0:00:00
2500 -- (-1039.730) [-1046.276] (-1047.070) (-1041.985) * (-1045.520) [-1045.992] (-1045.586) (-1047.489) -- 0:00:00
3000 -- (-1041.963) (-1046.839) (-1045.741) [-1050.412] * (-1040.779) (-1046.340) [-1044.244] (-1041.974) -- 0:00:00
3500 -- (-1047.647) (-1043.653) [-1042.321] (-1047.741) * [-1039.100] (-1043.546) (-1050.395) (-1051.662) -- 0:00:00
4000 -- (-1050.304) (-1047.043) (-1044.888) [-1049.298] * (-1039.614) (-1044.194) [-1038.081] (-1043.890) -- 0:00:00
4500 -- [-1041.388] (-1045.849) (-1048.100) (-1041.631) * (-1042.711) (-1048.029) [-1046.571] (-1042.268) -- 0:00:00
5000 -- (-1048.666) (-1050.396) (-1053.974) [-1042.302] * (-1048.204) (-1045.001) (-1047.148) [-1040.012] -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- [-1041.285] (-1043.690) (-1045.964) (-1041.907) * (-1046.241) (-1042.433) [-1042.503] (-1042.466) -- 0:00:00
6000 -- (-1039.851) (-1042.824) (-1044.695) [-1040.608] * (-1046.978) [-1040.590] (-1042.422) (-1041.171) -- 0:00:00
6500 -- (-1036.301) (-1042.978) [-1040.520] (-1044.226) * (-1051.511) (-1043.007) [-1046.551] (-1043.546) -- 0:00:00
7000 -- (-1042.831) (-1046.450) [-1053.727] (-1047.269) * (-1049.929) [-1042.304] (-1042.723) (-1044.527) -- 0:00:00
7500 -- (-1033.801) (-1046.916) [-1044.263] (-1051.268) * (-1050.409) (-1042.464) [-1043.550] (-1044.495) -- 0:00:00
8000 -- (-1033.837) (-1044.282) (-1040.969) [-1046.269] * (-1042.740) [-1049.160] (-1040.196) (-1044.278) -- 0:00:00
8500 -- (-1033.810) [-1045.668] (-1041.957) (-1051.003) * (-1040.256) (-1045.215) [-1040.715] (-1045.735) -- 0:00:00
9000 -- (-1038.238) (-1039.413) [-1039.363] (-1042.425) * (-1048.102) (-1041.050) [-1045.270] (-1052.773) -- 0:00:00
9500 -- (-1033.743) (-1041.196) (-1043.863) [-1041.709] * (-1045.014) (-1040.274) [-1045.299] (-1038.921) -- 0:00:00
10000 -- (-1035.156) (-1037.952) [-1046.630] (-1062.045) * (-1047.975) [-1039.479] (-1048.106) (-1037.151) -- 0:00:00
Average standard deviation of split frequencies: 0.072106
10500 -- (-1034.696) [-1039.662] (-1040.014) (-1046.679) * [-1047.871] (-1047.730) (-1046.648) (-1035.669) -- 0:00:00
11000 -- [-1036.625] (-1041.250) (-1044.785) (-1047.321) * (-1045.498) (-1049.347) [-1048.943] (-1034.571) -- 0:00:00
11500 -- [-1033.553] (-1049.086) (-1041.041) (-1048.243) * (-1042.987) (-1041.337) [-1049.607] (-1037.240) -- 0:00:00
12000 -- (-1035.035) (-1045.215) [-1050.330] (-1044.803) * (-1046.999) [-1039.886] (-1049.206) (-1035.607) -- 0:00:00
12500 -- (-1034.349) (-1042.417) (-1040.711) [-1042.651] * (-1047.710) (-1038.544) [-1044.364] (-1036.522) -- 0:00:00
13000 -- [-1038.799] (-1041.027) (-1047.949) (-1048.012) * [-1039.823] (-1038.540) (-1041.711) (-1040.114) -- 0:00:00
13500 -- (-1036.170) (-1043.737) (-1042.219) [-1045.903] * [-1043.312] (-1041.346) (-1043.643) (-1034.952) -- 0:00:00
14000 -- (-1040.912) (-1044.036) [-1045.911] (-1043.253) * [-1046.615] (-1043.943) (-1056.031) (-1038.755) -- 0:00:00
14500 -- [-1036.173] (-1039.264) (-1054.963) (-1044.267) * (-1052.066) [-1043.272] (-1046.534) (-1037.644) -- 0:01:07
15000 -- [-1035.758] (-1044.744) (-1041.081) (-1041.449) * (-1042.076) (-1052.448) (-1044.463) [-1035.509] -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- (-1035.351) (-1046.877) (-1055.855) [-1040.608] * (-1043.955) (-1041.981) (-1044.996) [-1035.436] -- 0:01:03
16000 -- (-1038.520) (-1052.374) (-1047.441) [-1045.497] * (-1042.432) [-1041.257] (-1050.463) (-1034.872) -- 0:01:01
16500 -- (-1034.718) (-1040.437) [-1039.637] (-1050.206) * (-1046.278) [-1045.593] (-1046.292) (-1034.673) -- 0:00:59
17000 -- (-1036.310) (-1049.257) (-1043.706) [-1043.095] * [-1050.955] (-1042.243) (-1051.159) (-1034.604) -- 0:00:57
17500 -- (-1034.006) (-1044.696) [-1040.523] (-1041.950) * (-1051.140) [-1039.087] (-1041.397) (-1034.785) -- 0:00:56
18000 -- [-1035.584] (-1046.118) (-1044.374) (-1055.625) * (-1048.333) [-1039.885] (-1046.142) (-1034.633) -- 0:00:54
18500 -- (-1035.492) [-1043.966] (-1047.504) (-1038.019) * (-1045.295) [-1053.198] (-1053.004) (-1035.342) -- 0:00:53
19000 -- (-1035.587) [-1044.406] (-1042.197) (-1037.034) * [-1039.252] (-1041.849) (-1047.380) (-1034.443) -- 0:00:51
19500 -- (-1034.884) (-1045.677) [-1052.393] (-1034.577) * (-1047.638) (-1046.106) [-1043.618] (-1034.232) -- 0:00:50
20000 -- [-1034.968] (-1056.985) (-1047.081) (-1034.614) * [-1047.904] (-1045.835) (-1054.964) (-1034.375) -- 0:00:49
Average standard deviation of split frequencies: 0.077822
20500 -- (-1036.320) (-1048.436) (-1045.804) [-1033.960] * (-1042.626) [-1039.058] (-1040.188) (-1034.295) -- 0:00:47
21000 -- (-1037.186) [-1046.333] (-1038.690) (-1034.201) * (-1051.727) (-1045.662) [-1052.093] (-1035.214) -- 0:00:46
21500 -- [-1034.192] (-1044.504) (-1040.279) (-1033.868) * [-1048.033] (-1040.934) (-1044.502) (-1034.687) -- 0:00:45
22000 -- (-1034.228) (-1050.069) [-1049.495] (-1034.213) * (-1041.292) [-1038.491] (-1047.713) (-1033.806) -- 0:00:44
22500 -- (-1034.673) (-1043.586) [-1046.059] (-1038.447) * (-1046.500) (-1046.251) [-1040.521] (-1033.786) -- 0:00:43
23000 -- (-1036.467) (-1044.670) [-1043.963] (-1034.887) * (-1040.758) [-1040.952] (-1046.269) (-1036.467) -- 0:00:42
23500 -- (-1035.723) (-1043.134) (-1044.355) [-1034.373] * (-1048.887) [-1049.251] (-1046.604) (-1037.218) -- 0:00:41
24000 -- (-1035.980) (-1042.838) [-1042.899] (-1034.135) * (-1046.067) (-1047.983) [-1048.482] (-1036.709) -- 0:00:40
24500 -- (-1034.616) (-1048.409) [-1038.636] (-1037.763) * (-1055.768) [-1043.305] (-1044.627) (-1035.675) -- 0:00:39
25000 -- (-1033.676) [-1040.423] (-1048.346) (-1038.852) * (-1042.963) [-1039.559] (-1048.508) (-1034.379) -- 0:00:39
Average standard deviation of split frequencies: 0.062634
25500 -- (-1034.078) (-1052.195) (-1043.934) [-1035.719] * (-1048.889) (-1046.983) [-1043.504] (-1036.850) -- 0:00:38
26000 -- (-1034.193) (-1042.952) [-1047.785] (-1033.982) * (-1054.037) [-1048.735] (-1046.987) (-1035.352) -- 0:00:37
26500 -- (-1035.208) (-1035.332) [-1045.793] (-1033.814) * (-1042.590) (-1050.402) [-1048.072] (-1035.216) -- 0:00:36
27000 -- (-1034.440) (-1035.041) [-1040.983] (-1034.934) * (-1045.398) [-1046.421] (-1053.339) (-1035.996) -- 0:00:36
27500 -- (-1036.733) (-1037.931) (-1055.169) [-1033.804] * (-1041.796) [-1044.549] (-1048.979) (-1039.543) -- 0:00:35
28000 -- (-1039.397) (-1037.850) (-1043.641) [-1034.420] * [-1039.445] (-1047.562) (-1050.195) (-1039.703) -- 0:00:34
28500 -- (-1036.654) (-1036.593) (-1047.659) [-1035.309] * (-1064.460) (-1042.761) [-1043.739] (-1035.571) -- 0:00:34
29000 -- [-1036.648] (-1038.987) (-1041.957) (-1035.383) * (-1039.367) [-1044.590] (-1044.846) (-1035.316) -- 0:00:33
29500 -- (-1037.056) [-1040.366] (-1046.455) (-1036.852) * (-1063.850) [-1045.110] (-1048.558) (-1034.528) -- 0:00:32
30000 -- [-1036.841] (-1036.070) (-1041.909) (-1037.032) * (-1041.010) (-1047.605) [-1046.466] (-1033.629) -- 0:00:32
Average standard deviation of split frequencies: 0.054168
30500 -- [-1035.336] (-1035.092) (-1046.694) (-1034.585) * (-1037.776) (-1044.528) [-1049.676] (-1034.126) -- 0:01:03
31000 -- [-1035.599] (-1035.987) (-1044.052) (-1035.042) * [-1034.533] (-1048.454) (-1045.976) (-1036.707) -- 0:01:02
31500 -- (-1036.048) (-1038.024) [-1041.341] (-1036.273) * (-1037.394) (-1043.964) [-1042.128] (-1034.218) -- 0:01:01
32000 -- (-1036.620) [-1033.953] (-1040.512) (-1034.668) * (-1035.920) (-1043.250) (-1042.546) [-1034.002] -- 0:01:00
32500 -- (-1036.605) [-1033.924] (-1045.563) (-1035.237) * (-1034.714) (-1038.567) [-1044.337] (-1034.659) -- 0:00:59
33000 -- (-1047.783) (-1034.496) (-1043.591) [-1034.790] * (-1036.969) (-1042.107) (-1043.047) [-1034.563] -- 0:00:58
33500 -- (-1047.719) (-1034.198) [-1045.559] (-1036.836) * (-1036.155) [-1041.864] (-1044.324) (-1037.204) -- 0:00:57
34000 -- (-1035.867) [-1037.557] (-1046.825) (-1037.021) * [-1036.188] (-1045.677) (-1047.520) (-1039.593) -- 0:00:56
34500 -- (-1035.513) [-1035.209] (-1045.490) (-1035.527) * (-1036.336) (-1053.456) (-1041.423) [-1039.290] -- 0:00:55
35000 -- (-1035.094) [-1033.756] (-1043.163) (-1034.813) * (-1037.551) (-1051.244) (-1046.400) [-1038.458] -- 0:00:55
Average standard deviation of split frequencies: 0.048637
35500 -- (-1035.704) (-1033.844) (-1042.569) [-1034.810] * (-1037.454) (-1043.450) [-1041.387] (-1038.686) -- 0:00:54
36000 -- (-1035.951) [-1033.823] (-1037.082) (-1036.940) * (-1034.932) (-1042.222) (-1045.180) [-1037.966] -- 0:00:53
36500 -- (-1036.261) (-1034.239) [-1041.671] (-1035.213) * (-1034.110) [-1043.909] (-1046.877) (-1034.092) -- 0:00:52
37000 -- (-1035.618) (-1036.461) [-1045.190] (-1035.577) * [-1034.461] (-1052.527) (-1040.096) (-1034.266) -- 0:00:52
37500 -- (-1036.010) [-1036.895] (-1041.804) (-1035.198) * (-1034.893) (-1051.259) (-1039.672) [-1034.820] -- 0:00:51
38000 -- [-1035.054] (-1038.301) (-1047.580) (-1037.681) * [-1035.730] (-1051.686) (-1034.270) (-1033.817) -- 0:00:50
38500 -- (-1036.463) (-1035.336) [-1042.024] (-1038.025) * (-1033.968) (-1056.590) [-1037.066] (-1034.732) -- 0:00:49
39000 -- (-1035.238) (-1034.384) [-1040.942] (-1037.009) * (-1034.861) [-1048.721] (-1035.067) (-1034.592) -- 0:00:49
39500 -- (-1034.879) (-1036.868) (-1034.356) [-1035.665] * (-1034.064) (-1043.210) (-1039.932) [-1034.648] -- 0:00:48
40000 -- [-1034.685] (-1036.891) (-1034.442) (-1034.834) * (-1036.810) (-1049.258) [-1034.564] (-1035.105) -- 0:00:48
Average standard deviation of split frequencies: 0.043317
40500 -- (-1034.628) [-1034.463] (-1035.550) (-1035.475) * (-1034.113) [-1042.875] (-1036.871) (-1036.945) -- 0:00:47
41000 -- (-1037.457) (-1034.599) [-1035.224] (-1035.311) * (-1034.382) (-1057.271) (-1040.052) [-1038.624] -- 0:00:46
41500 -- (-1035.700) [-1034.108] (-1034.843) (-1036.973) * [-1034.174] (-1040.918) (-1039.347) (-1039.601) -- 0:00:46
42000 -- (-1040.146) (-1035.579) (-1035.686) [-1036.403] * (-1036.005) [-1045.479] (-1036.816) (-1035.034) -- 0:00:45
42500 -- (-1038.705) [-1036.325] (-1038.118) (-1041.470) * [-1036.053] (-1051.315) (-1035.298) (-1036.377) -- 0:00:45
43000 -- (-1038.713) (-1040.266) [-1040.477] (-1037.380) * (-1036.334) [-1041.881] (-1035.530) (-1036.222) -- 0:00:44
43500 -- (-1036.054) [-1037.393] (-1035.559) (-1034.037) * (-1042.748) (-1041.476) [-1035.383] (-1035.888) -- 0:00:43
44000 -- (-1037.563) (-1034.369) [-1035.039] (-1034.834) * (-1037.401) (-1048.801) (-1033.436) [-1039.719] -- 0:00:43
44500 -- (-1041.341) (-1037.792) [-1034.916] (-1038.902) * (-1035.650) (-1050.190) (-1034.182) [-1036.241] -- 0:00:42
45000 -- (-1039.217) (-1036.996) [-1034.294] (-1039.737) * (-1033.675) [-1047.124] (-1036.252) (-1035.661) -- 0:00:42
Average standard deviation of split frequencies: 0.032208
45500 -- (-1038.791) (-1035.684) (-1035.635) [-1035.207] * (-1033.637) (-1050.830) (-1040.796) [-1034.754] -- 0:00:41
46000 -- (-1037.223) (-1034.951) (-1034.063) [-1035.131] * (-1034.534) (-1042.375) [-1038.288] (-1038.244) -- 0:00:41
46500 -- (-1037.187) (-1036.173) (-1034.329) [-1036.568] * [-1033.321] (-1048.402) (-1039.096) (-1038.064) -- 0:01:01
47000 -- (-1036.732) (-1035.318) [-1037.592] (-1040.082) * (-1036.814) (-1052.349) (-1034.166) [-1039.826] -- 0:01:00
47500 -- (-1034.996) (-1035.284) [-1034.117] (-1036.743) * (-1034.796) [-1047.642] (-1036.261) (-1034.266) -- 0:01:00
48000 -- (-1035.445) (-1035.840) (-1035.634) [-1035.754] * (-1034.212) (-1049.481) [-1036.681] (-1039.803) -- 0:00:59
48500 -- (-1035.959) (-1041.023) [-1034.718] (-1038.293) * [-1033.658] (-1046.553) (-1035.123) (-1037.102) -- 0:00:58
49000 -- (-1035.397) (-1038.305) [-1034.376] (-1038.147) * (-1035.397) (-1045.091) [-1034.110] (-1038.586) -- 0:00:58
49500 -- (-1042.051) (-1038.375) (-1035.106) [-1040.863] * [-1035.086] (-1053.493) (-1035.280) (-1036.956) -- 0:00:57
50000 -- (-1040.054) (-1037.361) [-1035.683] (-1041.860) * (-1033.694) (-1050.100) [-1035.376] (-1038.025) -- 0:00:57
Average standard deviation of split frequencies: 0.028402
50500 -- (-1034.038) (-1037.568) [-1033.872] (-1040.558) * (-1034.394) (-1055.276) [-1034.402] (-1037.231) -- 0:00:56
51000 -- [-1035.557] (-1036.204) (-1036.106) (-1037.383) * [-1035.481] (-1043.695) (-1034.429) (-1039.191) -- 0:00:55
51500 -- [-1036.121] (-1037.683) (-1035.571) (-1034.339) * (-1035.548) [-1052.180] (-1037.023) (-1043.709) -- 0:00:55
52000 -- (-1035.399) (-1034.081) (-1038.107) [-1036.125] * (-1036.752) (-1055.636) (-1036.914) [-1035.271] -- 0:00:54
52500 -- (-1035.026) (-1035.669) (-1038.050) [-1034.175] * (-1035.760) (-1043.653) [-1037.401] (-1035.314) -- 0:00:54
53000 -- [-1038.261] (-1043.391) (-1037.426) (-1034.826) * [-1040.632] (-1036.095) (-1034.746) (-1036.322) -- 0:00:53
53500 -- [-1038.874] (-1041.426) (-1034.752) (-1035.320) * [-1033.916] (-1038.340) (-1034.118) (-1036.321) -- 0:00:53
54000 -- [-1036.725] (-1035.040) (-1036.049) (-1034.731) * (-1033.916) (-1041.288) [-1034.850] (-1036.573) -- 0:00:52
54500 -- (-1035.776) [-1040.083] (-1033.453) (-1037.275) * (-1035.222) (-1037.882) [-1034.398] (-1036.848) -- 0:00:52
55000 -- (-1039.626) [-1044.217] (-1033.527) (-1036.790) * (-1034.956) (-1035.559) [-1035.987] (-1035.140) -- 0:00:51
Average standard deviation of split frequencies: 0.027592
55500 -- (-1036.740) [-1037.764] (-1034.693) (-1037.118) * (-1034.702) [-1033.867] (-1035.961) (-1035.220) -- 0:00:51
56000 -- [-1034.362] (-1038.170) (-1035.245) (-1036.579) * [-1034.821] (-1034.392) (-1035.978) (-1039.374) -- 0:00:50
56500 -- [-1035.174] (-1036.437) (-1034.356) (-1036.704) * (-1034.849) [-1037.928] (-1034.436) (-1035.865) -- 0:00:50
57000 -- (-1038.947) (-1034.520) [-1037.092] (-1036.542) * [-1034.940] (-1038.925) (-1036.593) (-1034.964) -- 0:00:49
57500 -- [-1037.633] (-1035.443) (-1038.616) (-1038.103) * (-1034.967) [-1036.501] (-1036.720) (-1035.936) -- 0:00:49
58000 -- (-1036.384) [-1039.800] (-1035.208) (-1043.614) * (-1033.877) [-1033.680] (-1037.331) (-1040.854) -- 0:00:48
58500 -- (-1036.056) (-1037.803) (-1035.731) [-1039.041] * (-1034.535) [-1035.903] (-1035.434) (-1040.902) -- 0:00:48
59000 -- [-1036.464] (-1034.673) (-1040.707) (-1036.657) * (-1034.496) (-1035.143) (-1038.110) [-1036.318] -- 0:00:47
59500 -- (-1039.803) (-1036.373) [-1037.409] (-1036.084) * (-1033.747) (-1037.467) [-1036.598] (-1036.731) -- 0:00:47
60000 -- [-1034.528] (-1035.976) (-1034.037) (-1040.628) * (-1033.834) [-1036.862] (-1034.256) (-1037.774) -- 0:00:47
Average standard deviation of split frequencies: 0.024088
60500 -- (-1038.057) [-1034.090] (-1034.446) (-1034.591) * (-1041.172) (-1036.831) (-1033.621) [-1036.143] -- 0:00:46
61000 -- (-1033.931) (-1035.236) [-1034.447] (-1034.918) * [-1035.432] (-1037.655) (-1033.644) (-1037.139) -- 0:00:46
61500 -- (-1035.414) (-1034.784) (-1034.023) [-1035.406] * (-1036.336) (-1035.816) [-1037.145] (-1035.699) -- 0:00:45
62000 -- (-1034.084) (-1034.245) (-1034.908) [-1034.529] * (-1034.741) (-1035.231) [-1035.910] (-1038.176) -- 0:00:45
62500 -- (-1035.130) [-1033.840] (-1034.922) (-1037.052) * [-1034.734] (-1034.208) (-1035.381) (-1038.471) -- 0:00:45
63000 -- [-1035.112] (-1033.635) (-1036.450) (-1036.025) * (-1034.682) (-1033.853) [-1035.380] (-1040.490) -- 0:00:44
63500 -- [-1035.181] (-1037.178) (-1036.928) (-1035.322) * (-1034.637) (-1037.473) [-1034.815] (-1036.854) -- 0:00:58
64000 -- [-1037.992] (-1038.456) (-1037.104) (-1038.097) * (-1033.858) [-1036.798] (-1037.802) (-1036.416) -- 0:00:58
64500 -- (-1038.049) [-1034.387] (-1035.972) (-1035.467) * (-1034.945) (-1034.341) (-1035.942) [-1036.316] -- 0:00:58
65000 -- (-1036.722) (-1036.484) (-1037.552) [-1035.111] * (-1037.886) (-1035.954) (-1036.879) [-1035.467] -- 0:00:57
Average standard deviation of split frequencies: 0.029250
65500 -- (-1036.955) (-1036.581) [-1037.384] (-1038.796) * [-1034.983] (-1035.393) (-1034.455) (-1034.613) -- 0:00:57
66000 -- (-1035.401) [-1035.800] (-1037.840) (-1035.813) * [-1034.422] (-1038.041) (-1034.910) (-1034.364) -- 0:00:56
66500 -- (-1035.465) (-1037.831) (-1036.675) [-1035.320] * [-1034.095] (-1037.845) (-1037.718) (-1039.244) -- 0:00:56
67000 -- [-1035.849] (-1035.891) (-1037.205) (-1037.800) * [-1034.011] (-1034.927) (-1035.198) (-1038.268) -- 0:00:55
67500 -- (-1037.210) (-1035.531) (-1037.003) [-1036.634] * (-1040.999) (-1034.586) (-1035.027) [-1035.858] -- 0:00:55
68000 -- (-1035.259) (-1037.218) [-1034.041] (-1039.119) * (-1038.111) (-1035.513) [-1035.375] (-1037.610) -- 0:00:54
68500 -- (-1035.587) [-1035.550] (-1035.568) (-1035.096) * (-1035.103) (-1037.589) (-1039.521) [-1035.874] -- 0:00:54
69000 -- (-1034.981) [-1035.713] (-1035.843) (-1034.676) * (-1033.742) (-1039.746) (-1035.510) [-1041.571] -- 0:00:53
69500 -- (-1034.413) (-1035.763) [-1035.021] (-1036.419) * (-1035.849) (-1038.554) [-1034.802] (-1036.752) -- 0:00:53
70000 -- (-1037.233) (-1036.480) (-1035.314) [-1037.309] * (-1034.819) (-1040.971) (-1034.886) [-1036.940] -- 0:00:53
Average standard deviation of split frequencies: 0.031686
70500 -- (-1035.675) (-1035.210) [-1035.524] (-1039.587) * (-1036.464) [-1036.725] (-1036.094) (-1038.131) -- 0:00:52
71000 -- (-1034.100) [-1038.159] (-1035.614) (-1039.677) * (-1041.587) [-1035.201] (-1037.449) (-1038.613) -- 0:00:52
71500 -- (-1035.223) (-1034.710) [-1035.822] (-1042.397) * (-1039.099) [-1033.631] (-1040.473) (-1037.015) -- 0:00:51
72000 -- (-1035.028) [-1034.260] (-1035.501) (-1038.532) * [-1035.009] (-1033.658) (-1037.513) (-1036.471) -- 0:00:51
72500 -- (-1033.931) (-1036.906) [-1034.068] (-1035.508) * (-1034.777) (-1042.423) [-1035.495] (-1038.235) -- 0:00:51
73000 -- (-1035.314) (-1035.302) [-1035.514] (-1037.236) * (-1035.303) [-1036.492] (-1034.100) (-1033.809) -- 0:00:50
73500 -- (-1034.738) [-1035.236] (-1037.311) (-1035.958) * (-1034.847) (-1035.098) [-1034.053] (-1035.950) -- 0:00:50
74000 -- (-1036.266) (-1037.959) [-1038.848] (-1037.562) * [-1035.138] (-1036.031) (-1038.908) (-1034.128) -- 0:00:50
74500 -- (-1034.729) [-1035.697] (-1037.066) (-1036.517) * (-1037.621) (-1034.815) [-1036.912] (-1034.682) -- 0:00:49
75000 -- (-1033.926) (-1034.323) [-1035.159] (-1035.063) * (-1035.154) (-1035.580) [-1039.206] (-1034.013) -- 0:00:49
Average standard deviation of split frequencies: 0.028843
75500 -- (-1034.530) [-1035.801] (-1034.808) (-1036.485) * [-1036.151] (-1035.967) (-1034.583) (-1034.264) -- 0:00:48
76000 -- (-1033.895) (-1034.336) [-1035.634] (-1035.670) * (-1034.744) [-1034.254] (-1036.134) (-1036.630) -- 0:00:48
76500 -- (-1035.996) (-1035.320) [-1036.801] (-1034.868) * (-1034.544) [-1034.444] (-1034.311) (-1036.867) -- 0:00:48
77000 -- [-1036.610] (-1036.227) (-1037.225) (-1033.854) * (-1035.778) [-1034.635] (-1034.448) (-1034.340) -- 0:00:47
77500 -- (-1034.203) [-1033.750] (-1038.305) (-1036.529) * (-1037.380) [-1040.401] (-1035.965) (-1035.456) -- 0:00:47
78000 -- (-1034.711) [-1033.729] (-1037.530) (-1035.413) * [-1035.146] (-1038.282) (-1034.266) (-1039.075) -- 0:00:47
78500 -- (-1033.782) (-1034.275) (-1036.853) [-1036.060] * [-1035.934] (-1039.171) (-1034.164) (-1041.473) -- 0:00:46
79000 -- [-1035.567] (-1036.316) (-1035.010) (-1034.469) * [-1036.180] (-1035.696) (-1036.585) (-1038.163) -- 0:00:46
79500 -- (-1034.576) (-1035.413) (-1037.829) [-1035.491] * (-1037.284) [-1035.783] (-1037.788) (-1036.667) -- 0:00:46
80000 -- (-1033.671) (-1038.312) [-1035.629] (-1034.768) * (-1037.305) [-1033.637] (-1036.630) (-1033.651) -- 0:00:57
Average standard deviation of split frequencies: 0.031849
80500 -- [-1037.580] (-1036.052) (-1037.890) (-1034.950) * [-1040.169] (-1033.632) (-1035.089) (-1034.405) -- 0:00:57
81000 -- [-1036.416] (-1035.602) (-1037.760) (-1036.696) * (-1038.090) (-1038.872) (-1033.736) [-1034.246] -- 0:00:56
81500 -- (-1034.907) (-1035.828) (-1037.639) [-1036.568] * [-1034.948] (-1035.819) (-1036.773) (-1033.427) -- 0:00:56
82000 -- (-1036.279) (-1036.329) [-1039.402] (-1034.507) * (-1039.365) [-1035.675] (-1035.001) (-1037.273) -- 0:00:55
82500 -- [-1035.946] (-1036.336) (-1040.615) (-1033.824) * [-1037.087] (-1040.674) (-1036.896) (-1034.031) -- 0:00:55
83000 -- [-1036.619] (-1034.268) (-1038.254) (-1035.189) * (-1036.404) [-1034.158] (-1038.348) (-1033.360) -- 0:00:55
83500 -- [-1035.570] (-1035.176) (-1035.495) (-1034.007) * [-1034.570] (-1034.837) (-1041.729) (-1037.778) -- 0:00:54
84000 -- (-1035.747) [-1036.953] (-1037.652) (-1033.899) * (-1035.001) (-1035.429) (-1034.176) [-1036.848] -- 0:00:54
84500 -- (-1037.452) (-1037.594) [-1034.928] (-1034.175) * (-1036.741) (-1038.126) (-1038.247) [-1033.661] -- 0:00:54
85000 -- (-1034.939) (-1043.349) [-1034.965] (-1035.289) * (-1035.346) (-1034.585) (-1035.413) [-1035.555] -- 0:00:53
Average standard deviation of split frequencies: 0.029600
85500 -- (-1034.112) [-1040.737] (-1034.797) (-1036.937) * [-1041.932] (-1035.962) (-1035.507) (-1034.697) -- 0:00:53
86000 -- (-1038.585) [-1034.555] (-1036.829) (-1034.135) * [-1036.607] (-1034.562) (-1036.026) (-1034.442) -- 0:00:53
86500 -- (-1037.471) (-1034.395) (-1034.874) [-1034.349] * [-1034.240] (-1034.653) (-1036.420) (-1036.545) -- 0:00:52
87000 -- (-1035.722) (-1035.368) (-1036.333) [-1037.409] * (-1035.953) (-1037.109) [-1036.386] (-1034.092) -- 0:00:52
87500 -- (-1034.305) (-1035.793) (-1034.569) [-1034.153] * (-1036.224) (-1035.363) (-1036.573) [-1035.320] -- 0:00:52
88000 -- (-1035.529) (-1035.301) (-1034.409) [-1035.768] * (-1038.535) [-1033.622] (-1035.124) (-1034.765) -- 0:00:51
88500 -- [-1037.982] (-1035.139) (-1034.133) (-1036.010) * (-1037.937) (-1034.082) (-1035.729) [-1035.139] -- 0:00:51
89000 -- (-1035.777) (-1035.570) [-1034.481] (-1035.493) * (-1035.813) (-1035.357) (-1036.866) [-1034.015] -- 0:00:51
89500 -- [-1035.363] (-1035.667) (-1034.694) (-1035.537) * (-1035.156) (-1038.966) (-1036.654) [-1035.079] -- 0:00:50
90000 -- [-1035.088] (-1034.792) (-1036.909) (-1036.411) * (-1038.228) (-1035.171) [-1039.419] (-1039.868) -- 0:00:50
Average standard deviation of split frequencies: 0.026776
90500 -- (-1037.338) [-1034.009] (-1035.876) (-1038.495) * [-1036.601] (-1035.004) (-1036.203) (-1036.980) -- 0:00:50
91000 -- (-1037.777) [-1036.545] (-1035.972) (-1035.814) * (-1035.079) [-1033.643] (-1036.805) (-1035.204) -- 0:00:49
91500 -- (-1035.001) [-1034.990] (-1033.652) (-1037.693) * [-1035.058] (-1038.039) (-1041.981) (-1035.435) -- 0:00:49
92000 -- (-1034.134) (-1036.197) (-1038.635) [-1038.272] * (-1035.938) (-1033.610) (-1035.281) [-1035.997] -- 0:00:49
92500 -- [-1035.862] (-1034.252) (-1038.321) (-1035.626) * (-1034.735) (-1035.806) [-1040.174] (-1034.547) -- 0:00:49
93000 -- (-1041.627) (-1035.672) (-1036.270) [-1033.791] * (-1034.777) (-1034.376) [-1036.070] (-1038.027) -- 0:00:48
93500 -- (-1036.736) (-1033.830) (-1035.769) [-1035.270] * (-1035.958) [-1037.306] (-1036.775) (-1037.359) -- 0:00:48
94000 -- (-1034.996) [-1035.588] (-1035.233) (-1035.302) * (-1038.370) [-1040.487] (-1038.037) (-1034.502) -- 0:00:48
94500 -- [-1036.484] (-1035.706) (-1034.300) (-1038.266) * (-1037.385) [-1036.384] (-1038.964) (-1035.742) -- 0:00:47
95000 -- (-1035.611) [-1035.065] (-1039.194) (-1034.766) * (-1035.990) (-1038.968) [-1039.450] (-1035.298) -- 0:00:47
Average standard deviation of split frequencies: 0.023777
95500 -- (-1035.059) (-1034.448) (-1039.372) [-1033.823] * (-1039.572) [-1034.695] (-1037.352) (-1035.359) -- 0:00:47
96000 -- (-1034.661) [-1036.612] (-1034.792) (-1035.649) * (-1035.874) (-1034.779) (-1036.470) [-1035.941] -- 0:00:47
96500 -- (-1034.683) (-1035.878) [-1035.766] (-1035.267) * (-1035.547) (-1037.320) (-1035.885) [-1037.308] -- 0:00:56
97000 -- (-1034.490) (-1034.196) (-1035.509) [-1034.004] * (-1036.689) [-1039.903] (-1034.913) (-1034.903) -- 0:00:55
97500 -- (-1034.031) [-1034.296] (-1034.956) (-1036.432) * (-1035.924) [-1036.210] (-1038.206) (-1036.326) -- 0:00:55
98000 -- (-1034.761) [-1034.087] (-1034.806) (-1035.789) * (-1035.413) [-1034.123] (-1039.531) (-1036.474) -- 0:00:55
98500 -- [-1035.426] (-1036.652) (-1036.592) (-1039.422) * (-1036.023) [-1037.363] (-1040.930) (-1035.611) -- 0:00:54
99000 -- (-1035.348) (-1035.040) (-1036.432) [-1036.763] * (-1035.662) (-1037.784) (-1036.002) [-1035.883] -- 0:00:54
99500 -- (-1035.483) (-1036.278) (-1035.807) [-1036.003] * [-1035.358] (-1034.582) (-1040.707) (-1035.089) -- 0:00:54
100000 -- (-1036.097) (-1036.604) [-1036.325] (-1035.451) * [-1037.072] (-1035.600) (-1036.369) (-1034.065) -- 0:00:54
Average standard deviation of split frequencies: 0.025879
100500 -- (-1036.264) [-1035.121] (-1035.096) (-1034.878) * [-1037.132] (-1035.387) (-1034.823) (-1035.650) -- 0:00:53
101000 -- (-1036.424) [-1034.303] (-1038.396) (-1039.016) * (-1039.088) (-1036.863) (-1034.552) [-1036.712] -- 0:00:53
101500 -- (-1035.776) (-1036.147) (-1035.258) [-1034.342] * (-1039.283) (-1039.772) (-1034.786) [-1036.745] -- 0:00:53
102000 -- [-1035.309] (-1037.138) (-1033.602) (-1035.119) * [-1035.530] (-1037.447) (-1037.895) (-1034.316) -- 0:00:52
102500 -- [-1038.172] (-1036.134) (-1033.507) (-1036.843) * (-1035.607) (-1040.258) (-1035.853) [-1034.177] -- 0:00:52
103000 -- (-1038.552) (-1035.228) (-1034.958) [-1038.197] * (-1036.142) [-1037.027] (-1036.091) (-1037.575) -- 0:00:52
103500 -- (-1040.833) (-1035.522) (-1034.084) [-1039.285] * (-1036.989) (-1040.103) (-1035.095) [-1033.654] -- 0:00:51
104000 -- (-1036.921) (-1034.988) [-1035.529] (-1034.725) * [-1034.617] (-1037.469) (-1035.166) (-1037.509) -- 0:00:51
104500 -- (-1038.532) (-1033.812) (-1035.462) [-1034.464] * (-1035.477) (-1038.011) [-1034.698] (-1036.231) -- 0:00:51
105000 -- (-1040.725) (-1036.009) [-1034.307] (-1035.185) * (-1034.664) (-1034.813) (-1034.032) [-1040.945] -- 0:00:51
Average standard deviation of split frequencies: 0.024989
105500 -- (-1040.582) [-1036.589] (-1035.692) (-1033.665) * (-1034.717) (-1038.324) [-1035.368] (-1035.004) -- 0:00:50
106000 -- [-1037.016] (-1038.421) (-1037.985) (-1035.680) * (-1033.667) (-1037.965) [-1039.137] (-1034.554) -- 0:00:50
106500 -- (-1036.229) (-1037.484) [-1036.130] (-1036.559) * [-1034.950] (-1035.830) (-1039.243) (-1036.024) -- 0:00:50
107000 -- [-1036.276] (-1036.560) (-1036.297) (-1035.901) * (-1034.950) [-1037.063] (-1038.783) (-1040.116) -- 0:00:50
107500 -- (-1036.109) (-1036.021) [-1034.309] (-1036.175) * (-1035.771) (-1034.077) (-1039.516) [-1036.259] -- 0:00:49
108000 -- (-1037.862) [-1035.250] (-1037.270) (-1034.186) * (-1035.088) (-1038.391) [-1034.662] (-1036.493) -- 0:00:49
108500 -- [-1035.887] (-1036.282) (-1042.152) (-1036.354) * (-1037.952) (-1035.767) [-1034.761] (-1040.052) -- 0:00:49
109000 -- (-1037.403) [-1034.588] (-1036.453) (-1037.597) * (-1037.056) (-1037.134) [-1033.762] (-1038.463) -- 0:00:49
109500 -- [-1035.636] (-1033.899) (-1034.044) (-1036.051) * (-1037.519) (-1034.023) (-1035.129) [-1034.221] -- 0:00:48
110000 -- [-1035.777] (-1036.090) (-1037.671) (-1036.795) * (-1037.024) [-1035.108] (-1035.807) (-1034.271) -- 0:00:48
Average standard deviation of split frequencies: 0.025761
110500 -- (-1035.087) [-1034.874] (-1034.739) (-1034.592) * (-1037.731) [-1035.092] (-1037.851) (-1035.048) -- 0:00:48
111000 -- (-1036.201) (-1035.471) (-1034.753) [-1036.368] * (-1037.320) (-1033.961) [-1035.019] (-1035.748) -- 0:00:48
111500 -- (-1040.529) (-1035.472) (-1039.567) [-1035.456] * [-1036.261] (-1034.705) (-1036.340) (-1035.319) -- 0:00:47
112000 -- (-1038.338) [-1034.900] (-1035.280) (-1037.390) * (-1037.111) (-1036.770) [-1035.949] (-1036.861) -- 0:00:47
112500 -- (-1034.357) (-1033.932) (-1035.701) [-1035.069] * (-1037.359) [-1035.299] (-1037.415) (-1035.268) -- 0:00:47
113000 -- (-1034.370) (-1034.990) (-1035.588) [-1037.635] * [-1035.038] (-1037.552) (-1039.149) (-1036.103) -- 0:00:54
113500 -- (-1035.478) (-1035.175) [-1034.375] (-1036.942) * (-1033.953) (-1038.044) [-1036.537] (-1038.898) -- 0:00:54
114000 -- (-1034.625) [-1036.043] (-1033.804) (-1034.598) * (-1035.335) (-1035.322) [-1037.160] (-1035.253) -- 0:00:54
114500 -- (-1035.643) (-1036.639) [-1034.599] (-1036.505) * (-1034.800) (-1035.103) (-1037.480) [-1040.581] -- 0:00:54
115000 -- (-1035.322) (-1034.846) (-1039.463) [-1038.468] * (-1035.655) (-1036.273) [-1035.070] (-1038.158) -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-1036.699) [-1035.281] (-1040.402) (-1035.915) * (-1036.046) [-1035.590] (-1033.604) (-1036.288) -- 0:00:53
116000 -- [-1039.663] (-1035.288) (-1037.747) (-1035.766) * (-1037.873) [-1034.480] (-1034.178) (-1034.121) -- 0:00:53
116500 -- (-1035.667) [-1036.762] (-1038.669) (-1039.495) * (-1041.944) [-1039.776] (-1033.909) (-1036.831) -- 0:00:53
117000 -- [-1036.787] (-1035.244) (-1035.979) (-1035.099) * [-1038.625] (-1038.017) (-1037.313) (-1036.659) -- 0:00:52
117500 -- (-1036.451) (-1035.710) (-1035.044) [-1035.253] * [-1034.124] (-1037.427) (-1034.399) (-1038.262) -- 0:00:52
118000 -- (-1035.120) [-1037.904] (-1035.247) (-1038.372) * (-1034.512) [-1034.951] (-1035.585) (-1037.736) -- 0:00:52
118500 -- (-1034.452) [-1036.297] (-1035.224) (-1036.601) * (-1036.106) (-1039.147) [-1033.453] (-1035.137) -- 0:00:52
119000 -- (-1034.835) (-1035.565) [-1035.220] (-1035.428) * [-1034.405] (-1035.264) (-1036.061) (-1038.240) -- 0:00:51
119500 -- (-1035.323) (-1034.125) [-1035.233] (-1040.338) * (-1034.939) [-1036.169] (-1038.509) (-1038.030) -- 0:00:51
120000 -- (-1036.086) (-1035.105) [-1034.939] (-1037.889) * [-1033.928] (-1033.949) (-1037.226) (-1036.931) -- 0:00:51
Average standard deviation of split frequencies: 0.023029
120500 -- (-1037.835) (-1036.242) (-1034.630) [-1036.466] * [-1035.070] (-1036.278) (-1037.310) (-1034.544) -- 0:00:51
121000 -- [-1034.888] (-1037.747) (-1035.212) (-1037.497) * (-1034.450) (-1039.446) [-1034.414] (-1034.336) -- 0:00:50
121500 -- (-1035.166) (-1036.276) (-1038.076) [-1034.934] * (-1034.509) (-1035.097) [-1035.676] (-1034.372) -- 0:00:50
122000 -- (-1038.675) (-1037.682) (-1038.828) [-1034.448] * [-1035.005] (-1035.887) (-1034.734) (-1038.002) -- 0:00:50
122500 -- (-1039.777) (-1039.110) (-1037.649) [-1035.698] * (-1034.346) [-1035.617] (-1034.915) (-1035.289) -- 0:00:50
123000 -- (-1037.414) [-1039.231] (-1037.748) (-1034.729) * [-1033.969] (-1037.223) (-1036.129) (-1033.684) -- 0:00:49
123500 -- (-1037.025) (-1037.370) [-1037.795] (-1034.364) * (-1033.885) (-1035.994) [-1035.608] (-1035.067) -- 0:00:49
124000 -- (-1036.454) (-1036.063) (-1034.345) [-1034.569] * (-1036.230) [-1037.252] (-1041.077) (-1034.128) -- 0:00:49
124500 -- (-1036.715) (-1037.487) [-1037.483] (-1035.004) * (-1036.058) (-1041.855) (-1042.161) [-1034.785] -- 0:00:49
125000 -- (-1035.656) (-1035.129) [-1033.471] (-1035.027) * (-1035.378) (-1036.386) [-1038.499] (-1034.785) -- 0:00:49
Average standard deviation of split frequencies: 0.022626
125500 -- [-1036.122] (-1035.323) (-1034.871) (-1036.424) * [-1034.559] (-1040.264) (-1034.139) (-1033.698) -- 0:00:48
126000 -- (-1037.365) (-1033.782) [-1035.416] (-1034.053) * (-1034.973) (-1041.191) [-1035.178] (-1033.874) -- 0:00:48
126500 -- (-1037.420) (-1040.524) (-1037.077) [-1034.794] * (-1036.167) (-1036.087) [-1034.039] (-1036.283) -- 0:00:48
127000 -- (-1035.068) [-1033.982] (-1038.393) (-1034.062) * (-1037.147) (-1036.520) [-1035.678] (-1036.487) -- 0:00:48
127500 -- (-1035.295) (-1036.477) [-1036.296] (-1034.986) * [-1038.551] (-1034.914) (-1034.816) (-1038.443) -- 0:00:47
128000 -- [-1035.353] (-1034.791) (-1035.431) (-1035.801) * (-1036.038) (-1035.347) [-1036.166] (-1036.569) -- 0:00:47
128500 -- (-1036.566) (-1035.982) (-1034.077) [-1036.750] * (-1038.342) [-1035.061] (-1035.368) (-1034.674) -- 0:00:47
129000 -- (-1033.430) (-1034.979) (-1037.281) [-1035.193] * (-1036.837) (-1034.431) [-1034.661] (-1033.887) -- 0:00:47
129500 -- (-1034.526) (-1034.977) (-1037.244) [-1034.451] * (-1034.656) (-1033.848) [-1035.655] (-1034.979) -- 0:00:47
130000 -- (-1034.906) [-1036.150] (-1039.516) (-1035.008) * [-1033.997] (-1034.459) (-1036.125) (-1034.979) -- 0:00:53
Average standard deviation of split frequencies: 0.021285
130500 -- [-1038.259] (-1034.581) (-1034.757) (-1035.767) * (-1033.795) [-1035.157] (-1038.409) (-1037.199) -- 0:00:53
131000 -- (-1036.138) [-1035.723] (-1034.930) (-1035.077) * (-1033.799) (-1037.641) [-1034.609] (-1034.063) -- 0:00:53
131500 -- (-1035.552) (-1034.039) (-1036.847) [-1035.913] * (-1033.776) [-1041.603] (-1034.346) (-1035.080) -- 0:00:52
132000 -- (-1037.415) (-1037.767) [-1034.091] (-1034.744) * (-1034.035) (-1033.708) [-1034.839] (-1037.037) -- 0:00:52
132500 -- (-1036.384) [-1036.175] (-1034.714) (-1035.138) * [-1035.856] (-1035.112) (-1035.417) (-1038.648) -- 0:00:52
133000 -- (-1041.749) (-1034.860) [-1037.357] (-1042.076) * (-1035.151) [-1034.735] (-1034.491) (-1037.309) -- 0:00:52
133500 -- [-1036.092] (-1034.046) (-1038.465) (-1038.538) * (-1036.100) (-1035.010) (-1034.690) [-1034.229] -- 0:00:51
134000 -- (-1039.123) (-1033.804) [-1040.045] (-1033.675) * (-1038.440) (-1034.505) [-1037.289] (-1035.125) -- 0:00:51
134500 -- (-1034.841) (-1033.764) [-1035.488] (-1033.705) * (-1036.118) [-1035.506] (-1035.869) (-1034.023) -- 0:00:51
135000 -- (-1033.817) (-1034.064) (-1040.818) [-1035.429] * (-1039.830) [-1037.962] (-1035.440) (-1035.036) -- 0:00:51
Average standard deviation of split frequencies: 0.020302
135500 -- (-1034.545) (-1037.042) (-1045.276) [-1036.937] * [-1037.757] (-1034.766) (-1037.019) (-1034.807) -- 0:00:51
136000 -- (-1036.425) [-1036.876] (-1036.430) (-1042.541) * (-1034.272) (-1037.296) (-1036.297) [-1035.334] -- 0:00:50
136500 -- (-1035.189) (-1034.569) [-1035.645] (-1041.719) * (-1034.001) (-1035.904) (-1036.196) [-1034.859] -- 0:00:50
137000 -- (-1035.458) (-1034.816) [-1036.046] (-1040.474) * (-1034.651) (-1035.025) (-1037.947) [-1034.023] -- 0:00:50
137500 -- (-1039.306) [-1034.475] (-1037.694) (-1039.233) * [-1034.715] (-1034.887) (-1038.949) (-1033.848) -- 0:00:50
138000 -- (-1036.026) (-1037.014) [-1034.574] (-1039.271) * [-1036.763] (-1040.545) (-1036.693) (-1036.246) -- 0:00:49
138500 -- (-1034.247) [-1033.478] (-1034.405) (-1034.787) * (-1036.098) [-1037.393] (-1034.580) (-1034.958) -- 0:00:49
139000 -- (-1036.454) (-1035.108) [-1034.097] (-1036.452) * (-1042.194) (-1037.150) [-1034.813] (-1034.898) -- 0:00:49
139500 -- [-1034.787] (-1036.362) (-1034.454) (-1034.587) * (-1038.891) (-1036.851) [-1035.655] (-1037.133) -- 0:00:49
140000 -- (-1036.995) (-1036.320) (-1036.069) [-1040.234] * (-1035.339) [-1034.795] (-1037.308) (-1041.654) -- 0:00:49
Average standard deviation of split frequencies: 0.019948
140500 -- [-1034.469] (-1037.822) (-1035.548) (-1042.598) * [-1034.085] (-1034.669) (-1038.631) (-1036.697) -- 0:00:48
141000 -- [-1035.041] (-1034.868) (-1036.904) (-1039.924) * (-1034.493) (-1034.736) [-1037.570] (-1039.639) -- 0:00:48
141500 -- [-1036.085] (-1034.924) (-1035.845) (-1035.173) * (-1034.442) (-1034.862) [-1035.380] (-1037.111) -- 0:00:48
142000 -- [-1034.035] (-1035.030) (-1040.970) (-1034.976) * [-1038.421] (-1034.516) (-1034.036) (-1034.386) -- 0:00:48
142500 -- (-1035.770) (-1034.597) (-1042.347) [-1040.386] * [-1039.383] (-1034.503) (-1034.525) (-1036.962) -- 0:00:48
143000 -- (-1035.292) (-1037.268) (-1036.875) [-1035.516] * (-1039.174) (-1034.881) [-1036.554] (-1036.711) -- 0:00:47
143500 -- (-1035.466) (-1035.187) [-1035.272] (-1036.707) * (-1034.314) [-1036.496] (-1035.257) (-1036.467) -- 0:00:47
144000 -- (-1035.295) [-1035.642] (-1034.231) (-1035.872) * (-1034.496) (-1036.584) [-1036.679] (-1034.142) -- 0:00:47
144500 -- (-1037.296) (-1036.150) [-1037.755] (-1038.785) * (-1041.887) (-1038.913) (-1035.372) [-1034.419] -- 0:00:47
145000 -- (-1040.631) [-1034.535] (-1036.564) (-1036.653) * (-1033.731) (-1037.363) (-1036.376) [-1035.658] -- 0:00:47
Average standard deviation of split frequencies: 0.019834
145500 -- (-1034.690) [-1034.933] (-1036.806) (-1040.899) * (-1033.946) (-1037.975) (-1042.070) [-1034.688] -- 0:00:46
146000 -- [-1034.827] (-1035.496) (-1035.933) (-1034.121) * [-1033.938] (-1039.660) (-1036.870) (-1034.967) -- 0:00:52
146500 -- (-1037.433) [-1035.825] (-1034.894) (-1034.027) * (-1036.099) (-1038.087) [-1034.627] (-1036.769) -- 0:00:52
147000 -- (-1034.962) (-1040.702) [-1034.879] (-1035.211) * (-1045.181) (-1039.896) [-1034.211] (-1040.507) -- 0:00:52
147500 -- [-1037.052] (-1040.028) (-1035.485) (-1034.277) * (-1037.910) (-1037.971) [-1037.191] (-1039.771) -- 0:00:52
148000 -- [-1034.246] (-1036.983) (-1035.236) (-1035.382) * (-1037.918) [-1037.191] (-1036.676) (-1037.463) -- 0:00:51
148500 -- (-1035.498) [-1034.711] (-1034.203) (-1034.961) * (-1036.278) (-1037.572) [-1037.570] (-1035.883) -- 0:00:51
149000 -- (-1036.281) [-1036.649] (-1033.916) (-1036.843) * (-1035.302) (-1036.694) [-1036.759] (-1035.378) -- 0:00:51
149500 -- (-1036.695) (-1035.822) (-1035.066) [-1035.123] * [-1037.223] (-1037.004) (-1035.230) (-1037.651) -- 0:00:51
150000 -- (-1037.977) (-1034.753) (-1035.420) [-1033.726] * [-1037.505] (-1041.713) (-1036.728) (-1034.670) -- 0:00:51
Average standard deviation of split frequencies: 0.021306
150500 -- [-1036.144] (-1035.021) (-1034.955) (-1034.693) * (-1036.292) [-1035.591] (-1036.614) (-1033.929) -- 0:00:50
151000 -- (-1036.769) (-1037.293) [-1037.392] (-1034.375) * (-1035.390) [-1038.545] (-1034.342) (-1035.038) -- 0:00:50
151500 -- (-1038.780) (-1035.871) [-1034.741] (-1033.628) * (-1035.884) [-1038.524] (-1036.742) (-1035.067) -- 0:00:50
152000 -- (-1034.559) (-1033.808) (-1034.823) [-1034.617] * (-1036.338) [-1034.228] (-1035.717) (-1035.421) -- 0:00:50
152500 -- [-1036.572] (-1035.873) (-1034.902) (-1033.747) * (-1038.510) (-1035.163) (-1035.202) [-1035.148] -- 0:00:50
153000 -- (-1034.330) (-1037.675) [-1041.190] (-1034.322) * (-1037.670) [-1035.063] (-1034.245) (-1036.037) -- 0:00:49
153500 -- (-1039.817) [-1035.571] (-1033.803) (-1035.837) * (-1036.080) (-1035.199) (-1035.245) [-1036.862] -- 0:00:49
154000 -- [-1034.599] (-1034.772) (-1034.245) (-1034.779) * [-1034.851] (-1038.798) (-1034.346) (-1036.896) -- 0:00:49
154500 -- (-1035.753) [-1036.503] (-1034.227) (-1038.874) * (-1034.661) [-1034.729] (-1034.897) (-1037.898) -- 0:00:49
155000 -- (-1033.981) (-1044.396) [-1033.793] (-1036.851) * (-1033.895) [-1033.902] (-1034.102) (-1038.792) -- 0:00:49
Average standard deviation of split frequencies: 0.020699
155500 -- [-1035.160] (-1040.575) (-1036.636) (-1036.642) * (-1034.715) (-1038.881) (-1033.986) [-1035.541] -- 0:00:48
156000 -- (-1042.822) [-1034.604] (-1035.645) (-1038.638) * (-1035.404) (-1038.640) [-1037.560] (-1038.313) -- 0:00:48
156500 -- (-1036.011) [-1035.599] (-1034.182) (-1041.755) * (-1037.036) [-1035.450] (-1037.741) (-1036.894) -- 0:00:48
157000 -- (-1036.064) (-1036.632) (-1041.434) [-1041.330] * (-1037.312) (-1038.870) [-1040.598] (-1035.955) -- 0:00:48
157500 -- (-1033.771) [-1035.522] (-1040.086) (-1037.217) * (-1036.898) (-1036.683) (-1033.563) [-1033.782] -- 0:00:48
158000 -- (-1035.450) (-1039.247) (-1035.608) [-1035.480] * (-1036.721) (-1036.182) [-1035.105] (-1036.690) -- 0:00:47
158500 -- (-1037.385) (-1037.790) (-1037.160) [-1036.221] * (-1037.593) (-1036.262) [-1036.178] (-1042.078) -- 0:00:47
159000 -- (-1035.650) (-1036.282) (-1035.069) [-1034.527] * (-1036.984) (-1038.745) (-1036.373) [-1038.765] -- 0:00:47
159500 -- (-1036.682) [-1034.368] (-1034.382) (-1035.776) * (-1038.460) (-1035.619) [-1037.893] (-1038.717) -- 0:00:47
160000 -- [-1036.640] (-1038.009) (-1036.646) (-1035.605) * [-1038.540] (-1039.149) (-1035.024) (-1038.643) -- 0:00:47
Average standard deviation of split frequencies: 0.021419
160500 -- [-1035.905] (-1033.846) (-1034.507) (-1038.347) * (-1043.072) (-1034.766) (-1034.392) [-1035.555] -- 0:00:47
161000 -- (-1034.793) (-1039.525) [-1034.492] (-1035.992) * [-1037.144] (-1035.819) (-1036.251) (-1036.084) -- 0:00:46
161500 -- (-1033.676) [-1036.517] (-1036.253) (-1037.474) * [-1035.941] (-1036.733) (-1035.631) (-1038.301) -- 0:00:46
162000 -- [-1034.837] (-1036.565) (-1039.355) (-1035.086) * [-1034.721] (-1039.107) (-1034.940) (-1037.827) -- 0:00:46
162500 -- [-1033.734] (-1034.833) (-1035.136) (-1034.863) * (-1034.831) (-1036.005) [-1035.906] (-1043.949) -- 0:00:51
163000 -- (-1034.985) (-1035.881) [-1033.754] (-1034.682) * [-1034.379] (-1039.298) (-1035.085) (-1041.483) -- 0:00:51
163500 -- (-1035.465) (-1036.667) [-1035.088] (-1039.670) * (-1034.897) (-1036.029) [-1037.049] (-1037.581) -- 0:00:51
164000 -- [-1034.195] (-1038.263) (-1037.509) (-1033.830) * (-1035.698) (-1039.714) [-1037.565] (-1036.567) -- 0:00:50
164500 -- (-1034.887) (-1035.813) [-1038.108] (-1036.232) * [-1033.981] (-1040.692) (-1034.780) (-1035.132) -- 0:00:50
165000 -- [-1034.841] (-1035.739) (-1034.012) (-1035.879) * (-1034.837) (-1040.052) (-1036.948) [-1035.083] -- 0:00:50
Average standard deviation of split frequencies: 0.022313
165500 -- (-1035.823) (-1036.163) (-1034.321) [-1036.657] * [-1039.867] (-1034.562) (-1036.000) (-1039.996) -- 0:00:50
166000 -- (-1033.973) (-1036.610) [-1038.534] (-1034.756) * (-1040.513) (-1034.450) (-1034.561) [-1035.066] -- 0:00:50
166500 -- (-1038.326) (-1037.591) (-1039.097) [-1037.567] * [-1035.320] (-1039.389) (-1033.757) (-1035.658) -- 0:00:50
167000 -- [-1037.471] (-1035.911) (-1034.845) (-1037.027) * [-1036.020] (-1035.525) (-1035.154) (-1035.730) -- 0:00:49
167500 -- (-1034.783) (-1036.275) (-1035.163) [-1037.664] * (-1036.960) [-1035.582] (-1035.569) (-1033.685) -- 0:00:49
168000 -- (-1034.968) (-1035.559) (-1035.813) [-1035.946] * (-1035.952) (-1035.865) (-1034.808) [-1035.405] -- 0:00:49
168500 -- (-1038.442) (-1034.007) [-1035.139] (-1035.091) * [-1035.915] (-1039.181) (-1034.529) (-1034.878) -- 0:00:49
169000 -- (-1034.577) [-1035.187] (-1039.062) (-1037.696) * (-1039.599) (-1040.125) [-1033.893] (-1034.981) -- 0:00:49
169500 -- (-1035.350) (-1036.530) (-1036.194) [-1038.468] * (-1034.839) (-1034.621) (-1036.964) [-1036.078] -- 0:00:48
170000 -- [-1037.730] (-1036.273) (-1036.222) (-1040.432) * (-1038.924) (-1037.119) [-1035.104] (-1035.622) -- 0:00:48
Average standard deviation of split frequencies: 0.025135
170500 -- (-1035.409) (-1035.530) [-1034.469] (-1035.085) * (-1039.330) (-1040.138) (-1034.684) [-1034.724] -- 0:00:48
171000 -- [-1034.362] (-1035.390) (-1034.799) (-1037.379) * [-1038.698] (-1041.212) (-1034.871) (-1033.617) -- 0:00:48
171500 -- (-1035.190) (-1035.515) (-1035.566) [-1035.395] * (-1034.761) (-1039.292) (-1038.653) [-1034.456] -- 0:00:48
172000 -- (-1035.082) (-1034.344) [-1036.685] (-1034.921) * (-1034.177) (-1034.335) (-1034.660) [-1035.166] -- 0:00:48
172500 -- (-1035.777) [-1034.207] (-1035.655) (-1035.588) * [-1035.138] (-1034.340) (-1035.748) (-1035.363) -- 0:00:47
173000 -- [-1036.027] (-1034.483) (-1035.999) (-1039.475) * (-1035.141) (-1034.670) [-1035.724] (-1037.472) -- 0:00:47
173500 -- [-1033.816] (-1034.361) (-1034.893) (-1043.028) * (-1035.586) (-1035.199) [-1034.164] (-1035.494) -- 0:00:47
174000 -- (-1035.417) (-1036.050) (-1036.504) [-1037.361] * (-1034.301) [-1034.219] (-1036.345) (-1033.848) -- 0:00:47
174500 -- (-1034.288) (-1036.118) [-1036.780] (-1040.119) * [-1035.680] (-1035.771) (-1035.445) (-1037.274) -- 0:00:47
175000 -- [-1034.850] (-1036.415) (-1035.428) (-1038.182) * (-1037.335) (-1035.820) [-1035.884] (-1036.013) -- 0:00:47
Average standard deviation of split frequencies: 0.025516
175500 -- [-1036.827] (-1036.729) (-1034.921) (-1039.936) * (-1034.206) (-1037.848) (-1036.373) [-1036.428] -- 0:00:46
176000 -- (-1036.444) [-1034.573] (-1036.789) (-1037.369) * [-1033.966] (-1041.347) (-1035.372) (-1035.301) -- 0:00:46
176500 -- (-1038.327) (-1034.587) [-1034.783] (-1040.092) * (-1038.310) (-1034.312) [-1035.857] (-1036.415) -- 0:00:46
177000 -- (-1036.789) [-1035.953] (-1035.703) (-1035.321) * (-1035.695) (-1035.910) (-1044.365) [-1036.697] -- 0:00:46
177500 -- (-1035.096) [-1036.124] (-1036.469) (-1038.433) * [-1038.792] (-1035.373) (-1039.688) (-1035.413) -- 0:00:46
178000 -- (-1034.574) (-1034.907) [-1035.038] (-1035.832) * (-1036.767) (-1035.817) (-1037.403) [-1035.222] -- 0:00:46
178500 -- (-1033.648) (-1035.956) [-1039.948] (-1034.299) * [-1036.636] (-1035.761) (-1035.579) (-1036.864) -- 0:00:46
179000 -- (-1038.491) [-1033.913] (-1036.683) (-1034.440) * (-1034.307) (-1034.332) [-1036.467] (-1035.879) -- 0:00:50
179500 -- [-1035.912] (-1034.660) (-1035.518) (-1035.962) * (-1034.109) (-1034.176) (-1036.503) [-1034.694] -- 0:00:50
180000 -- (-1035.348) (-1036.482) (-1035.299) [-1036.674] * (-1037.061) (-1037.757) [-1037.690] (-1035.518) -- 0:00:50
Average standard deviation of split frequencies: 0.023628
180500 -- [-1036.037] (-1037.091) (-1034.680) (-1037.844) * (-1037.207) (-1035.728) (-1040.536) [-1038.970] -- 0:00:49
181000 -- [-1037.458] (-1037.726) (-1035.106) (-1035.884) * (-1036.276) (-1036.625) (-1036.413) [-1039.527] -- 0:00:49
181500 -- (-1041.458) (-1034.326) (-1035.278) [-1036.047] * (-1037.862) (-1035.116) [-1035.681] (-1037.662) -- 0:00:49
182000 -- (-1034.850) [-1039.929] (-1036.151) (-1035.273) * (-1038.290) (-1035.565) [-1035.618] (-1036.357) -- 0:00:49
182500 -- (-1034.384) (-1038.413) (-1033.895) [-1034.878] * [-1035.155] (-1036.113) (-1036.146) (-1034.769) -- 0:00:49
183000 -- (-1034.098) (-1037.088) [-1036.205] (-1036.929) * (-1038.695) (-1037.155) [-1037.256] (-1036.043) -- 0:00:49
183500 -- (-1034.482) [-1037.250] (-1034.392) (-1037.203) * (-1038.164) (-1035.854) (-1037.900) [-1035.038] -- 0:00:48
184000 -- [-1035.692] (-1036.205) (-1033.850) (-1038.673) * [-1037.379] (-1036.615) (-1036.255) (-1035.589) -- 0:00:48
184500 -- (-1035.609) [-1036.218] (-1034.167) (-1034.279) * (-1036.025) [-1035.566] (-1034.097) (-1034.675) -- 0:00:48
185000 -- [-1036.380] (-1035.781) (-1037.100) (-1037.018) * (-1035.236) (-1034.539) [-1035.418] (-1038.051) -- 0:00:48
Average standard deviation of split frequencies: 0.022677
185500 -- [-1035.253] (-1036.149) (-1033.741) (-1037.622) * [-1035.543] (-1034.058) (-1035.276) (-1036.278) -- 0:00:48
186000 -- [-1036.137] (-1036.069) (-1033.943) (-1035.430) * [-1034.435] (-1033.628) (-1036.249) (-1034.971) -- 0:00:48
186500 -- (-1040.411) [-1038.003] (-1036.051) (-1034.704) * (-1035.467) (-1034.774) [-1035.149] (-1036.940) -- 0:00:47
187000 -- [-1033.683] (-1035.106) (-1037.665) (-1034.029) * (-1038.219) (-1037.286) [-1034.644] (-1036.398) -- 0:00:47
187500 -- [-1034.842] (-1040.392) (-1035.419) (-1034.637) * (-1036.981) (-1035.940) [-1034.941] (-1035.284) -- 0:00:47
188000 -- (-1034.686) (-1035.323) [-1035.084] (-1034.020) * (-1036.342) (-1035.177) [-1034.060] (-1036.380) -- 0:00:47
188500 -- [-1033.799] (-1035.539) (-1035.129) (-1034.389) * (-1039.085) (-1037.155) [-1035.723] (-1038.030) -- 0:00:47
189000 -- (-1035.399) [-1036.389] (-1035.264) (-1034.514) * (-1035.188) (-1039.146) [-1040.292] (-1038.086) -- 0:00:47
189500 -- (-1036.768) [-1035.751] (-1033.801) (-1035.711) * (-1035.429) (-1037.192) [-1036.008] (-1036.272) -- 0:00:47
190000 -- [-1039.290] (-1039.773) (-1035.067) (-1035.927) * (-1036.998) (-1036.955) (-1036.609) [-1035.813] -- 0:00:46
Average standard deviation of split frequencies: 0.023763
190500 -- (-1038.152) (-1039.721) (-1034.758) [-1034.144] * (-1037.624) [-1038.200] (-1034.715) (-1036.691) -- 0:00:46
191000 -- (-1036.148) [-1035.411] (-1034.404) (-1034.144) * [-1036.153] (-1037.963) (-1034.148) (-1036.378) -- 0:00:46
191500 -- [-1040.005] (-1035.306) (-1035.984) (-1034.689) * (-1035.301) [-1035.420] (-1033.684) (-1035.852) -- 0:00:46
192000 -- (-1037.559) [-1034.357] (-1034.877) (-1033.881) * (-1039.740) (-1035.990) [-1034.064] (-1037.479) -- 0:00:46
192500 -- [-1035.666] (-1038.926) (-1035.547) (-1036.071) * (-1038.721) [-1033.635] (-1034.146) (-1035.956) -- 0:00:46
193000 -- (-1035.450) (-1035.156) [-1034.048] (-1034.975) * (-1035.646) (-1037.359) [-1033.524] (-1034.688) -- 0:00:45
193500 -- (-1038.442) (-1035.864) [-1036.938] (-1037.211) * (-1038.802) (-1036.251) (-1034.404) [-1037.323] -- 0:00:45
194000 -- [-1035.372] (-1036.158) (-1039.304) (-1035.416) * (-1038.952) (-1041.401) (-1037.493) [-1034.095] -- 0:00:45
194500 -- (-1035.140) (-1036.540) [-1034.038] (-1035.640) * (-1036.030) [-1039.014] (-1037.046) (-1037.300) -- 0:00:45
195000 -- [-1037.273] (-1036.259) (-1034.475) (-1039.460) * [-1035.723] (-1036.787) (-1037.549) (-1033.958) -- 0:00:45
Average standard deviation of split frequencies: 0.022581
195500 -- (-1034.032) (-1036.082) [-1034.934] (-1038.398) * [-1034.108] (-1040.005) (-1035.060) (-1037.056) -- 0:00:49
196000 -- (-1038.714) [-1035.722] (-1037.761) (-1037.194) * (-1034.739) (-1035.241) [-1035.848] (-1036.681) -- 0:00:49
196500 -- (-1035.758) (-1036.153) [-1035.225] (-1036.712) * (-1035.392) (-1033.891) [-1036.390] (-1034.756) -- 0:00:49
197000 -- (-1038.092) (-1034.768) (-1035.199) [-1038.001] * [-1035.225] (-1035.073) (-1035.648) (-1034.607) -- 0:00:48
197500 -- (-1036.681) [-1036.218] (-1036.865) (-1037.592) * (-1034.511) (-1035.660) [-1036.375] (-1035.392) -- 0:00:48
198000 -- [-1033.676] (-1035.989) (-1034.631) (-1038.228) * (-1037.857) (-1035.852) [-1037.022] (-1036.358) -- 0:00:48
198500 -- [-1035.272] (-1035.070) (-1034.846) (-1036.561) * (-1036.472) [-1034.536] (-1035.149) (-1034.800) -- 0:00:48
199000 -- (-1034.169) [-1042.434] (-1037.936) (-1035.438) * [-1036.655] (-1036.572) (-1035.839) (-1035.678) -- 0:00:48
199500 -- (-1033.771) (-1037.276) (-1039.323) [-1035.316] * [-1039.464] (-1038.874) (-1038.497) (-1037.190) -- 0:00:48
200000 -- (-1041.736) (-1036.975) [-1039.983] (-1035.413) * (-1038.085) [-1037.860] (-1036.456) (-1043.165) -- 0:00:48
Average standard deviation of split frequencies: 0.021273
200500 -- (-1038.894) (-1035.558) [-1037.355] (-1035.134) * (-1036.378) [-1034.559] (-1034.645) (-1038.437) -- 0:00:47
201000 -- [-1036.461] (-1034.921) (-1037.216) (-1035.710) * [-1035.152] (-1037.244) (-1038.534) (-1033.747) -- 0:00:47
201500 -- (-1037.314) (-1036.924) (-1037.289) [-1035.555] * [-1035.130] (-1038.823) (-1036.682) (-1034.794) -- 0:00:47
202000 -- (-1035.785) [-1035.188] (-1036.774) (-1033.984) * [-1033.854] (-1037.795) (-1034.530) (-1040.984) -- 0:00:47
202500 -- (-1038.901) (-1035.295) (-1038.371) [-1036.529] * [-1037.729] (-1038.141) (-1034.832) (-1040.790) -- 0:00:47
203000 -- [-1038.594] (-1034.381) (-1035.620) (-1037.434) * (-1037.883) (-1039.879) (-1035.350) [-1041.302] -- 0:00:47
203500 -- (-1034.186) (-1034.057) (-1040.465) [-1035.478] * (-1037.073) [-1034.586] (-1034.591) (-1040.193) -- 0:00:46
204000 -- (-1034.144) (-1033.934) (-1035.526) [-1038.828] * (-1036.639) [-1035.378] (-1034.843) (-1041.279) -- 0:00:46
204500 -- (-1034.748) (-1034.616) (-1035.788) [-1034.187] * (-1035.559) [-1034.218] (-1034.563) (-1046.033) -- 0:00:46
205000 -- (-1035.891) [-1035.405] (-1034.147) (-1034.335) * (-1037.965) (-1035.695) [-1033.783] (-1035.698) -- 0:00:46
Average standard deviation of split frequencies: 0.019451
205500 -- (-1036.454) (-1035.021) [-1034.005] (-1033.371) * (-1034.810) [-1034.725] (-1034.791) (-1034.605) -- 0:00:46
206000 -- (-1036.318) (-1034.033) (-1036.319) [-1034.295] * [-1035.241] (-1035.527) (-1039.580) (-1035.255) -- 0:00:46
206500 -- [-1035.762] (-1034.229) (-1042.219) (-1038.276) * (-1039.166) [-1033.728] (-1036.533) (-1034.839) -- 0:00:46
207000 -- (-1035.370) (-1034.754) (-1036.071) [-1037.229] * (-1034.015) [-1033.513] (-1038.443) (-1037.141) -- 0:00:45
207500 -- (-1034.835) [-1034.277] (-1040.706) (-1034.337) * [-1034.853] (-1033.665) (-1038.236) (-1034.543) -- 0:00:45
208000 -- [-1037.920] (-1037.714) (-1036.616) (-1033.828) * (-1038.149) (-1033.745) [-1037.676] (-1035.059) -- 0:00:45
208500 -- [-1041.274] (-1039.694) (-1036.059) (-1034.129) * (-1046.396) [-1039.296] (-1038.842) (-1035.062) -- 0:00:45
209000 -- [-1037.949] (-1037.600) (-1034.571) (-1034.819) * [-1037.549] (-1035.405) (-1034.787) (-1034.381) -- 0:00:45
209500 -- (-1034.041) (-1033.975) [-1036.228] (-1035.412) * [-1036.644] (-1034.568) (-1034.900) (-1034.871) -- 0:00:45
210000 -- [-1033.863] (-1034.156) (-1037.123) (-1035.134) * (-1034.953) (-1034.369) (-1037.895) [-1036.828] -- 0:00:45
Average standard deviation of split frequencies: 0.018647
210500 -- [-1034.685] (-1037.031) (-1035.502) (-1036.929) * (-1033.940) [-1035.136] (-1035.576) (-1034.666) -- 0:00:45
211000 -- (-1036.381) [-1036.960] (-1034.364) (-1035.366) * (-1033.968) (-1038.210) (-1035.199) [-1034.570] -- 0:00:44
211500 -- [-1034.641] (-1036.944) (-1034.837) (-1034.474) * (-1034.312) [-1035.195] (-1035.058) (-1037.025) -- 0:00:44
212000 -- [-1038.046] (-1036.998) (-1034.687) (-1039.718) * (-1037.763) (-1037.617) [-1043.790] (-1038.652) -- 0:00:48
212500 -- (-1038.305) [-1035.796] (-1035.701) (-1035.437) * [-1035.366] (-1034.967) (-1037.460) (-1040.908) -- 0:00:48
213000 -- [-1036.061] (-1035.421) (-1034.883) (-1035.482) * (-1034.644) (-1039.032) (-1035.338) [-1035.136] -- 0:00:48
213500 -- (-1040.268) (-1035.766) [-1035.478] (-1038.611) * (-1036.700) (-1035.916) (-1035.691) [-1036.802] -- 0:00:47
214000 -- (-1036.459) (-1038.079) (-1035.814) [-1034.497] * (-1037.638) (-1035.450) (-1035.003) [-1038.025] -- 0:00:47
214500 -- (-1036.965) [-1040.746] (-1034.733) (-1034.794) * [-1033.631] (-1035.911) (-1038.099) (-1037.730) -- 0:00:47
215000 -- (-1038.143) [-1036.907] (-1034.017) (-1034.177) * (-1033.659) (-1033.955) (-1036.806) [-1036.055] -- 0:00:47
Average standard deviation of split frequencies: 0.018034
215500 -- (-1036.034) (-1036.994) [-1034.359] (-1034.264) * (-1033.659) [-1033.734] (-1035.258) (-1039.288) -- 0:00:47
216000 -- (-1035.611) [-1037.494] (-1035.382) (-1035.096) * [-1033.723] (-1036.262) (-1036.013) (-1035.935) -- 0:00:47
216500 -- (-1038.427) (-1037.413) [-1037.452] (-1034.347) * (-1035.300) (-1036.924) [-1035.701] (-1036.144) -- 0:00:47
217000 -- (-1036.690) (-1040.263) [-1036.288] (-1038.404) * [-1036.456] (-1036.130) (-1038.404) (-1034.720) -- 0:00:46
217500 -- (-1037.309) (-1036.170) (-1034.139) [-1037.087] * (-1035.578) (-1037.512) [-1034.521] (-1034.452) -- 0:00:46
218000 -- (-1036.821) (-1037.032) [-1034.256] (-1034.093) * (-1035.374) (-1035.022) [-1037.066] (-1034.827) -- 0:00:46
218500 -- (-1035.293) (-1037.237) (-1037.368) [-1036.961] * (-1035.862) (-1035.696) (-1034.873) [-1035.641] -- 0:00:46
219000 -- [-1034.855] (-1037.506) (-1036.779) (-1038.451) * (-1034.693) (-1035.573) (-1036.921) [-1034.243] -- 0:00:46
219500 -- (-1035.146) (-1035.525) (-1037.019) [-1035.485] * [-1034.338] (-1040.491) (-1033.906) (-1034.971) -- 0:00:46
220000 -- (-1034.194) (-1038.009) (-1039.201) [-1035.676] * (-1035.898) (-1034.689) (-1034.256) [-1034.422] -- 0:00:46
Average standard deviation of split frequencies: 0.017719
220500 -- (-1040.419) [-1037.468] (-1036.694) (-1034.933) * (-1037.028) (-1035.365) [-1034.661] (-1034.185) -- 0:00:45
221000 -- [-1036.717] (-1035.799) (-1037.018) (-1034.260) * [-1036.316] (-1034.706) (-1034.349) (-1035.316) -- 0:00:45
221500 -- (-1035.786) (-1034.907) [-1036.136] (-1038.477) * [-1035.395] (-1038.264) (-1034.899) (-1036.342) -- 0:00:45
222000 -- [-1034.514] (-1036.592) (-1035.057) (-1035.258) * (-1037.094) (-1037.475) (-1035.329) [-1035.599] -- 0:00:45
222500 -- (-1033.654) [-1037.952] (-1037.176) (-1036.870) * [-1035.423] (-1036.217) (-1034.964) (-1036.263) -- 0:00:45
223000 -- (-1033.606) (-1038.500) (-1034.596) [-1033.957] * (-1035.759) [-1034.244] (-1035.993) (-1037.348) -- 0:00:45
223500 -- (-1035.186) [-1037.451] (-1035.811) (-1035.145) * [-1033.859] (-1034.583) (-1035.192) (-1035.098) -- 0:00:45
224000 -- (-1035.347) (-1037.000) [-1036.374] (-1035.112) * (-1035.224) (-1040.584) (-1034.208) [-1035.179] -- 0:00:45
224500 -- [-1035.289] (-1036.927) (-1036.848) (-1035.320) * (-1034.028) [-1038.510] (-1034.800) (-1034.104) -- 0:00:44
225000 -- (-1036.820) (-1036.853) (-1038.787) [-1034.608] * [-1034.957] (-1037.114) (-1034.689) (-1043.353) -- 0:00:44
Average standard deviation of split frequencies: 0.016339
225500 -- (-1037.291) (-1035.016) (-1036.230) [-1038.969] * (-1033.623) [-1035.624] (-1035.553) (-1037.161) -- 0:00:44
226000 -- (-1034.639) (-1037.214) (-1035.850) [-1036.122] * (-1037.037) [-1039.382] (-1034.627) (-1036.022) -- 0:00:44
226500 -- (-1035.643) (-1037.538) [-1034.973] (-1036.145) * (-1036.214) (-1036.111) (-1034.125) [-1038.540] -- 0:00:44
227000 -- (-1035.483) [-1037.922] (-1036.202) (-1035.624) * (-1034.370) [-1036.183] (-1034.125) (-1038.952) -- 0:00:44
227500 -- (-1044.766) (-1034.427) [-1035.504] (-1036.705) * [-1034.150] (-1037.571) (-1034.280) (-1036.972) -- 0:00:44
228000 -- (-1037.152) (-1034.426) [-1034.588] (-1035.898) * (-1036.810) (-1038.331) (-1035.855) [-1038.692] -- 0:00:44
228500 -- [-1033.556] (-1034.151) (-1033.876) (-1036.090) * (-1034.204) (-1037.892) [-1037.782] (-1037.514) -- 0:00:47
229000 -- (-1037.072) (-1034.422) (-1036.907) [-1037.271] * [-1035.917] (-1038.891) (-1039.239) (-1034.673) -- 0:00:47
229500 -- [-1036.352] (-1035.524) (-1034.733) (-1034.573) * [-1034.942] (-1042.236) (-1035.180) (-1034.204) -- 0:00:47
230000 -- (-1038.120) (-1033.573) [-1035.751] (-1038.030) * (-1034.345) [-1034.454] (-1034.657) (-1033.953) -- 0:00:46
Average standard deviation of split frequencies: 0.017210
230500 -- [-1036.865] (-1035.995) (-1035.201) (-1034.883) * [-1034.598] (-1035.855) (-1034.372) (-1034.337) -- 0:00:46
231000 -- (-1034.662) (-1037.423) [-1034.758] (-1034.144) * (-1034.359) (-1035.126) (-1034.651) [-1035.978] -- 0:00:46
231500 -- (-1034.247) (-1036.313) [-1035.035] (-1034.058) * (-1035.193) (-1035.934) [-1034.425] (-1036.738) -- 0:00:46
232000 -- (-1036.895) [-1034.990] (-1036.553) (-1036.204) * (-1035.013) [-1034.873] (-1035.282) (-1036.249) -- 0:00:46
232500 -- [-1036.895] (-1037.144) (-1036.647) (-1037.920) * [-1034.833] (-1033.689) (-1035.214) (-1037.236) -- 0:00:46
233000 -- (-1035.197) (-1036.162) [-1034.042] (-1038.066) * (-1035.553) [-1041.915] (-1036.716) (-1037.839) -- 0:00:46
233500 -- [-1035.413] (-1034.446) (-1034.043) (-1036.611) * (-1037.967) (-1036.405) [-1045.448] (-1035.973) -- 0:00:45
234000 -- [-1036.080] (-1037.446) (-1036.922) (-1037.959) * (-1036.549) (-1036.193) (-1038.063) [-1039.409] -- 0:00:45
234500 -- (-1036.921) [-1036.611] (-1034.674) (-1037.377) * (-1035.946) (-1040.107) [-1039.735] (-1037.463) -- 0:00:45
235000 -- (-1039.003) (-1038.325) (-1037.543) [-1036.833] * (-1034.708) (-1038.549) [-1034.775] (-1038.338) -- 0:00:45
Average standard deviation of split frequencies: 0.016757
235500 -- (-1037.155) (-1046.236) (-1038.012) [-1034.387] * [-1034.717] (-1037.626) (-1034.611) (-1034.064) -- 0:00:45
236000 -- (-1033.914) [-1034.385] (-1036.564) (-1033.711) * (-1034.610) [-1037.146] (-1033.795) (-1035.901) -- 0:00:45
236500 -- (-1035.618) (-1038.559) [-1036.130] (-1035.767) * [-1034.257] (-1035.189) (-1037.367) (-1036.947) -- 0:00:45
237000 -- [-1034.569] (-1039.581) (-1039.209) (-1034.475) * (-1035.326) [-1034.657] (-1035.634) (-1038.986) -- 0:00:45
237500 -- (-1034.172) (-1037.152) (-1035.379) [-1034.964] * (-1038.447) (-1035.490) (-1033.757) [-1036.530] -- 0:00:44
238000 -- (-1033.581) [-1037.019] (-1035.335) (-1043.641) * (-1036.916) [-1037.586] (-1033.866) (-1038.785) -- 0:00:44
238500 -- (-1033.998) (-1038.329) (-1035.902) [-1035.946] * (-1035.857) (-1035.490) (-1036.532) [-1035.982] -- 0:00:44
239000 -- (-1034.404) (-1037.398) (-1036.008) [-1035.019] * [-1036.961] (-1036.064) (-1035.600) (-1034.617) -- 0:00:44
239500 -- (-1034.984) (-1037.526) [-1035.269] (-1035.154) * (-1039.270) (-1037.174) [-1034.617] (-1034.927) -- 0:00:44
240000 -- [-1035.217] (-1035.857) (-1040.051) (-1036.612) * (-1038.537) [-1038.080] (-1035.831) (-1034.562) -- 0:00:44
Average standard deviation of split frequencies: 0.015235
240500 -- (-1034.198) (-1035.621) [-1035.757] (-1035.049) * [-1035.399] (-1037.789) (-1034.512) (-1036.216) -- 0:00:44
241000 -- (-1035.865) [-1034.847] (-1034.355) (-1034.847) * (-1033.776) (-1041.130) [-1034.127] (-1037.865) -- 0:00:44
241500 -- (-1037.212) [-1033.584] (-1036.892) (-1034.293) * (-1034.002) [-1037.062] (-1034.191) (-1034.272) -- 0:00:43
242000 -- (-1036.784) [-1034.512] (-1039.037) (-1034.293) * (-1034.445) (-1034.550) (-1034.294) [-1038.650] -- 0:00:43
242500 -- (-1035.483) (-1034.507) [-1039.828] (-1036.035) * [-1034.515] (-1033.502) (-1036.050) (-1037.640) -- 0:00:43
243000 -- (-1035.464) (-1035.464) (-1041.223) [-1034.924] * [-1035.186] (-1036.120) (-1039.558) (-1035.466) -- 0:00:43
243500 -- (-1034.653) (-1035.055) (-1039.319) [-1035.059] * (-1035.595) (-1035.934) (-1039.080) [-1038.444] -- 0:00:43
244000 -- (-1037.214) (-1035.957) [-1036.368] (-1034.905) * (-1036.635) (-1034.141) (-1038.509) [-1038.303] -- 0:00:43
244500 -- (-1040.414) (-1035.041) [-1034.505] (-1037.877) * (-1035.532) (-1034.724) [-1037.211] (-1036.861) -- 0:00:43
245000 -- (-1037.235) (-1036.179) [-1035.905] (-1035.023) * [-1035.569] (-1033.879) (-1037.996) (-1035.433) -- 0:00:46
Average standard deviation of split frequencies: 0.016501
245500 -- [-1036.661] (-1034.520) (-1035.711) (-1036.574) * (-1035.343) (-1036.452) (-1038.472) [-1037.110] -- 0:00:46
246000 -- (-1037.088) [-1035.938] (-1035.585) (-1037.234) * [-1038.745] (-1036.005) (-1035.185) (-1036.275) -- 0:00:45
246500 -- (-1034.055) (-1036.153) [-1035.346] (-1035.991) * (-1037.439) (-1035.389) (-1036.073) [-1037.686] -- 0:00:45
247000 -- (-1033.449) (-1036.651) (-1035.513) [-1034.597] * (-1035.574) (-1035.364) (-1036.657) [-1036.060] -- 0:00:45
247500 -- (-1034.103) (-1036.522) [-1037.179] (-1034.841) * (-1033.701) (-1036.750) (-1036.605) [-1036.095] -- 0:00:45
248000 -- [-1034.452] (-1037.025) (-1037.553) (-1035.436) * (-1034.695) (-1037.170) (-1039.224) [-1037.218] -- 0:00:45
248500 -- (-1034.203) (-1035.520) (-1038.140) [-1033.794] * [-1034.816] (-1038.123) (-1042.085) (-1036.134) -- 0:00:45
249000 -- (-1035.415) (-1035.440) (-1037.338) [-1033.891] * (-1034.580) (-1036.047) [-1036.925] (-1037.739) -- 0:00:45
249500 -- (-1035.042) (-1035.490) (-1034.922) [-1038.003] * [-1034.238] (-1036.191) (-1035.125) (-1035.739) -- 0:00:45
250000 -- [-1034.928] (-1037.521) (-1037.583) (-1036.793) * [-1034.388] (-1034.873) (-1035.661) (-1035.549) -- 0:00:45
Average standard deviation of split frequencies: 0.016194
250500 -- [-1033.420] (-1036.690) (-1038.235) (-1034.298) * (-1035.084) [-1035.758] (-1034.292) (-1037.554) -- 0:00:44
251000 -- (-1035.979) [-1035.869] (-1038.603) (-1034.300) * (-1035.900) [-1037.159] (-1034.208) (-1035.985) -- 0:00:44
251500 -- (-1035.906) (-1034.682) (-1036.713) [-1037.790] * [-1036.752] (-1036.587) (-1037.226) (-1036.163) -- 0:00:44
252000 -- (-1041.009) [-1036.085] (-1036.524) (-1036.531) * [-1038.707] (-1035.019) (-1034.805) (-1036.667) -- 0:00:44
252500 -- (-1040.279) (-1036.366) [-1035.454] (-1034.364) * [-1039.800] (-1035.109) (-1034.575) (-1035.005) -- 0:00:44
253000 -- (-1037.977) [-1036.040] (-1035.485) (-1033.943) * (-1039.768) (-1037.806) [-1039.794] (-1039.003) -- 0:00:44
253500 -- (-1038.223) (-1034.738) (-1036.611) [-1036.038] * (-1036.102) (-1035.087) [-1036.239] (-1035.767) -- 0:00:44
254000 -- (-1037.973) (-1034.841) [-1035.762] (-1037.124) * (-1038.915) (-1036.818) [-1035.571] (-1036.468) -- 0:00:44
254500 -- (-1035.342) [-1034.295] (-1034.658) (-1037.396) * (-1038.572) (-1038.672) (-1035.560) [-1033.798] -- 0:00:43
255000 -- (-1036.819) (-1036.722) [-1036.633] (-1034.422) * (-1035.314) (-1036.033) [-1034.093] (-1033.611) -- 0:00:43
Average standard deviation of split frequencies: 0.015038
255500 -- (-1038.292) (-1034.585) (-1033.994) [-1034.139] * (-1036.765) (-1035.243) (-1037.505) [-1035.888] -- 0:00:43
256000 -- (-1038.286) (-1042.057) (-1037.078) [-1034.168] * (-1039.473) (-1038.073) [-1034.187] (-1038.307) -- 0:00:43
256500 -- [-1038.161] (-1035.123) (-1039.422) (-1035.155) * (-1035.922) (-1035.477) (-1033.848) [-1037.801] -- 0:00:43
257000 -- (-1037.062) [-1037.605] (-1035.643) (-1035.616) * [-1036.395] (-1035.108) (-1038.832) (-1036.728) -- 0:00:43
257500 -- (-1034.873) (-1036.786) [-1034.029] (-1036.129) * [-1037.595] (-1035.222) (-1035.714) (-1036.206) -- 0:00:43
258000 -- (-1034.303) (-1036.381) (-1034.582) [-1034.135] * (-1035.899) (-1034.369) (-1035.036) [-1042.063] -- 0:00:43
258500 -- [-1042.495] (-1036.788) (-1034.561) (-1036.506) * (-1036.812) (-1035.090) (-1034.236) [-1036.896] -- 0:00:43
259000 -- (-1035.441) (-1035.452) (-1039.511) [-1036.190] * (-1035.935) (-1033.975) (-1033.920) [-1035.968] -- 0:00:42
259500 -- (-1036.208) (-1035.836) [-1034.561] (-1035.555) * (-1034.789) [-1035.606] (-1035.730) (-1036.641) -- 0:00:42
260000 -- [-1036.678] (-1034.354) (-1035.861) (-1036.222) * (-1038.118) (-1036.502) [-1033.452] (-1038.683) -- 0:00:42
Average standard deviation of split frequencies: 0.014870
260500 -- [-1034.597] (-1034.153) (-1035.629) (-1035.639) * (-1037.215) (-1035.208) [-1033.687] (-1035.513) -- 0:00:42
261000 -- (-1034.956) (-1035.509) [-1034.610] (-1037.045) * (-1034.066) (-1037.149) (-1033.665) [-1035.020] -- 0:00:42
261500 -- (-1038.754) [-1035.945] (-1034.519) (-1039.284) * (-1034.329) (-1035.527) [-1034.244] (-1034.442) -- 0:00:45
262000 -- (-1034.521) [-1036.591] (-1036.158) (-1039.807) * (-1033.980) [-1034.978] (-1033.544) (-1036.085) -- 0:00:45
262500 -- (-1034.982) (-1034.168) [-1039.133] (-1037.139) * (-1034.199) [-1036.105] (-1035.089) (-1040.858) -- 0:00:44
263000 -- (-1034.528) (-1037.297) (-1034.793) [-1035.433] * (-1036.023) [-1037.385] (-1035.121) (-1037.585) -- 0:00:44
263500 -- (-1034.495) [-1037.237] (-1034.654) (-1034.599) * (-1040.463) (-1037.750) [-1033.695] (-1036.881) -- 0:00:44
264000 -- (-1037.740) [-1034.564] (-1035.329) (-1034.485) * (-1036.893) (-1037.348) [-1034.550] (-1037.682) -- 0:00:44
264500 -- (-1034.455) (-1034.738) (-1035.516) [-1037.479] * [-1034.441] (-1035.314) (-1033.868) (-1037.487) -- 0:00:44
265000 -- (-1034.819) (-1034.658) (-1035.366) [-1036.724] * [-1036.947] (-1034.256) (-1037.476) (-1041.641) -- 0:00:44
Average standard deviation of split frequencies: 0.014768
265500 -- (-1037.336) (-1036.336) (-1034.409) [-1035.041] * (-1036.378) [-1033.602] (-1035.938) (-1036.804) -- 0:00:44
266000 -- [-1034.336] (-1036.284) (-1036.120) (-1036.604) * (-1040.008) (-1036.872) (-1036.180) [-1037.003] -- 0:00:44
266500 -- (-1035.627) [-1035.141] (-1035.606) (-1037.242) * (-1036.758) (-1035.944) [-1039.742] (-1035.418) -- 0:00:44
267000 -- (-1035.530) [-1035.022] (-1035.464) (-1036.171) * (-1035.350) (-1036.995) [-1036.409] (-1034.189) -- 0:00:43
267500 -- (-1038.464) [-1036.086] (-1034.234) (-1036.083) * [-1042.749] (-1035.502) (-1036.549) (-1040.391) -- 0:00:43
268000 -- [-1034.632] (-1042.569) (-1034.192) (-1039.648) * [-1034.654] (-1035.004) (-1038.505) (-1037.465) -- 0:00:43
268500 -- [-1036.372] (-1034.552) (-1036.821) (-1040.027) * (-1036.499) (-1034.625) (-1034.546) [-1035.288] -- 0:00:43
269000 -- (-1036.455) [-1036.094] (-1034.646) (-1038.030) * (-1036.944) (-1035.081) [-1035.717] (-1035.437) -- 0:00:43
269500 -- [-1037.048] (-1036.143) (-1036.943) (-1036.331) * (-1044.903) (-1034.872) (-1041.022) [-1035.580] -- 0:00:43
270000 -- (-1038.836) (-1035.151) [-1035.954] (-1036.452) * [-1037.044] (-1043.915) (-1035.764) (-1039.535) -- 0:00:43
Average standard deviation of split frequencies: 0.014116
270500 -- [-1035.590] (-1034.504) (-1034.548) (-1039.685) * (-1036.559) [-1038.835] (-1036.262) (-1035.468) -- 0:00:43
271000 -- (-1035.114) (-1034.324) [-1034.046] (-1035.946) * [-1036.430] (-1037.032) (-1035.979) (-1034.386) -- 0:00:43
271500 -- (-1037.173) (-1034.562) (-1036.793) [-1036.193] * (-1036.725) (-1037.856) (-1037.140) [-1034.243] -- 0:00:42
272000 -- [-1034.833] (-1035.165) (-1034.601) (-1034.716) * (-1037.032) [-1036.283] (-1036.693) (-1035.103) -- 0:00:42
272500 -- [-1034.210] (-1034.654) (-1036.192) (-1035.072) * [-1035.808] (-1035.235) (-1036.304) (-1034.866) -- 0:00:42
273000 -- (-1033.512) [-1035.402] (-1035.448) (-1042.823) * (-1035.960) [-1035.491] (-1039.794) (-1034.317) -- 0:00:42
273500 -- (-1038.172) (-1035.518) [-1034.992] (-1038.005) * (-1036.988) [-1035.267] (-1037.305) (-1035.037) -- 0:00:42
274000 -- (-1035.658) [-1035.338] (-1035.354) (-1036.944) * (-1039.683) (-1034.983) [-1034.089] (-1035.881) -- 0:00:42
274500 -- (-1036.301) [-1035.160] (-1035.340) (-1035.367) * (-1040.018) (-1036.244) [-1034.718] (-1035.897) -- 0:00:42
275000 -- (-1034.852) [-1036.407] (-1035.105) (-1037.560) * (-1040.277) [-1038.707] (-1034.852) (-1036.874) -- 0:00:42
Average standard deviation of split frequencies: 0.014347
275500 -- (-1050.421) [-1034.452] (-1036.193) (-1036.262) * (-1037.065) (-1036.316) (-1035.649) [-1035.232] -- 0:00:42
276000 -- (-1040.465) (-1034.867) (-1041.575) [-1038.578] * (-1035.132) (-1039.191) [-1035.318] (-1035.603) -- 0:00:41
276500 -- (-1036.263) (-1034.935) (-1039.400) [-1034.709] * (-1035.140) (-1040.150) [-1035.566] (-1037.278) -- 0:00:41
277000 -- [-1035.024] (-1036.451) (-1035.171) (-1035.461) * (-1036.380) [-1036.507] (-1033.874) (-1041.530) -- 0:00:41
277500 -- (-1038.079) (-1034.426) [-1035.184] (-1038.093) * (-1035.628) (-1037.207) (-1035.321) [-1036.308] -- 0:00:41
278000 -- (-1037.443) (-1033.514) [-1038.373] (-1037.940) * (-1034.622) (-1034.637) [-1034.586] (-1035.004) -- 0:00:44
278500 -- (-1036.970) (-1035.116) [-1035.904] (-1039.366) * (-1035.574) (-1036.617) [-1037.930] (-1034.090) -- 0:00:44
279000 -- (-1037.998) (-1036.266) (-1035.330) [-1034.323] * [-1036.882] (-1036.370) (-1034.927) (-1037.344) -- 0:00:43
279500 -- (-1034.275) (-1033.849) (-1034.626) [-1034.124] * (-1037.399) (-1034.986) (-1036.849) [-1036.614] -- 0:00:43
280000 -- (-1037.763) (-1035.297) (-1035.461) [-1036.332] * (-1035.780) (-1034.979) [-1036.549] (-1038.145) -- 0:00:43
Average standard deviation of split frequencies: 0.015823
280500 -- (-1034.583) [-1033.995] (-1034.505) (-1038.176) * [-1035.391] (-1035.681) (-1037.055) (-1038.939) -- 0:00:43
281000 -- (-1034.908) (-1038.751) [-1034.498] (-1036.554) * (-1036.597) [-1035.278] (-1038.182) (-1036.716) -- 0:00:43
281500 -- (-1034.817) [-1035.932] (-1034.492) (-1034.189) * [-1037.725] (-1036.981) (-1035.173) (-1035.908) -- 0:00:43
282000 -- (-1036.384) (-1039.932) (-1034.947) [-1034.686] * [-1033.959] (-1040.499) (-1036.459) (-1035.696) -- 0:00:43
282500 -- (-1035.767) (-1035.425) (-1037.115) [-1037.300] * (-1035.336) (-1034.895) [-1035.150] (-1035.673) -- 0:00:43
283000 -- [-1034.185] (-1033.983) (-1034.064) (-1034.155) * (-1036.860) [-1035.628] (-1037.860) (-1039.952) -- 0:00:43
283500 -- (-1035.636) (-1033.394) (-1034.648) [-1035.573] * (-1034.035) [-1036.007] (-1038.117) (-1039.038) -- 0:00:42
284000 -- (-1037.267) [-1033.405] (-1036.513) (-1036.847) * [-1036.202] (-1034.194) (-1036.544) (-1046.393) -- 0:00:42
284500 -- (-1034.728) (-1034.636) [-1035.941] (-1036.503) * (-1036.700) (-1033.768) [-1034.496] (-1038.781) -- 0:00:42
285000 -- (-1034.606) [-1035.666] (-1039.100) (-1035.753) * (-1035.932) (-1034.079) (-1034.923) [-1034.364] -- 0:00:42
Average standard deviation of split frequencies: 0.013763
285500 -- (-1042.172) [-1033.883] (-1034.507) (-1039.686) * (-1038.538) (-1035.340) (-1036.222) [-1034.507] -- 0:00:42
286000 -- (-1037.951) [-1034.374] (-1038.402) (-1037.511) * (-1035.118) (-1037.844) [-1035.553] (-1038.522) -- 0:00:42
286500 -- (-1037.756) [-1034.608] (-1034.243) (-1036.003) * [-1034.261] (-1035.640) (-1034.024) (-1036.463) -- 0:00:42
287000 -- (-1035.292) (-1034.617) (-1035.018) [-1035.342] * [-1033.956] (-1035.653) (-1034.219) (-1037.392) -- 0:00:42
287500 -- [-1036.960] (-1034.308) (-1034.190) (-1037.835) * (-1036.571) (-1038.324) (-1038.095) [-1033.803] -- 0:00:42
288000 -- (-1039.145) (-1033.957) [-1034.364] (-1038.047) * (-1035.574) (-1037.912) (-1036.326) [-1033.861] -- 0:00:42
288500 -- [-1035.351] (-1034.437) (-1034.322) (-1045.131) * (-1037.656) (-1034.799) [-1034.739] (-1033.754) -- 0:00:41
289000 -- (-1034.837) (-1036.188) [-1033.547] (-1045.182) * (-1038.372) (-1039.821) (-1035.595) [-1034.880] -- 0:00:41
289500 -- [-1036.975] (-1035.836) (-1033.574) (-1035.816) * (-1036.162) (-1036.404) (-1034.686) [-1036.082] -- 0:00:41
290000 -- (-1036.321) (-1038.283) (-1036.919) [-1034.731] * (-1038.085) [-1036.125] (-1034.134) (-1034.460) -- 0:00:41
Average standard deviation of split frequencies: 0.012488
290500 -- (-1037.413) (-1038.098) [-1033.991] (-1037.321) * (-1042.033) (-1033.497) [-1034.054] (-1035.897) -- 0:00:41
291000 -- (-1036.996) (-1041.873) (-1035.260) [-1037.694] * (-1035.611) [-1035.730] (-1037.144) (-1034.364) -- 0:00:41
291500 -- [-1036.760] (-1038.151) (-1038.896) (-1039.794) * (-1036.638) (-1034.676) [-1035.751] (-1034.552) -- 0:00:41
292000 -- [-1036.747] (-1034.437) (-1041.840) (-1036.388) * (-1036.219) (-1037.930) [-1037.604] (-1035.577) -- 0:00:41
292500 -- (-1037.233) (-1035.334) (-1034.542) [-1035.520] * (-1036.754) [-1037.270] (-1038.712) (-1035.051) -- 0:00:41
293000 -- [-1034.088] (-1036.190) (-1034.844) (-1035.041) * [-1036.283] (-1038.933) (-1036.864) (-1035.063) -- 0:00:41
293500 -- (-1037.388) (-1035.596) [-1035.031] (-1036.937) * [-1034.430] (-1035.180) (-1034.308) (-1035.350) -- 0:00:40
294000 -- [-1035.874] (-1037.293) (-1040.196) (-1035.190) * (-1036.444) (-1033.972) (-1041.201) [-1035.976] -- 0:00:40
294500 -- (-1036.045) (-1037.731) (-1034.170) [-1036.476] * (-1034.850) (-1034.074) [-1035.512] (-1035.640) -- 0:00:43
295000 -- (-1034.955) [-1039.038] (-1035.508) (-1037.480) * (-1036.402) (-1035.280) (-1034.234) [-1034.716] -- 0:00:43
Average standard deviation of split frequencies: 0.011068
295500 -- (-1036.285) (-1034.547) (-1034.067) [-1037.663] * (-1047.024) (-1036.323) [-1037.758] (-1036.840) -- 0:00:42
296000 -- (-1039.240) (-1034.806) (-1034.765) [-1040.012] * (-1039.371) [-1034.946] (-1036.679) (-1036.254) -- 0:00:42
296500 -- (-1041.345) (-1034.636) (-1035.174) [-1039.390] * (-1034.638) [-1034.962] (-1034.671) (-1035.355) -- 0:00:42
297000 -- [-1036.894] (-1035.699) (-1035.051) (-1040.966) * (-1034.497) (-1036.041) [-1034.889] (-1036.876) -- 0:00:42
297500 -- (-1037.463) (-1035.580) [-1034.458] (-1035.110) * (-1037.598) (-1036.857) [-1034.889] (-1038.815) -- 0:00:42
298000 -- (-1037.450) (-1040.357) (-1034.112) [-1035.509] * (-1034.516) (-1034.020) (-1036.026) [-1038.397] -- 0:00:42
298500 -- [-1038.190] (-1037.072) (-1034.012) (-1036.307) * (-1035.063) (-1034.278) (-1038.397) [-1038.072] -- 0:00:42
299000 -- [-1036.350] (-1035.701) (-1034.020) (-1036.896) * (-1034.801) (-1039.401) [-1035.522] (-1036.491) -- 0:00:42
299500 -- [-1035.405] (-1036.351) (-1034.979) (-1036.466) * (-1034.959) (-1036.846) [-1034.768] (-1034.548) -- 0:00:42
300000 -- (-1034.890) (-1034.473) [-1035.209] (-1036.563) * (-1034.674) (-1037.072) (-1034.115) [-1035.563] -- 0:00:42
Average standard deviation of split frequencies: 0.012465
300500 -- (-1034.885) [-1036.449] (-1034.543) (-1036.148) * (-1037.486) (-1038.535) (-1040.743) [-1037.677] -- 0:00:41
301000 -- [-1035.991] (-1035.997) (-1034.899) (-1036.192) * (-1035.379) (-1036.538) (-1037.567) [-1039.911] -- 0:00:41
301500 -- (-1034.748) [-1034.702] (-1033.511) (-1036.625) * (-1035.916) (-1037.313) [-1035.145] (-1042.106) -- 0:00:41
302000 -- (-1034.568) (-1038.141) (-1033.511) [-1034.164] * (-1035.048) (-1040.370) [-1037.744] (-1036.574) -- 0:00:41
302500 -- [-1034.315] (-1037.658) (-1035.940) (-1034.163) * [-1036.970] (-1036.090) (-1036.724) (-1037.959) -- 0:00:41
303000 -- (-1036.445) (-1036.985) [-1036.056] (-1039.571) * (-1039.337) [-1034.774] (-1037.960) (-1036.798) -- 0:00:41
303500 -- (-1036.379) (-1037.586) (-1037.622) [-1036.640] * (-1033.910) [-1035.123] (-1040.567) (-1037.723) -- 0:00:41
304000 -- (-1035.005) [-1037.925] (-1036.797) (-1035.671) * (-1038.062) [-1034.482] (-1035.718) (-1039.382) -- 0:00:41
304500 -- (-1034.873) (-1038.366) [-1037.833] (-1036.618) * [-1035.425] (-1036.825) (-1035.694) (-1038.127) -- 0:00:41
305000 -- (-1039.012) (-1039.582) (-1038.177) [-1036.223] * (-1037.115) (-1034.235) (-1035.084) [-1034.600] -- 0:00:41
Average standard deviation of split frequencies: 0.013172
305500 -- (-1036.203) [-1037.834] (-1037.327) (-1034.525) * (-1035.767) (-1035.627) (-1036.283) [-1034.623] -- 0:00:40
306000 -- [-1034.698] (-1040.826) (-1036.770) (-1035.289) * (-1034.894) (-1035.797) (-1034.725) [-1035.022] -- 0:00:40
306500 -- (-1038.779) [-1034.642] (-1035.733) (-1036.654) * (-1037.594) [-1034.381] (-1036.364) (-1033.905) -- 0:00:40
307000 -- (-1037.476) (-1038.908) (-1035.639) [-1034.791] * (-1036.779) (-1034.322) [-1034.862] (-1038.784) -- 0:00:40
307500 -- [-1036.289] (-1039.189) (-1035.297) (-1036.606) * (-1039.488) [-1034.377] (-1034.318) (-1040.260) -- 0:00:40
308000 -- (-1035.695) [-1036.221] (-1036.905) (-1035.017) * [-1037.924] (-1035.841) (-1036.068) (-1037.081) -- 0:00:40
308500 -- (-1039.911) (-1037.172) [-1037.879] (-1034.982) * [-1035.839] (-1035.841) (-1036.599) (-1035.231) -- 0:00:40
309000 -- (-1035.483) [-1041.001] (-1034.761) (-1037.697) * (-1037.005) (-1037.386) [-1034.508] (-1035.230) -- 0:00:40
309500 -- (-1036.186) (-1038.923) [-1036.426] (-1036.609) * [-1034.455] (-1038.470) (-1035.935) (-1034.520) -- 0:00:40
310000 -- [-1034.169] (-1037.778) (-1035.776) (-1033.931) * (-1036.410) (-1034.026) [-1035.646] (-1036.239) -- 0:00:40
Average standard deviation of split frequencies: 0.013808
310500 -- (-1036.564) (-1036.554) [-1035.422] (-1038.768) * (-1037.788) (-1035.066) (-1035.153) [-1034.761] -- 0:00:39
311000 -- (-1039.035) (-1037.289) (-1035.894) [-1035.174] * (-1034.975) (-1037.432) (-1042.209) [-1034.995] -- 0:00:42
311500 -- (-1035.583) (-1035.910) [-1034.718] (-1036.122) * (-1036.204) [-1035.099] (-1035.990) (-1036.977) -- 0:00:41
312000 -- [-1036.844] (-1034.572) (-1035.940) (-1035.133) * [-1036.508] (-1036.821) (-1035.443) (-1035.101) -- 0:00:41
312500 -- (-1037.254) [-1034.663] (-1036.032) (-1035.201) * (-1035.533) (-1036.484) (-1033.536) [-1036.073] -- 0:00:41
313000 -- (-1036.214) (-1035.495) [-1038.367] (-1039.600) * (-1036.456) (-1037.198) [-1034.549] (-1038.730) -- 0:00:41
313500 -- (-1036.683) (-1038.923) [-1035.529] (-1039.715) * (-1037.011) [-1037.724] (-1034.613) (-1040.813) -- 0:00:41
314000 -- [-1035.979] (-1034.620) (-1035.918) (-1037.477) * (-1037.286) (-1036.024) [-1035.197] (-1034.950) -- 0:00:41
314500 -- (-1035.650) (-1037.242) [-1035.210] (-1036.421) * (-1041.005) [-1036.818] (-1034.886) (-1033.625) -- 0:00:41
315000 -- (-1036.126) (-1033.713) [-1037.211] (-1035.262) * (-1034.641) (-1034.039) (-1034.160) [-1033.619] -- 0:00:41
Average standard deviation of split frequencies: 0.013976
315500 -- (-1036.528) [-1035.613] (-1034.320) (-1035.017) * (-1034.939) [-1033.549] (-1034.504) (-1034.144) -- 0:00:41
316000 -- (-1036.001) [-1034.443] (-1040.471) (-1036.188) * [-1033.955] (-1035.573) (-1034.644) (-1034.673) -- 0:00:41
316500 -- [-1033.815] (-1040.018) (-1039.309) (-1037.082) * (-1035.583) (-1035.115) [-1035.103] (-1034.794) -- 0:00:41
317000 -- (-1033.451) [-1037.490] (-1036.810) (-1035.044) * [-1038.886] (-1035.374) (-1039.795) (-1034.581) -- 0:00:40
317500 -- (-1036.968) (-1036.114) [-1036.521] (-1036.143) * [-1037.345] (-1037.110) (-1037.133) (-1035.223) -- 0:00:40
318000 -- (-1036.268) (-1034.201) (-1035.662) [-1035.905] * (-1036.193) (-1035.910) (-1036.403) [-1034.999] -- 0:00:40
318500 -- (-1034.353) (-1037.614) [-1035.531] (-1034.972) * (-1034.422) (-1034.991) [-1037.919] (-1036.813) -- 0:00:40
319000 -- (-1033.857) [-1035.365] (-1037.189) (-1038.446) * (-1038.549) (-1036.637) (-1036.776) [-1034.118] -- 0:00:40
319500 -- [-1035.077] (-1040.475) (-1036.752) (-1038.112) * (-1034.546) (-1036.384) (-1036.677) [-1034.002] -- 0:00:40
320000 -- [-1037.991] (-1036.969) (-1038.669) (-1035.044) * (-1042.459) (-1038.321) [-1036.142] (-1039.719) -- 0:00:40
Average standard deviation of split frequencies: 0.012844
320500 -- (-1038.865) [-1034.897] (-1035.710) (-1035.351) * (-1036.558) [-1036.324] (-1034.997) (-1038.058) -- 0:00:40
321000 -- (-1039.877) (-1034.327) (-1034.440) [-1034.134] * (-1033.982) (-1038.752) [-1038.265] (-1036.260) -- 0:00:40
321500 -- [-1034.113] (-1034.322) (-1034.927) (-1034.583) * [-1033.736] (-1036.662) (-1035.797) (-1039.082) -- 0:00:40
322000 -- (-1037.146) (-1036.062) (-1034.230) [-1041.013] * (-1035.828) (-1035.791) [-1036.422] (-1036.158) -- 0:00:40
322500 -- (-1034.332) (-1036.227) [-1035.606] (-1036.610) * [-1035.180] (-1035.548) (-1035.656) (-1037.015) -- 0:00:39
323000 -- [-1035.405] (-1034.666) (-1035.569) (-1034.301) * [-1034.116] (-1035.295) (-1036.739) (-1035.539) -- 0:00:39
323500 -- (-1036.598) (-1035.104) (-1034.066) [-1035.833] * (-1036.080) [-1036.060] (-1033.617) (-1034.795) -- 0:00:39
324000 -- (-1038.691) [-1034.320] (-1037.335) (-1036.996) * [-1036.104] (-1037.513) (-1035.070) (-1035.642) -- 0:00:39
324500 -- (-1038.516) [-1036.334] (-1036.101) (-1038.512) * (-1035.760) [-1034.473] (-1038.985) (-1034.610) -- 0:00:39
325000 -- (-1035.438) (-1036.302) (-1035.255) [-1037.122] * (-1035.272) [-1035.266] (-1035.500) (-1034.608) -- 0:00:39
Average standard deviation of split frequencies: 0.013243
325500 -- [-1035.773] (-1040.933) (-1034.525) (-1039.427) * [-1034.117] (-1035.385) (-1034.359) (-1034.076) -- 0:00:39
326000 -- (-1035.454) (-1042.021) [-1039.951] (-1038.979) * (-1038.913) (-1034.392) (-1034.888) [-1034.074] -- 0:00:39
326500 -- [-1034.958] (-1040.166) (-1042.096) (-1036.896) * (-1037.338) [-1034.316] (-1036.026) (-1041.443) -- 0:00:39
327000 -- (-1034.979) (-1035.113) [-1034.710] (-1036.429) * [-1036.966] (-1038.023) (-1034.663) (-1040.369) -- 0:00:39
327500 -- [-1034.760] (-1036.204) (-1036.527) (-1035.774) * (-1037.199) (-1035.025) (-1033.923) [-1034.241] -- 0:00:41
328000 -- (-1034.799) [-1035.136] (-1037.257) (-1034.129) * (-1037.233) (-1036.276) (-1035.041) [-1037.175] -- 0:00:40
328500 -- [-1039.026] (-1036.793) (-1035.795) (-1034.250) * [-1034.514] (-1035.716) (-1035.522) (-1036.632) -- 0:00:40
329000 -- (-1042.094) [-1034.604] (-1036.388) (-1039.120) * [-1039.326] (-1034.466) (-1035.828) (-1033.986) -- 0:00:40
329500 -- (-1043.527) (-1033.951) [-1034.200] (-1039.100) * (-1034.507) (-1035.319) (-1035.562) [-1035.466] -- 0:00:40
330000 -- [-1038.484] (-1039.448) (-1034.867) (-1036.115) * (-1035.965) (-1034.715) [-1037.378] (-1035.469) -- 0:00:40
Average standard deviation of split frequencies: 0.012514
330500 -- (-1034.161) [-1040.198] (-1034.066) (-1038.171) * (-1034.828) (-1034.714) [-1036.576] (-1035.849) -- 0:00:40
331000 -- [-1034.703] (-1036.038) (-1037.333) (-1035.196) * (-1034.398) [-1034.219] (-1039.392) (-1035.228) -- 0:00:40
331500 -- (-1035.435) (-1035.509) (-1037.880) [-1036.106] * (-1034.933) (-1035.071) (-1038.923) [-1035.222] -- 0:00:40
332000 -- (-1037.267) (-1035.299) [-1035.496] (-1036.513) * [-1037.497] (-1033.451) (-1035.004) (-1038.343) -- 0:00:40
332500 -- (-1039.218) (-1035.253) [-1034.998] (-1034.984) * (-1036.408) [-1033.464] (-1035.315) (-1037.152) -- 0:00:40
333000 -- (-1036.254) (-1035.663) (-1037.204) [-1034.553] * (-1036.590) [-1035.618] (-1036.013) (-1038.005) -- 0:00:40
333500 -- (-1035.859) (-1035.023) [-1036.432] (-1034.417) * (-1035.412) (-1037.278) [-1035.959] (-1035.052) -- 0:00:39
334000 -- [-1040.612] (-1034.194) (-1035.865) (-1034.354) * [-1037.555] (-1036.833) (-1039.796) (-1035.318) -- 0:00:39
334500 -- (-1035.507) (-1037.018) (-1040.205) [-1034.051] * [-1038.848] (-1035.317) (-1036.416) (-1035.884) -- 0:00:39
335000 -- [-1033.809] (-1037.254) (-1036.609) (-1035.249) * (-1037.963) [-1034.073] (-1034.554) (-1034.102) -- 0:00:39
Average standard deviation of split frequencies: 0.011888
335500 -- (-1033.821) (-1035.361) [-1036.445] (-1036.023) * (-1041.813) (-1033.972) (-1035.365) [-1033.955] -- 0:00:39
336000 -- (-1034.309) [-1038.014] (-1034.135) (-1035.072) * (-1041.052) [-1034.769] (-1039.256) (-1037.150) -- 0:00:39
336500 -- (-1035.262) (-1036.076) [-1035.282] (-1036.192) * (-1036.135) (-1039.520) [-1036.848] (-1037.717) -- 0:00:39
337000 -- (-1036.595) [-1036.934] (-1036.351) (-1036.614) * [-1034.761] (-1034.993) (-1036.726) (-1034.287) -- 0:00:39
337500 -- [-1035.431] (-1034.718) (-1035.389) (-1035.082) * (-1038.227) (-1034.860) [-1034.606] (-1034.718) -- 0:00:39
338000 -- (-1035.547) (-1034.822) (-1035.780) [-1034.195] * (-1036.023) [-1034.484] (-1035.554) (-1038.480) -- 0:00:39
338500 -- [-1034.132] (-1034.712) (-1034.616) (-1034.262) * [-1037.078] (-1033.695) (-1034.358) (-1035.069) -- 0:00:39
339000 -- (-1037.625) [-1035.004] (-1038.197) (-1035.710) * (-1041.339) [-1034.804] (-1036.181) (-1036.092) -- 0:00:38
339500 -- (-1034.831) (-1041.893) (-1038.457) [-1035.821] * [-1038.526] (-1035.773) (-1034.845) (-1034.680) -- 0:00:38
340000 -- (-1034.359) [-1036.145] (-1033.537) (-1035.071) * (-1036.750) (-1035.886) [-1037.359] (-1034.257) -- 0:00:38
Average standard deviation of split frequencies: 0.011531
340500 -- (-1033.443) (-1034.490) (-1034.568) [-1037.389] * (-1035.804) [-1037.606] (-1040.749) (-1034.705) -- 0:00:38
341000 -- (-1034.248) [-1036.412] (-1035.679) (-1037.047) * (-1037.732) (-1039.920) [-1036.258] (-1035.407) -- 0:00:38
341500 -- (-1037.054) (-1038.923) [-1034.310] (-1040.534) * (-1035.578) (-1035.867) [-1036.326] (-1035.841) -- 0:00:38
342000 -- (-1035.287) (-1039.169) (-1035.004) [-1034.686] * (-1034.718) (-1037.113) [-1035.480] (-1033.617) -- 0:00:38
342500 -- [-1036.447] (-1036.308) (-1035.026) (-1038.191) * [-1036.982] (-1039.583) (-1039.078) (-1038.757) -- 0:00:38
343000 -- (-1037.992) (-1036.326) (-1034.190) [-1037.227] * [-1035.554] (-1038.616) (-1035.777) (-1039.995) -- 0:00:38
343500 -- (-1036.032) [-1034.075] (-1034.271) (-1035.327) * [-1036.934] (-1036.328) (-1033.835) (-1035.506) -- 0:00:38
344000 -- [-1036.268] (-1035.782) (-1036.362) (-1035.060) * (-1036.268) (-1034.217) [-1034.525] (-1036.909) -- 0:00:40
344500 -- (-1034.422) [-1035.745] (-1036.472) (-1036.149) * (-1035.133) [-1035.260] (-1034.433) (-1037.968) -- 0:00:39
345000 -- (-1035.510) [-1034.867] (-1041.059) (-1037.242) * (-1038.196) (-1033.755) [-1033.772] (-1035.738) -- 0:00:39
Average standard deviation of split frequencies: 0.011278
345500 -- (-1035.192) (-1035.317) (-1038.486) [-1037.673] * (-1036.046) (-1037.689) (-1035.055) [-1034.807] -- 0:00:39
346000 -- [-1039.970] (-1037.536) (-1039.184) (-1035.787) * (-1034.526) (-1035.427) (-1035.055) [-1035.866] -- 0:00:39
346500 -- (-1040.268) [-1035.996] (-1037.752) (-1036.987) * (-1035.265) (-1035.153) [-1034.386] (-1038.050) -- 0:00:39
347000 -- (-1034.953) (-1038.560) [-1035.254] (-1035.444) * (-1035.878) (-1036.518) [-1033.962] (-1035.110) -- 0:00:39
347500 -- (-1037.499) [-1035.014] (-1036.460) (-1034.332) * (-1036.947) (-1036.899) [-1034.321] (-1035.824) -- 0:00:39
348000 -- (-1034.136) [-1035.722] (-1036.875) (-1033.511) * [-1034.491] (-1035.374) (-1036.196) (-1037.509) -- 0:00:39
348500 -- [-1033.855] (-1036.404) (-1036.315) (-1033.944) * (-1036.945) [-1037.979] (-1036.932) (-1035.854) -- 0:00:39
349000 -- (-1041.976) (-1034.642) [-1037.500] (-1034.513) * [-1034.195] (-1036.655) (-1036.529) (-1038.478) -- 0:00:39
349500 -- [-1041.589] (-1035.024) (-1035.560) (-1034.523) * (-1034.182) [-1036.332] (-1035.753) (-1040.402) -- 0:00:39
350000 -- (-1038.997) (-1034.452) (-1035.162) [-1035.630] * [-1034.955] (-1040.592) (-1036.420) (-1040.542) -- 0:00:39
Average standard deviation of split frequencies: 0.010913
350500 -- [-1037.672] (-1034.050) (-1035.189) (-1035.533) * (-1036.508) (-1035.245) (-1035.762) [-1037.290] -- 0:00:38
351000 -- [-1033.783] (-1034.632) (-1035.262) (-1034.090) * (-1036.825) (-1034.718) [-1036.599] (-1034.490) -- 0:00:38
351500 -- (-1034.703) (-1034.660) (-1036.123) [-1034.533] * (-1033.969) [-1034.431] (-1034.263) (-1036.761) -- 0:00:38
352000 -- (-1034.577) [-1036.579] (-1038.753) (-1033.878) * (-1035.199) [-1033.927] (-1036.449) (-1036.761) -- 0:00:38
352500 -- [-1033.984] (-1036.596) (-1038.526) (-1035.814) * [-1034.278] (-1035.070) (-1036.874) (-1034.118) -- 0:00:38
353000 -- (-1034.590) (-1036.595) (-1039.813) [-1035.957] * (-1037.099) (-1034.588) (-1034.098) [-1034.645] -- 0:00:38
353500 -- [-1040.536] (-1035.615) (-1034.856) (-1037.432) * (-1038.777) (-1035.207) [-1035.792] (-1034.320) -- 0:00:38
354000 -- (-1034.111) (-1036.201) (-1035.388) [-1034.356] * (-1035.109) (-1034.149) (-1034.838) [-1033.720] -- 0:00:38
354500 -- (-1034.171) (-1041.866) [-1034.128] (-1033.910) * [-1038.042] (-1038.692) (-1034.892) (-1035.012) -- 0:00:38
355000 -- (-1036.367) [-1034.824] (-1037.114) (-1034.941) * (-1034.789) (-1036.533) [-1035.771] (-1035.226) -- 0:00:38
Average standard deviation of split frequencies: 0.010749
355500 -- [-1040.485] (-1034.690) (-1036.870) (-1036.602) * [-1035.148] (-1037.929) (-1035.463) (-1035.193) -- 0:00:38
356000 -- (-1038.490) [-1035.119] (-1035.151) (-1038.521) * (-1036.775) (-1037.216) [-1039.286] (-1035.824) -- 0:00:37
356500 -- [-1036.535] (-1036.946) (-1036.544) (-1037.161) * [-1036.966] (-1037.135) (-1035.780) (-1035.615) -- 0:00:37
357000 -- (-1034.933) (-1037.523) [-1037.721] (-1035.252) * (-1034.342) (-1036.160) [-1034.855] (-1034.186) -- 0:00:37
357500 -- [-1034.285] (-1038.138) (-1037.029) (-1034.831) * (-1035.228) (-1035.016) [-1037.478] (-1033.579) -- 0:00:37
358000 -- (-1035.092) [-1034.693] (-1038.748) (-1040.251) * (-1035.029) (-1036.293) (-1033.837) [-1034.717] -- 0:00:37
358500 -- [-1034.699] (-1034.198) (-1037.641) (-1038.501) * (-1037.263) [-1037.489] (-1034.085) (-1033.957) -- 0:00:37
359000 -- [-1034.340] (-1035.749) (-1035.518) (-1037.090) * (-1034.698) (-1042.041) [-1035.402] (-1034.105) -- 0:00:37
359500 -- (-1037.094) (-1034.428) [-1037.031] (-1035.550) * [-1033.896] (-1041.115) (-1037.014) (-1036.582) -- 0:00:37
360000 -- [-1036.469] (-1035.080) (-1040.521) (-1034.027) * (-1037.562) (-1038.659) [-1033.791] (-1035.230) -- 0:00:37
Average standard deviation of split frequencies: 0.010687
360500 -- (-1036.510) (-1035.751) (-1038.509) [-1034.428] * (-1039.380) (-1039.908) [-1034.241] (-1035.329) -- 0:00:39
361000 -- (-1036.421) (-1039.689) (-1034.504) [-1035.483] * (-1037.648) (-1035.725) (-1034.865) [-1034.368] -- 0:00:38
361500 -- [-1039.705] (-1033.957) (-1043.105) (-1035.796) * [-1034.441] (-1034.830) (-1038.496) (-1037.454) -- 0:00:38
362000 -- (-1039.893) (-1034.145) [-1042.548] (-1036.174) * (-1036.818) [-1033.901] (-1038.081) (-1036.791) -- 0:00:38
362500 -- (-1037.497) [-1034.307] (-1038.173) (-1036.093) * (-1039.497) [-1038.189] (-1036.266) (-1035.278) -- 0:00:38
363000 -- (-1034.293) (-1033.919) [-1035.833] (-1040.682) * (-1036.063) [-1036.016] (-1034.566) (-1035.394) -- 0:00:38
363500 -- [-1034.232] (-1033.533) (-1035.452) (-1038.904) * (-1035.254) (-1036.201) (-1035.693) [-1034.140] -- 0:00:38
364000 -- (-1036.135) (-1036.399) [-1033.488] (-1035.094) * [-1035.242] (-1035.879) (-1037.392) (-1034.988) -- 0:00:38
364500 -- (-1034.298) [-1034.651] (-1034.698) (-1035.881) * (-1035.262) (-1035.245) (-1034.208) [-1036.303] -- 0:00:38
365000 -- (-1036.309) (-1034.442) [-1033.976] (-1040.474) * (-1040.160) (-1034.991) [-1035.041] (-1034.952) -- 0:00:38
Average standard deviation of split frequencies: 0.011137
365500 -- (-1039.493) [-1034.793] (-1033.665) (-1040.590) * (-1039.822) (-1035.169) (-1034.182) [-1035.146] -- 0:00:38
366000 -- (-1035.264) (-1037.631) [-1033.502] (-1034.981) * (-1042.093) [-1037.133] (-1035.043) (-1036.514) -- 0:00:38
366500 -- (-1034.405) [-1038.219] (-1038.937) (-1034.287) * (-1040.434) (-1036.864) (-1035.784) [-1037.124] -- 0:00:38
367000 -- (-1034.584) (-1037.985) [-1035.410] (-1035.453) * (-1036.261) (-1036.389) [-1035.630] (-1039.223) -- 0:00:37
367500 -- (-1034.223) (-1035.126) [-1034.564] (-1041.245) * (-1038.373) (-1036.324) [-1034.182] (-1035.366) -- 0:00:37
368000 -- (-1034.602) [-1035.731] (-1034.973) (-1036.672) * (-1034.730) [-1034.674] (-1041.416) (-1034.819) -- 0:00:37
368500 -- (-1034.773) [-1034.347] (-1035.301) (-1037.080) * (-1035.212) [-1033.895] (-1038.408) (-1036.231) -- 0:00:37
369000 -- (-1034.305) [-1035.284] (-1036.377) (-1037.241) * (-1040.036) [-1036.020] (-1035.186) (-1034.195) -- 0:00:37
369500 -- (-1035.044) (-1035.271) [-1034.616] (-1036.246) * [-1034.930] (-1036.182) (-1034.664) (-1034.408) -- 0:00:37
370000 -- (-1036.530) (-1034.613) [-1036.188] (-1036.542) * (-1036.152) [-1037.098] (-1034.267) (-1034.214) -- 0:00:37
Average standard deviation of split frequencies: 0.010623
370500 -- (-1035.512) (-1034.969) [-1035.244] (-1036.527) * (-1041.441) (-1034.898) [-1033.946] (-1037.295) -- 0:00:37
371000 -- (-1037.301) (-1035.674) (-1034.107) [-1034.516] * (-1036.332) [-1035.311] (-1033.901) (-1035.025) -- 0:00:37
371500 -- (-1035.892) [-1035.042] (-1037.048) (-1035.808) * (-1038.267) [-1037.911] (-1033.967) (-1037.198) -- 0:00:37
372000 -- (-1037.601) [-1037.129] (-1033.398) (-1037.578) * (-1035.794) (-1035.293) [-1034.341] (-1037.960) -- 0:00:37
372500 -- [-1034.080] (-1035.767) (-1034.410) (-1041.463) * (-1036.964) (-1037.313) (-1035.445) [-1043.402] -- 0:00:37
373000 -- (-1036.755) [-1035.402] (-1037.926) (-1040.230) * (-1036.544) (-1037.273) (-1035.986) [-1038.717] -- 0:00:36
373500 -- [-1035.751] (-1038.379) (-1035.692) (-1038.246) * (-1037.593) (-1037.537) (-1035.050) [-1034.188] -- 0:00:36
374000 -- (-1035.758) (-1036.558) [-1036.677] (-1034.725) * (-1038.307) (-1035.245) (-1035.459) [-1037.347] -- 0:00:36
374500 -- (-1035.676) (-1036.281) [-1035.936] (-1039.181) * (-1033.968) [-1035.278] (-1036.494) (-1035.909) -- 0:00:36
375000 -- (-1036.771) (-1035.860) (-1037.457) [-1035.765] * [-1034.266] (-1035.269) (-1035.744) (-1034.239) -- 0:00:36
Average standard deviation of split frequencies: 0.011874
375500 -- [-1034.856] (-1039.182) (-1038.259) (-1040.264) * (-1034.811) (-1037.291) (-1041.467) [-1034.239] -- 0:00:36
376000 -- [-1035.081] (-1038.670) (-1035.811) (-1036.321) * (-1034.049) (-1036.552) [-1037.607] (-1034.239) -- 0:00:36
376500 -- (-1034.984) (-1034.392) [-1035.616] (-1040.732) * [-1035.496] (-1035.490) (-1033.572) (-1036.555) -- 0:00:36
377000 -- (-1036.304) [-1034.357] (-1037.240) (-1039.078) * [-1039.282] (-1035.881) (-1033.630) (-1037.182) -- 0:00:38
377500 -- (-1035.263) [-1036.722] (-1035.584) (-1036.981) * (-1036.300) [-1037.208] (-1033.934) (-1035.954) -- 0:00:37
378000 -- [-1034.948] (-1036.610) (-1035.376) (-1035.161) * (-1037.023) (-1037.886) [-1033.970] (-1036.432) -- 0:00:37
378500 -- (-1034.732) (-1036.710) [-1033.505] (-1035.954) * (-1035.603) (-1034.222) (-1035.996) [-1034.377] -- 0:00:37
379000 -- (-1034.414) [-1034.755] (-1036.625) (-1035.638) * (-1038.068) (-1034.270) [-1036.680] (-1034.139) -- 0:00:37
379500 -- (-1034.567) (-1037.087) (-1037.422) [-1036.331] * (-1034.536) (-1043.151) (-1034.808) [-1036.754] -- 0:00:37
380000 -- [-1039.292] (-1036.632) (-1041.516) (-1040.252) * (-1037.544) (-1036.847) [-1035.548] (-1034.182) -- 0:00:37
Average standard deviation of split frequencies: 0.011655
380500 -- (-1039.050) [-1037.835] (-1034.824) (-1035.495) * (-1036.546) (-1037.784) [-1035.661] (-1035.519) -- 0:00:37
381000 -- (-1035.966) (-1034.351) (-1034.753) [-1037.852] * (-1036.207) [-1038.694] (-1035.214) (-1037.397) -- 0:00:37
381500 -- (-1039.807) [-1034.742] (-1035.692) (-1038.135) * (-1037.021) (-1037.680) (-1034.663) [-1041.056] -- 0:00:37
382000 -- (-1034.028) (-1033.760) [-1035.916] (-1036.279) * (-1037.538) (-1039.548) (-1035.427) [-1034.430] -- 0:00:37
382500 -- (-1037.940) (-1033.694) (-1035.102) [-1037.795] * (-1041.038) (-1034.898) (-1035.234) [-1036.928] -- 0:00:37
383000 -- (-1034.105) (-1033.961) [-1035.129] (-1033.926) * (-1037.206) [-1035.063] (-1034.597) (-1037.703) -- 0:00:37
383500 -- (-1034.324) (-1037.256) [-1034.800] (-1034.186) * (-1036.080) (-1039.434) (-1034.856) [-1036.545] -- 0:00:36
384000 -- (-1036.788) (-1035.317) [-1035.615] (-1034.030) * (-1039.559) (-1038.594) (-1035.216) [-1035.602] -- 0:00:36
384500 -- (-1036.231) (-1034.573) (-1035.622) [-1036.026] * (-1042.920) (-1034.978) (-1035.914) [-1035.423] -- 0:00:36
385000 -- (-1034.776) (-1034.375) (-1037.430) [-1036.318] * [-1037.344] (-1039.086) (-1036.312) (-1036.692) -- 0:00:36
Average standard deviation of split frequencies: 0.011534
385500 -- (-1035.715) (-1035.398) [-1035.800] (-1037.190) * (-1035.501) [-1035.790] (-1034.516) (-1036.034) -- 0:00:36
386000 -- (-1035.030) [-1036.780] (-1035.647) (-1038.384) * [-1034.302] (-1035.444) (-1036.135) (-1038.198) -- 0:00:36
386500 -- [-1038.040] (-1035.020) (-1034.365) (-1036.996) * (-1037.207) (-1035.115) [-1037.888] (-1038.308) -- 0:00:36
387000 -- (-1035.070) (-1035.038) [-1035.361] (-1041.021) * (-1035.248) [-1038.988] (-1036.735) (-1036.069) -- 0:00:36
387500 -- (-1034.846) (-1034.166) (-1034.274) [-1036.179] * (-1034.524) (-1037.656) (-1035.038) [-1035.694] -- 0:00:36
388000 -- (-1035.765) (-1035.881) [-1034.625] (-1037.465) * [-1035.779] (-1035.232) (-1034.790) (-1036.333) -- 0:00:36
388500 -- (-1035.341) (-1034.818) [-1034.872] (-1038.312) * [-1035.748] (-1034.118) (-1034.171) (-1034.128) -- 0:00:36
389000 -- [-1037.992] (-1040.668) (-1035.263) (-1035.861) * (-1034.054) [-1034.016] (-1033.978) (-1034.189) -- 0:00:36
389500 -- (-1038.184) (-1035.353) [-1035.466] (-1038.154) * (-1035.893) (-1034.541) [-1034.847] (-1036.087) -- 0:00:36
390000 -- (-1036.736) (-1037.079) [-1034.128] (-1033.758) * (-1035.124) (-1042.253) [-1034.713] (-1036.523) -- 0:00:35
Average standard deviation of split frequencies: 0.011933
390500 -- [-1036.702] (-1036.466) (-1038.014) (-1033.707) * (-1037.078) (-1036.770) (-1036.266) [-1037.497] -- 0:00:35
391000 -- (-1036.694) (-1035.912) [-1036.313] (-1033.816) * (-1035.767) [-1033.832] (-1040.352) (-1033.567) -- 0:00:35
391500 -- (-1036.594) (-1036.181) (-1037.721) [-1033.889] * (-1034.648) [-1035.853] (-1035.939) (-1035.373) -- 0:00:35
392000 -- [-1035.998] (-1035.497) (-1040.856) (-1036.775) * (-1034.956) (-1035.849) [-1038.222] (-1035.852) -- 0:00:35
392500 -- [-1037.261] (-1039.441) (-1038.867) (-1039.268) * (-1034.085) (-1036.184) (-1037.497) [-1036.223] -- 0:00:35
393000 -- (-1037.227) (-1037.775) (-1036.334) [-1038.131] * [-1037.636] (-1046.716) (-1035.950) (-1036.058) -- 0:00:35
393500 -- [-1035.855] (-1036.179) (-1035.301) (-1039.908) * (-1036.958) (-1036.664) (-1035.912) [-1035.776] -- 0:00:36
394000 -- (-1036.416) (-1036.029) [-1033.979] (-1038.182) * [-1036.426] (-1036.201) (-1035.333) (-1038.923) -- 0:00:36
394500 -- [-1036.028] (-1036.585) (-1034.644) (-1037.098) * (-1040.258) (-1037.208) [-1038.036] (-1038.272) -- 0:00:36
395000 -- (-1037.572) [-1035.959] (-1035.763) (-1034.799) * (-1040.145) (-1035.929) [-1036.088] (-1035.873) -- 0:00:36
Average standard deviation of split frequencies: 0.011970
395500 -- (-1034.354) [-1037.556] (-1038.196) (-1037.291) * (-1035.147) [-1035.161] (-1034.185) (-1039.751) -- 0:00:36
396000 -- (-1036.822) (-1034.754) (-1034.834) [-1038.368] * (-1037.589) (-1036.814) (-1033.929) [-1035.384] -- 0:00:36
396500 -- (-1036.292) (-1033.496) [-1036.186] (-1035.264) * (-1034.416) (-1034.449) (-1035.093) [-1034.017] -- 0:00:36
397000 -- (-1037.014) [-1035.441] (-1034.610) (-1033.813) * (-1039.713) (-1035.071) (-1034.846) [-1035.984] -- 0:00:36
397500 -- (-1042.161) (-1037.416) [-1034.381] (-1033.920) * (-1037.472) (-1034.774) [-1035.135] (-1035.420) -- 0:00:36
398000 -- (-1038.294) (-1035.945) [-1036.290] (-1034.196) * (-1038.526) [-1036.932] (-1035.969) (-1037.501) -- 0:00:36
398500 -- (-1034.517) (-1035.530) [-1035.029] (-1034.066) * (-1035.754) (-1036.755) (-1038.637) [-1037.061] -- 0:00:36
399000 -- (-1040.246) [-1034.636] (-1037.848) (-1036.471) * [-1035.013] (-1035.083) (-1040.645) (-1037.475) -- 0:00:36
399500 -- (-1034.424) (-1037.027) (-1035.971) [-1035.695] * (-1033.925) (-1034.253) [-1036.486] (-1036.386) -- 0:00:36
400000 -- [-1034.841] (-1036.690) (-1038.875) (-1034.408) * (-1033.975) (-1035.381) [-1036.608] (-1036.949) -- 0:00:36
Average standard deviation of split frequencies: 0.012419
400500 -- [-1033.925] (-1037.123) (-1036.969) (-1035.814) * (-1034.326) [-1036.596] (-1038.154) (-1037.388) -- 0:00:35
401000 -- (-1033.844) (-1035.667) [-1035.228] (-1035.076) * (-1034.846) [-1038.673] (-1035.729) (-1038.617) -- 0:00:35
401500 -- (-1034.687) (-1036.644) (-1036.626) [-1036.423] * (-1036.201) (-1036.732) [-1040.658] (-1035.002) -- 0:00:35
402000 -- (-1035.000) (-1035.368) [-1037.006] (-1036.928) * (-1039.170) (-1035.216) (-1038.564) [-1036.000] -- 0:00:35
402500 -- (-1036.762) [-1035.265] (-1035.412) (-1036.646) * (-1037.775) (-1034.929) (-1036.004) [-1038.521] -- 0:00:35
403000 -- [-1038.419] (-1035.342) (-1035.780) (-1037.119) * [-1034.058] (-1036.770) (-1036.467) (-1034.956) -- 0:00:35
403500 -- (-1037.124) [-1035.579] (-1036.629) (-1036.434) * [-1036.576] (-1038.515) (-1045.868) (-1034.772) -- 0:00:35
404000 -- (-1035.423) (-1034.905) [-1035.527] (-1044.023) * [-1036.010] (-1035.874) (-1039.985) (-1035.375) -- 0:00:35
404500 -- (-1036.345) [-1034.434] (-1035.609) (-1035.857) * (-1034.357) (-1039.108) (-1035.018) [-1037.983] -- 0:00:35
405000 -- (-1038.511) (-1037.830) (-1035.304) [-1035.590] * [-1035.063] (-1035.020) (-1034.108) (-1035.849) -- 0:00:35
Average standard deviation of split frequencies: 0.011288
405500 -- [-1037.145] (-1034.461) (-1036.158) (-1033.533) * (-1034.097) (-1035.337) [-1035.774] (-1039.373) -- 0:00:35
406000 -- [-1037.060] (-1034.652) (-1036.295) (-1033.809) * (-1036.086) (-1035.571) [-1036.309] (-1041.971) -- 0:00:35
406500 -- [-1033.634] (-1035.229) (-1034.780) (-1034.837) * (-1035.861) [-1039.482] (-1034.435) (-1040.539) -- 0:00:35
407000 -- (-1035.292) (-1034.138) [-1034.589] (-1034.749) * (-1037.254) [-1035.455] (-1033.584) (-1034.133) -- 0:00:34
407500 -- [-1038.708] (-1036.407) (-1034.148) (-1036.799) * (-1036.032) (-1036.016) [-1035.505] (-1034.891) -- 0:00:34
408000 -- (-1036.683) (-1034.438) [-1034.838] (-1035.766) * (-1035.487) [-1035.899] (-1037.352) (-1035.417) -- 0:00:34
408500 -- (-1035.363) [-1036.491] (-1037.684) (-1038.283) * [-1035.480] (-1034.828) (-1034.636) (-1035.836) -- 0:00:34
409000 -- [-1035.230] (-1034.794) (-1035.155) (-1034.753) * (-1036.670) (-1036.147) [-1035.477] (-1036.050) -- 0:00:34
409500 -- [-1036.172] (-1036.521) (-1035.170) (-1036.195) * [-1035.521] (-1035.159) (-1036.384) (-1034.465) -- 0:00:36
410000 -- [-1038.791] (-1034.970) (-1038.758) (-1035.899) * [-1036.861] (-1034.022) (-1037.448) (-1035.411) -- 0:00:35
Average standard deviation of split frequencies: 0.012053
410500 -- (-1034.500) (-1036.235) (-1035.766) [-1036.288] * (-1036.280) (-1035.517) [-1036.694] (-1035.915) -- 0:00:35
411000 -- (-1034.598) (-1033.907) (-1034.925) [-1034.220] * (-1037.338) [-1035.350] (-1038.249) (-1034.878) -- 0:00:35
411500 -- (-1034.378) (-1034.219) [-1035.485] (-1034.799) * (-1039.051) [-1037.520] (-1035.142) (-1036.184) -- 0:00:35
412000 -- (-1034.258) [-1034.215] (-1036.160) (-1036.535) * [-1036.114] (-1034.548) (-1035.756) (-1034.287) -- 0:00:35
412500 -- [-1039.968] (-1033.970) (-1034.289) (-1034.515) * [-1037.206] (-1035.096) (-1033.693) (-1034.606) -- 0:00:35
413000 -- (-1035.954) [-1033.769] (-1042.136) (-1035.244) * (-1037.309) (-1034.607) [-1035.873] (-1035.780) -- 0:00:35
413500 -- [-1038.195] (-1033.608) (-1039.695) (-1033.916) * (-1037.711) (-1035.435) [-1034.927] (-1036.918) -- 0:00:35
414000 -- (-1035.999) [-1034.178] (-1035.239) (-1036.559) * [-1037.879] (-1040.858) (-1035.311) (-1034.208) -- 0:00:35
414500 -- (-1037.525) [-1034.471] (-1035.239) (-1038.511) * (-1036.597) (-1039.257) [-1034.435] (-1034.727) -- 0:00:35
415000 -- [-1034.747] (-1034.097) (-1037.463) (-1033.643) * (-1034.579) (-1036.602) (-1036.947) [-1037.975] -- 0:00:35
Average standard deviation of split frequencies: 0.012150
415500 -- [-1037.043] (-1034.542) (-1036.194) (-1037.766) * (-1037.624) [-1034.283] (-1036.176) (-1037.241) -- 0:00:35
416000 -- (-1034.168) (-1035.699) (-1036.218) [-1038.142] * (-1036.660) (-1036.046) [-1036.544] (-1037.636) -- 0:00:35
416500 -- (-1034.313) (-1034.836) [-1040.782] (-1038.738) * (-1042.135) (-1037.290) (-1036.015) [-1036.089] -- 0:00:35
417000 -- [-1037.486] (-1038.608) (-1036.953) (-1036.645) * (-1037.730) (-1040.037) [-1037.289] (-1039.572) -- 0:00:34
417500 -- (-1040.794) (-1035.405) [-1035.457] (-1035.260) * (-1036.554) (-1036.030) [-1035.076] (-1040.089) -- 0:00:34
418000 -- (-1036.384) (-1035.999) (-1036.928) [-1034.802] * [-1034.076] (-1038.443) (-1034.201) (-1036.914) -- 0:00:34
418500 -- (-1038.509) (-1036.816) [-1035.094] (-1035.411) * (-1036.567) [-1034.446] (-1034.257) (-1036.848) -- 0:00:34
419000 -- (-1035.644) [-1038.365] (-1034.949) (-1034.353) * (-1038.042) (-1035.436) [-1034.429] (-1035.802) -- 0:00:34
419500 -- (-1037.010) (-1038.883) (-1033.723) [-1039.506] * [-1036.881] (-1037.523) (-1036.237) (-1036.460) -- 0:00:34
420000 -- (-1037.827) (-1037.076) [-1033.678] (-1036.814) * (-1036.495) (-1038.602) [-1033.888] (-1036.314) -- 0:00:34
Average standard deviation of split frequencies: 0.011580
420500 -- [-1035.132] (-1035.639) (-1033.622) (-1034.356) * (-1035.210) (-1036.814) [-1036.270] (-1036.572) -- 0:00:34
421000 -- (-1036.622) (-1035.421) [-1035.353] (-1034.271) * (-1036.037) [-1035.910] (-1034.546) (-1037.477) -- 0:00:34
421500 -- (-1034.751) (-1035.928) (-1038.566) [-1034.271] * [-1034.428] (-1035.411) (-1040.045) (-1036.256) -- 0:00:34
422000 -- (-1039.420) (-1036.335) (-1034.435) [-1034.529] * (-1036.962) (-1037.813) (-1037.280) [-1034.916] -- 0:00:34
422500 -- [-1034.841] (-1034.822) (-1035.740) (-1036.972) * (-1036.298) [-1039.749] (-1035.904) (-1035.624) -- 0:00:34
423000 -- (-1035.144) (-1036.236) (-1035.438) [-1037.113] * (-1034.614) [-1037.023] (-1036.244) (-1036.164) -- 0:00:34
423500 -- [-1034.484] (-1033.994) (-1035.183) (-1036.651) * (-1035.921) (-1035.581) (-1033.959) [-1035.309] -- 0:00:34
424000 -- [-1035.856] (-1038.002) (-1035.259) (-1035.314) * (-1035.525) [-1034.503] (-1036.156) (-1034.317) -- 0:00:33
424500 -- (-1038.355) (-1034.836) (-1036.534) [-1035.670] * (-1034.394) [-1042.867] (-1034.339) (-1036.441) -- 0:00:33
425000 -- (-1037.327) (-1035.747) (-1033.966) [-1035.378] * (-1042.803) (-1034.347) [-1035.341] (-1034.488) -- 0:00:33
Average standard deviation of split frequencies: 0.010697
425500 -- [-1035.332] (-1035.001) (-1035.473) (-1038.784) * (-1038.347) (-1035.009) (-1035.299) [-1035.042] -- 0:00:33
426000 -- (-1037.623) (-1035.974) (-1037.265) [-1041.273] * (-1036.905) (-1036.864) [-1034.668] (-1038.006) -- 0:00:35
426500 -- (-1035.831) [-1036.721] (-1035.676) (-1036.958) * (-1035.970) (-1037.473) (-1034.153) [-1035.191] -- 0:00:34
427000 -- [-1035.846] (-1035.938) (-1035.412) (-1037.232) * (-1038.435) [-1035.050] (-1033.852) (-1035.242) -- 0:00:34
427500 -- (-1039.711) (-1033.609) [-1035.086] (-1039.146) * (-1037.374) [-1033.873] (-1037.758) (-1035.842) -- 0:00:34
428000 -- (-1038.088) (-1036.398) (-1037.717) [-1038.714] * (-1036.178) (-1036.324) (-1035.095) [-1034.833] -- 0:00:34
428500 -- [-1036.320] (-1034.952) (-1036.592) (-1034.827) * (-1036.918) (-1036.479) (-1036.569) [-1034.355] -- 0:00:34
429000 -- (-1036.352) (-1037.757) (-1034.344) [-1036.420] * (-1036.481) [-1034.640] (-1035.872) (-1036.089) -- 0:00:34
429500 -- (-1035.680) (-1034.680) [-1037.037] (-1035.758) * (-1040.391) [-1035.649] (-1034.495) (-1035.156) -- 0:00:34
430000 -- [-1036.100] (-1035.698) (-1037.794) (-1034.044) * (-1035.861) (-1037.107) [-1033.901] (-1038.060) -- 0:00:34
Average standard deviation of split frequencies: 0.010495
430500 -- (-1035.239) (-1034.987) [-1034.873] (-1034.272) * [-1036.947] (-1034.048) (-1035.255) (-1036.340) -- 0:00:34
431000 -- (-1035.644) (-1034.486) [-1034.655] (-1034.428) * (-1036.451) (-1034.709) [-1034.932] (-1035.350) -- 0:00:34
431500 -- (-1035.168) (-1037.214) [-1037.705] (-1034.622) * (-1034.262) [-1035.984] (-1035.990) (-1036.421) -- 0:00:34
432000 -- [-1034.796] (-1034.354) (-1035.808) (-1036.160) * [-1033.921] (-1036.020) (-1034.721) (-1036.686) -- 0:00:34
432500 -- (-1035.892) (-1036.089) [-1035.709] (-1035.268) * (-1037.173) (-1036.864) (-1035.741) [-1035.729] -- 0:00:34
433000 -- (-1036.382) (-1036.453) (-1037.114) [-1034.433] * (-1034.110) (-1035.310) [-1037.657] (-1037.395) -- 0:00:34
433500 -- (-1036.402) (-1041.381) (-1035.910) [-1037.224] * (-1037.230) [-1035.958] (-1037.164) (-1033.758) -- 0:00:33
434000 -- [-1037.651] (-1035.963) (-1036.244) (-1044.153) * (-1038.294) [-1036.927] (-1039.297) (-1037.143) -- 0:00:33
434500 -- (-1035.214) (-1034.190) [-1035.690] (-1039.578) * (-1036.591) [-1034.987] (-1040.041) (-1036.525) -- 0:00:33
435000 -- (-1036.490) (-1035.929) (-1035.068) [-1035.545] * [-1034.953] (-1038.387) (-1036.936) (-1033.948) -- 0:00:33
Average standard deviation of split frequencies: 0.010494
435500 -- [-1036.679] (-1038.848) (-1036.057) (-1034.901) * (-1034.123) (-1039.464) (-1034.147) [-1035.822] -- 0:00:33
436000 -- [-1036.762] (-1035.524) (-1034.917) (-1037.348) * (-1035.559) (-1035.031) (-1036.299) [-1034.053] -- 0:00:33
436500 -- (-1034.855) (-1034.622) [-1034.320] (-1036.565) * (-1035.454) (-1034.951) (-1034.246) [-1035.290] -- 0:00:33
437000 -- [-1036.323] (-1036.670) (-1034.846) (-1037.435) * (-1037.920) (-1034.951) (-1035.806) [-1035.232] -- 0:00:33
437500 -- [-1033.994] (-1044.623) (-1034.722) (-1040.161) * (-1036.121) [-1034.624] (-1035.419) (-1035.230) -- 0:00:33
438000 -- (-1038.083) (-1037.757) [-1036.486] (-1037.932) * [-1035.319] (-1040.437) (-1037.008) (-1035.884) -- 0:00:33
438500 -- (-1041.195) (-1037.120) [-1036.906] (-1038.123) * [-1035.873] (-1040.826) (-1036.301) (-1035.848) -- 0:00:33
439000 -- (-1035.350) [-1036.905] (-1037.698) (-1034.111) * [-1034.736] (-1039.468) (-1039.799) (-1035.204) -- 0:00:33
439500 -- (-1033.772) (-1038.133) [-1036.734] (-1036.905) * [-1036.778] (-1041.678) (-1040.282) (-1036.793) -- 0:00:33
440000 -- (-1037.636) (-1036.045) [-1035.549] (-1037.936) * (-1037.573) (-1038.944) (-1037.349) [-1037.444] -- 0:00:33
Average standard deviation of split frequencies: 0.009565
440500 -- (-1041.469) (-1035.162) [-1035.521] (-1035.733) * (-1036.516) (-1034.322) (-1035.838) [-1034.442] -- 0:00:33
441000 -- (-1034.967) (-1040.812) (-1036.262) [-1039.448] * (-1035.365) [-1036.854] (-1037.343) (-1034.270) -- 0:00:32
441500 -- [-1035.532] (-1038.288) (-1042.473) (-1034.864) * (-1034.786) [-1035.764] (-1034.767) (-1035.196) -- 0:00:32
442000 -- (-1035.844) [-1035.227] (-1040.208) (-1034.590) * (-1041.105) [-1033.920] (-1037.827) (-1034.488) -- 0:00:32
442500 -- (-1035.472) (-1039.499) (-1041.539) [-1036.723] * (-1038.360) (-1034.818) [-1035.054] (-1034.602) -- 0:00:34
443000 -- [-1036.026] (-1036.912) (-1040.695) (-1035.560) * (-1038.609) (-1034.070) (-1040.279) [-1035.219] -- 0:00:33
443500 -- [-1034.690] (-1034.522) (-1039.047) (-1033.922) * (-1040.883) [-1033.471] (-1041.123) (-1040.903) -- 0:00:33
444000 -- (-1034.639) (-1038.591) [-1036.484] (-1039.501) * (-1036.554) [-1034.094] (-1035.941) (-1036.290) -- 0:00:33
444500 -- [-1035.465] (-1037.160) (-1037.996) (-1037.075) * (-1035.582) (-1034.560) (-1037.000) [-1037.378] -- 0:00:33
445000 -- [-1034.391] (-1035.958) (-1035.719) (-1035.252) * (-1037.443) [-1036.934] (-1035.495) (-1035.392) -- 0:00:33
Average standard deviation of split frequencies: 0.008953
445500 -- (-1034.473) [-1035.496] (-1036.314) (-1036.965) * (-1037.860) (-1037.824) [-1035.122] (-1035.685) -- 0:00:33
446000 -- (-1036.761) [-1037.252] (-1035.673) (-1041.184) * (-1037.492) (-1043.771) [-1037.166] (-1038.822) -- 0:00:33
446500 -- (-1036.734) (-1034.895) [-1034.402] (-1035.998) * (-1036.067) (-1041.510) [-1036.840] (-1042.072) -- 0:00:33
447000 -- (-1040.393) (-1036.469) [-1036.183] (-1037.386) * (-1033.904) (-1034.961) [-1034.792] (-1036.814) -- 0:00:33
447500 -- (-1034.204) [-1035.984] (-1037.514) (-1034.538) * [-1034.254] (-1036.617) (-1036.053) (-1036.997) -- 0:00:33
448000 -- [-1033.812] (-1035.138) (-1038.573) (-1037.584) * [-1035.157] (-1037.718) (-1036.572) (-1037.118) -- 0:00:33
448500 -- (-1033.870) [-1036.967] (-1036.526) (-1041.037) * (-1034.451) (-1040.931) (-1034.789) [-1035.724] -- 0:00:33
449000 -- (-1034.246) (-1038.166) [-1035.101] (-1036.733) * (-1034.586) (-1035.399) (-1037.781) [-1039.439] -- 0:00:33
449500 -- (-1034.946) (-1035.820) (-1034.874) [-1038.350] * (-1034.573) [-1036.700] (-1035.517) (-1035.400) -- 0:00:33
450000 -- (-1034.206) (-1037.422) [-1035.781] (-1036.284) * (-1034.512) (-1035.296) [-1034.089] (-1034.332) -- 0:00:33
Average standard deviation of split frequencies: 0.009298
450500 -- (-1035.336) [-1036.256] (-1036.735) (-1038.108) * (-1039.545) (-1035.148) (-1034.006) [-1037.559] -- 0:00:32
451000 -- (-1035.699) [-1033.856] (-1036.942) (-1037.441) * (-1034.011) [-1035.320] (-1036.603) (-1036.851) -- 0:00:32
451500 -- (-1033.410) [-1034.646] (-1036.821) (-1034.151) * (-1036.005) (-1036.262) [-1037.180] (-1035.893) -- 0:00:32
452000 -- (-1033.479) [-1037.358] (-1035.580) (-1033.744) * [-1034.117] (-1043.266) (-1033.976) (-1038.719) -- 0:00:32
452500 -- (-1037.769) [-1035.753] (-1036.870) (-1036.010) * [-1038.305] (-1038.736) (-1036.675) (-1038.521) -- 0:00:32
453000 -- (-1037.138) (-1033.420) [-1036.896] (-1036.338) * [-1035.071] (-1034.848) (-1036.061) (-1038.949) -- 0:00:32
453500 -- (-1035.154) [-1033.422] (-1040.115) (-1038.376) * (-1033.483) [-1037.669] (-1034.404) (-1037.223) -- 0:00:32
454000 -- (-1034.342) [-1036.475] (-1037.075) (-1038.114) * (-1037.315) [-1035.836] (-1034.466) (-1038.929) -- 0:00:32
454500 -- [-1033.777] (-1036.724) (-1036.176) (-1038.872) * (-1039.939) (-1035.385) [-1035.664] (-1034.565) -- 0:00:32
455000 -- (-1035.211) [-1036.401] (-1035.618) (-1034.647) * (-1037.894) (-1034.096) (-1038.908) [-1035.117] -- 0:00:32
Average standard deviation of split frequencies: 0.008757
455500 -- (-1035.237) (-1040.029) [-1034.578] (-1034.647) * [-1035.341] (-1040.183) (-1036.235) (-1037.261) -- 0:00:32
456000 -- [-1034.294] (-1034.433) (-1035.186) (-1033.974) * (-1037.104) (-1035.080) [-1033.670] (-1035.133) -- 0:00:32
456500 -- (-1036.627) (-1034.704) [-1035.463] (-1035.546) * [-1037.904] (-1037.588) (-1035.001) (-1037.543) -- 0:00:32
457000 -- [-1036.935] (-1035.807) (-1043.731) (-1035.451) * [-1036.314] (-1039.354) (-1036.260) (-1037.550) -- 0:00:32
457500 -- (-1034.064) (-1034.181) (-1038.053) [-1034.475] * [-1040.391] (-1035.458) (-1036.376) (-1039.990) -- 0:00:32
458000 -- (-1038.961) (-1033.785) (-1037.981) [-1036.076] * (-1036.203) (-1039.547) [-1035.838] (-1036.732) -- 0:00:31
458500 -- (-1038.663) [-1033.986] (-1033.446) (-1034.960) * (-1035.250) (-1035.403) (-1037.823) [-1034.249] -- 0:00:31
459000 -- (-1035.846) [-1035.527] (-1034.804) (-1034.452) * (-1036.625) [-1035.111] (-1036.318) (-1036.891) -- 0:00:33
459500 -- (-1038.596) (-1034.960) [-1035.470] (-1039.294) * (-1037.712) [-1035.983] (-1034.334) (-1034.212) -- 0:00:32
460000 -- [-1036.865] (-1035.666) (-1034.547) (-1035.602) * [-1034.939] (-1036.749) (-1034.202) (-1034.500) -- 0:00:32
Average standard deviation of split frequencies: 0.009029
460500 -- (-1034.850) [-1035.320] (-1034.797) (-1034.946) * (-1038.466) (-1036.611) [-1034.252] (-1033.941) -- 0:00:32
461000 -- (-1036.120) (-1035.878) [-1034.128] (-1035.356) * (-1038.874) (-1035.806) [-1033.966] (-1034.328) -- 0:00:32
461500 -- [-1036.022] (-1039.596) (-1036.577) (-1036.928) * (-1046.179) (-1035.353) (-1035.721) [-1036.434] -- 0:00:32
462000 -- (-1035.660) [-1036.130] (-1034.156) (-1035.701) * (-1038.743) (-1035.739) [-1036.513] (-1034.506) -- 0:00:32
462500 -- (-1035.935) (-1038.399) (-1033.878) [-1033.959] * (-1040.471) (-1036.235) [-1038.894] (-1034.860) -- 0:00:32
463000 -- (-1036.553) [-1035.219] (-1037.793) (-1035.102) * (-1038.918) (-1036.278) (-1040.325) [-1035.185] -- 0:00:32
463500 -- (-1033.850) (-1038.006) [-1035.088] (-1036.327) * [-1035.625] (-1036.497) (-1034.987) (-1038.538) -- 0:00:32
464000 -- (-1036.280) [-1035.201] (-1039.867) (-1034.814) * (-1035.373) (-1035.975) (-1034.646) [-1036.156] -- 0:00:32
464500 -- (-1037.164) [-1037.274] (-1042.585) (-1035.933) * [-1035.184] (-1034.560) (-1037.694) (-1034.436) -- 0:00:32
465000 -- (-1036.960) (-1036.408) (-1042.681) [-1037.639] * [-1035.735] (-1038.174) (-1035.600) (-1035.565) -- 0:00:32
Average standard deviation of split frequencies: 0.008747
465500 -- (-1037.947) (-1037.649) [-1041.715] (-1037.079) * (-1036.230) (-1034.887) [-1036.679] (-1035.565) -- 0:00:32
466000 -- [-1034.446] (-1036.336) (-1036.357) (-1036.213) * (-1035.613) (-1037.572) [-1036.471] (-1034.761) -- 0:00:32
466500 -- (-1035.412) (-1036.647) [-1035.438] (-1035.719) * (-1036.531) [-1035.187] (-1037.052) (-1036.980) -- 0:00:32
467000 -- (-1039.927) (-1042.345) [-1034.482] (-1034.567) * (-1036.055) (-1038.987) [-1039.866] (-1038.676) -- 0:00:31
467500 -- (-1040.254) (-1035.185) (-1034.667) [-1033.665] * (-1033.960) (-1036.677) [-1035.386] (-1036.471) -- 0:00:31
468000 -- (-1034.990) (-1040.358) (-1037.867) [-1034.616] * (-1035.054) [-1035.634] (-1034.443) (-1037.618) -- 0:00:31
468500 -- (-1044.118) (-1036.824) [-1037.200] (-1036.691) * [-1035.272] (-1035.233) (-1034.101) (-1035.669) -- 0:00:31
469000 -- (-1036.650) (-1033.956) [-1035.437] (-1038.946) * (-1035.998) (-1034.722) (-1034.230) [-1038.684] -- 0:00:31
469500 -- (-1035.464) (-1035.307) (-1037.086) [-1034.688] * [-1036.068] (-1038.447) (-1034.858) (-1038.324) -- 0:00:31
470000 -- (-1035.841) (-1037.315) [-1033.398] (-1034.075) * (-1036.287) (-1034.811) (-1039.483) [-1037.124] -- 0:00:31
Average standard deviation of split frequencies: 0.009202
470500 -- (-1041.378) [-1037.442] (-1035.483) (-1036.819) * (-1035.215) (-1037.765) (-1035.394) [-1034.963] -- 0:00:31
471000 -- [-1037.795] (-1036.124) (-1040.694) (-1035.681) * [-1038.355] (-1038.129) (-1037.656) (-1035.302) -- 0:00:31
471500 -- [-1038.437] (-1034.128) (-1035.271) (-1036.645) * (-1035.731) (-1037.179) (-1034.365) [-1034.760] -- 0:00:31
472000 -- (-1040.671) (-1034.828) (-1038.889) [-1037.141] * (-1034.316) (-1034.633) [-1035.067] (-1034.806) -- 0:00:31
472500 -- (-1036.389) (-1034.505) (-1037.023) [-1034.584] * [-1034.753] (-1033.792) (-1033.914) (-1034.757) -- 0:00:31
473000 -- (-1036.857) (-1037.229) (-1036.233) [-1035.724] * (-1034.884) [-1037.791] (-1033.954) (-1034.688) -- 0:00:31
473500 -- (-1035.389) (-1035.513) (-1042.338) [-1033.623] * [-1034.365] (-1035.179) (-1036.610) (-1034.669) -- 0:00:31
474000 -- (-1036.847) (-1034.306) [-1034.709] (-1035.028) * (-1036.775) [-1035.603] (-1039.656) (-1033.932) -- 0:00:31
474500 -- (-1037.074) (-1035.929) [-1038.361] (-1035.525) * [-1038.069] (-1037.726) (-1036.140) (-1038.382) -- 0:00:31
475000 -- (-1035.706) (-1039.145) (-1036.721) [-1035.922] * (-1034.792) (-1034.473) [-1041.244] (-1034.148) -- 0:00:30
Average standard deviation of split frequencies: 0.008738
475500 -- [-1035.236] (-1037.556) (-1035.308) (-1036.512) * (-1036.344) [-1034.102] (-1034.613) (-1039.271) -- 0:00:31
476000 -- (-1033.883) [-1036.078] (-1033.805) (-1035.215) * [-1037.376] (-1037.758) (-1035.286) (-1035.517) -- 0:00:31
476500 -- [-1035.361] (-1037.505) (-1037.600) (-1035.580) * (-1037.417) (-1034.437) (-1036.892) [-1034.501] -- 0:00:31
477000 -- (-1036.145) [-1034.805] (-1034.077) (-1037.453) * (-1037.448) (-1035.501) [-1034.632] (-1037.013) -- 0:00:31
477500 -- (-1035.570) (-1045.195) [-1035.287] (-1036.273) * (-1041.355) [-1035.154] (-1033.811) (-1034.547) -- 0:00:31
478000 -- (-1034.564) (-1036.927) [-1039.191] (-1037.917) * [-1034.225] (-1035.168) (-1037.731) (-1035.220) -- 0:00:31
478500 -- [-1035.305] (-1037.631) (-1035.205) (-1034.511) * [-1034.262] (-1035.639) (-1036.026) (-1035.012) -- 0:00:31
479000 -- [-1034.222] (-1041.212) (-1035.465) (-1034.901) * (-1035.046) (-1035.115) (-1042.604) [-1034.452] -- 0:00:31
479500 -- [-1034.888] (-1039.370) (-1033.785) (-1034.016) * [-1035.785] (-1040.842) (-1042.103) (-1035.345) -- 0:00:31
480000 -- (-1043.750) [-1033.808] (-1034.546) (-1033.813) * (-1036.367) (-1035.718) [-1034.443] (-1035.576) -- 0:00:31
Average standard deviation of split frequencies: 0.009115
480500 -- (-1035.910) (-1034.096) (-1034.594) [-1034.453] * (-1034.522) (-1036.320) [-1034.922] (-1035.246) -- 0:00:31
481000 -- (-1035.366) (-1033.504) (-1036.370) [-1033.647] * (-1035.655) (-1038.201) (-1034.939) [-1035.923] -- 0:00:31
481500 -- (-1036.804) (-1034.111) (-1034.957) [-1036.072] * (-1036.802) (-1035.273) (-1034.768) [-1034.736] -- 0:00:31
482000 -- (-1037.970) (-1036.488) (-1034.026) [-1035.751] * (-1036.036) [-1034.696] (-1035.400) (-1036.950) -- 0:00:31
482500 -- [-1035.789] (-1035.448) (-1036.291) (-1038.157) * (-1037.574) [-1035.432] (-1039.961) (-1035.585) -- 0:00:31
483000 -- (-1034.050) (-1034.362) [-1034.328] (-1036.506) * [-1037.526] (-1037.108) (-1038.087) (-1036.727) -- 0:00:31
483500 -- (-1034.298) (-1036.451) [-1034.826] (-1036.164) * (-1035.623) [-1034.407] (-1038.118) (-1035.036) -- 0:00:30
484000 -- [-1033.941] (-1035.843) (-1034.632) (-1038.005) * (-1036.328) (-1034.463) (-1038.347) [-1036.016] -- 0:00:30
484500 -- (-1034.144) (-1037.216) (-1034.531) [-1035.307] * [-1037.136] (-1037.518) (-1038.856) (-1035.501) -- 0:00:30
485000 -- (-1034.251) [-1037.130] (-1034.893) (-1035.987) * (-1036.886) [-1036.388] (-1036.604) (-1038.225) -- 0:00:30
Average standard deviation of split frequencies: 0.009814
485500 -- (-1035.608) (-1038.362) [-1034.766] (-1033.961) * (-1034.451) (-1034.546) (-1034.576) [-1036.779] -- 0:00:30
486000 -- (-1038.475) (-1040.086) (-1037.226) [-1035.194] * (-1037.754) [-1034.770] (-1035.283) (-1034.030) -- 0:00:30
486500 -- (-1035.732) (-1038.607) (-1035.569) [-1034.477] * [-1035.547] (-1038.190) (-1033.804) (-1039.042) -- 0:00:30
487000 -- (-1038.751) (-1034.896) (-1034.463) [-1037.416] * (-1038.056) [-1036.685] (-1038.003) (-1037.386) -- 0:00:30
487500 -- [-1037.398] (-1035.846) (-1033.434) (-1034.602) * (-1037.477) [-1037.427] (-1038.670) (-1037.030) -- 0:00:30
488000 -- (-1035.799) (-1034.943) [-1033.430] (-1038.371) * [-1034.875] (-1036.400) (-1037.635) (-1034.701) -- 0:00:30
488500 -- [-1033.903] (-1037.683) (-1037.346) (-1035.360) * [-1034.979] (-1037.031) (-1035.495) (-1038.125) -- 0:00:30
489000 -- (-1036.158) [-1037.229] (-1036.015) (-1035.642) * (-1035.979) [-1035.429] (-1034.350) (-1035.089) -- 0:00:30
489500 -- [-1037.939] (-1037.455) (-1034.837) (-1038.088) * (-1037.889) (-1035.147) [-1034.401] (-1035.254) -- 0:00:30
490000 -- (-1035.717) (-1038.335) (-1036.026) [-1036.091] * (-1034.899) (-1037.559) [-1034.463] (-1034.371) -- 0:00:30
Average standard deviation of split frequencies: 0.009212
490500 -- (-1038.506) (-1034.571) [-1035.968] (-1036.951) * [-1037.641] (-1038.812) (-1034.053) (-1034.469) -- 0:00:30
491000 -- (-1039.720) (-1035.921) (-1037.527) [-1035.220] * (-1038.796) [-1034.158] (-1035.642) (-1038.549) -- 0:00:30
491500 -- (-1036.989) [-1035.368] (-1033.882) (-1036.346) * [-1033.818] (-1036.211) (-1034.301) (-1040.126) -- 0:00:31
492000 -- (-1036.989) [-1035.812] (-1033.830) (-1036.223) * (-1036.513) [-1034.194] (-1035.850) (-1036.136) -- 0:00:30
492500 -- (-1036.475) (-1036.592) (-1034.392) [-1043.719] * (-1036.789) (-1035.279) (-1038.838) [-1035.766] -- 0:00:30
493000 -- (-1035.688) (-1040.603) (-1034.462) [-1038.070] * (-1037.765) (-1036.065) (-1035.267) [-1033.689] -- 0:00:30
493500 -- (-1035.069) [-1035.007] (-1034.590) (-1035.593) * (-1034.071) (-1035.119) [-1037.144] (-1036.291) -- 0:00:30
494000 -- (-1035.841) (-1041.122) [-1036.260] (-1034.723) * (-1035.814) [-1034.366] (-1037.622) (-1038.882) -- 0:00:30
494500 -- (-1036.294) (-1042.816) (-1036.433) [-1033.999] * (-1035.863) (-1034.854) (-1036.882) [-1035.510] -- 0:00:30
495000 -- (-1034.815) (-1035.025) (-1035.297) [-1036.788] * (-1034.857) (-1035.384) [-1040.147] (-1036.219) -- 0:00:30
Average standard deviation of split frequencies: 0.009672
495500 -- (-1034.461) (-1034.545) [-1036.187] (-1039.739) * (-1037.204) [-1034.121] (-1034.495) (-1035.215) -- 0:00:30
496000 -- [-1034.620] (-1035.517) (-1035.932) (-1035.169) * (-1040.117) (-1034.974) (-1035.366) [-1034.583] -- 0:00:30
496500 -- (-1037.137) [-1037.077] (-1034.959) (-1036.735) * (-1036.914) (-1036.177) [-1035.744] (-1034.155) -- 0:00:30
497000 -- (-1037.829) (-1035.788) [-1034.203] (-1038.278) * (-1036.697) (-1035.246) (-1034.617) [-1037.828] -- 0:00:30
497500 -- [-1037.915] (-1035.415) (-1034.952) (-1036.448) * (-1034.876) (-1035.473) [-1034.003] (-1033.921) -- 0:00:30
498000 -- (-1037.547) [-1034.066] (-1034.349) (-1035.857) * (-1038.047) [-1035.224] (-1034.424) (-1034.539) -- 0:00:30
498500 -- (-1034.813) [-1034.553] (-1034.682) (-1035.315) * (-1037.926) (-1034.426) (-1041.313) [-1034.631] -- 0:00:30
499000 -- (-1035.872) (-1034.703) (-1034.619) [-1035.256] * (-1038.257) [-1035.688] (-1034.633) (-1036.886) -- 0:00:30
499500 -- (-1033.722) [-1036.910] (-1036.878) (-1035.237) * (-1036.388) [-1036.534] (-1033.701) (-1035.601) -- 0:00:30
500000 -- (-1033.699) (-1034.160) [-1039.627] (-1036.754) * (-1036.136) (-1037.193) (-1034.965) [-1036.716] -- 0:00:30
Average standard deviation of split frequencies: 0.009692
500500 -- (-1034.977) (-1033.959) [-1038.208] (-1033.956) * (-1037.090) (-1037.528) (-1034.897) [-1036.554] -- 0:00:29
501000 -- (-1034.300) (-1033.640) [-1035.727] (-1037.605) * (-1035.922) (-1034.606) (-1041.935) [-1036.832] -- 0:00:29
501500 -- (-1034.270) [-1037.273] (-1037.251) (-1034.694) * (-1041.393) (-1034.791) [-1037.199] (-1035.877) -- 0:00:29
502000 -- (-1042.712) [-1036.388] (-1037.083) (-1035.458) * (-1038.616) (-1034.791) [-1034.868] (-1034.050) -- 0:00:29
502500 -- (-1035.704) (-1033.900) [-1035.654] (-1037.678) * (-1036.121) [-1035.728] (-1034.804) (-1036.381) -- 0:00:29
503000 -- (-1035.710) (-1035.015) (-1035.268) [-1033.626] * (-1035.321) (-1036.799) (-1036.718) [-1034.955] -- 0:00:29
503500 -- (-1040.591) (-1040.081) [-1034.367] (-1035.563) * (-1034.472) (-1039.413) [-1036.781] (-1034.618) -- 0:00:29
504000 -- (-1036.402) [-1037.036] (-1033.850) (-1036.132) * (-1036.732) (-1035.144) [-1033.702] (-1037.195) -- 0:00:29
504500 -- (-1036.472) (-1036.953) (-1034.260) [-1035.251] * (-1038.334) (-1037.693) [-1034.904] (-1038.980) -- 0:00:29
505000 -- [-1036.025] (-1036.801) (-1036.892) (-1037.853) * (-1035.681) (-1039.468) [-1036.827] (-1039.252) -- 0:00:29
Average standard deviation of split frequencies: 0.010138
505500 -- (-1038.344) (-1039.816) (-1035.752) [-1038.833] * (-1035.563) (-1035.137) (-1037.417) [-1037.607] -- 0:00:29
506000 -- (-1035.822) (-1040.098) [-1035.580] (-1039.379) * (-1035.831) [-1035.301] (-1039.560) (-1039.101) -- 0:00:29
506500 -- (-1039.577) (-1038.494) (-1034.428) [-1038.300] * [-1035.299] (-1034.802) (-1037.758) (-1036.487) -- 0:00:29
507000 -- (-1036.013) [-1038.325] (-1036.433) (-1037.824) * [-1035.092] (-1035.798) (-1037.468) (-1035.459) -- 0:00:29
507500 -- (-1033.923) (-1035.047) [-1034.355] (-1034.128) * (-1036.182) [-1035.267] (-1034.980) (-1037.556) -- 0:00:29
508000 -- [-1035.012] (-1036.127) (-1036.354) (-1034.943) * (-1035.843) (-1035.160) [-1036.346] (-1038.395) -- 0:00:30
508500 -- (-1035.060) [-1037.956] (-1035.082) (-1041.695) * (-1040.303) (-1037.784) (-1036.405) [-1037.657] -- 0:00:29
509000 -- [-1035.192] (-1038.109) (-1035.525) (-1042.832) * (-1042.513) [-1036.750] (-1034.382) (-1039.180) -- 0:00:29
509500 -- (-1039.374) (-1036.486) [-1037.531] (-1041.885) * (-1037.883) (-1040.310) [-1034.154] (-1034.240) -- 0:00:29
510000 -- (-1035.105) (-1036.713) (-1039.158) [-1034.051] * [-1036.193] (-1037.186) (-1034.349) (-1035.693) -- 0:00:29
Average standard deviation of split frequencies: 0.009503
510500 -- (-1036.255) [-1034.380] (-1036.340) (-1038.022) * [-1037.618] (-1036.181) (-1034.012) (-1041.604) -- 0:00:29
511000 -- [-1033.823] (-1034.596) (-1040.969) (-1037.872) * (-1033.767) [-1036.797] (-1034.357) (-1035.638) -- 0:00:29
511500 -- [-1035.195] (-1037.377) (-1035.276) (-1038.168) * [-1034.942] (-1037.812) (-1035.647) (-1034.726) -- 0:00:29
512000 -- [-1039.726] (-1036.798) (-1035.167) (-1039.910) * (-1037.860) (-1038.359) (-1034.230) [-1034.512] -- 0:00:29
512500 -- [-1037.189] (-1037.441) (-1038.504) (-1040.584) * (-1038.042) (-1035.275) (-1035.954) [-1035.053] -- 0:00:29
513000 -- (-1039.762) (-1038.370) [-1036.299] (-1037.820) * (-1038.943) (-1035.688) [-1036.911] (-1037.015) -- 0:00:29
513500 -- [-1037.330] (-1034.821) (-1034.181) (-1034.955) * (-1035.617) [-1034.834] (-1038.108) (-1034.687) -- 0:00:29
514000 -- (-1037.734) (-1034.778) [-1034.950] (-1034.232) * (-1035.933) [-1036.402] (-1038.917) (-1037.874) -- 0:00:29
514500 -- (-1036.648) (-1033.627) [-1035.697] (-1036.727) * (-1038.474) [-1040.080] (-1038.992) (-1038.028) -- 0:00:29
515000 -- (-1040.622) [-1034.614] (-1036.876) (-1034.868) * [-1035.464] (-1034.508) (-1035.083) (-1040.840) -- 0:00:29
Average standard deviation of split frequencies: 0.009781
515500 -- (-1040.447) (-1038.735) (-1034.326) [-1035.776] * (-1034.546) (-1035.716) (-1033.869) [-1036.406] -- 0:00:29
516000 -- (-1035.541) (-1033.975) [-1036.679] (-1035.683) * [-1036.002] (-1035.275) (-1037.928) (-1037.346) -- 0:00:29
516500 -- (-1034.488) (-1037.199) [-1034.577] (-1033.736) * (-1035.544) (-1036.023) (-1039.082) [-1034.725] -- 0:00:29
517000 -- [-1035.503] (-1038.081) (-1039.397) (-1033.736) * [-1038.012] (-1036.094) (-1039.465) (-1034.632) -- 0:00:28
517500 -- (-1034.582) [-1034.950] (-1037.125) (-1034.584) * (-1035.019) (-1036.021) (-1042.343) [-1034.022] -- 0:00:28
518000 -- [-1037.521] (-1034.465) (-1035.962) (-1034.817) * (-1036.124) (-1038.126) (-1039.769) [-1035.767] -- 0:00:28
518500 -- (-1035.705) [-1033.919] (-1038.710) (-1035.356) * (-1037.095) [-1038.294] (-1036.861) (-1037.047) -- 0:00:28
519000 -- (-1038.987) (-1033.646) [-1035.625] (-1037.820) * (-1036.887) (-1040.021) (-1034.386) [-1035.334] -- 0:00:28
519500 -- (-1034.278) [-1033.793] (-1038.052) (-1038.457) * (-1034.663) (-1040.921) (-1036.422) [-1034.437] -- 0:00:28
520000 -- [-1034.495] (-1034.037) (-1035.371) (-1034.304) * (-1034.623) [-1039.122] (-1036.214) (-1035.878) -- 0:00:28
Average standard deviation of split frequencies: 0.009906
520500 -- (-1035.049) (-1035.469) [-1034.626] (-1035.364) * [-1035.217] (-1035.684) (-1035.725) (-1036.866) -- 0:00:28
521000 -- [-1034.148] (-1035.972) (-1035.350) (-1038.775) * (-1036.262) (-1035.361) [-1035.662] (-1035.498) -- 0:00:28
521500 -- (-1034.149) [-1037.126] (-1035.098) (-1036.835) * [-1035.937] (-1036.093) (-1038.604) (-1034.789) -- 0:00:28
522000 -- (-1035.162) [-1037.668] (-1037.484) (-1035.284) * (-1033.610) (-1042.469) (-1042.854) [-1038.140] -- 0:00:28
522500 -- (-1034.843) [-1039.061] (-1035.144) (-1034.104) * (-1033.485) (-1042.484) (-1037.064) [-1036.076] -- 0:00:28
523000 -- (-1034.451) [-1036.546] (-1036.714) (-1034.405) * (-1035.052) (-1038.365) [-1038.145] (-1034.556) -- 0:00:28
523500 -- (-1034.822) (-1037.463) [-1037.279] (-1036.036) * [-1033.889] (-1035.642) (-1035.782) (-1038.504) -- 0:00:28
524000 -- [-1036.584] (-1038.356) (-1037.680) (-1039.047) * (-1033.969) [-1035.402] (-1034.140) (-1036.540) -- 0:00:28
524500 -- [-1036.460] (-1035.836) (-1035.993) (-1036.962) * (-1033.733) (-1037.539) [-1035.723] (-1036.165) -- 0:00:29
525000 -- [-1035.372] (-1037.560) (-1034.498) (-1034.082) * (-1035.281) [-1035.030] (-1035.196) (-1035.771) -- 0:00:28
Average standard deviation of split frequencies: 0.010122
525500 -- (-1036.841) (-1034.168) [-1034.448] (-1036.276) * (-1033.746) (-1035.241) (-1036.852) [-1035.830] -- 0:00:28
526000 -- (-1035.762) (-1033.680) (-1035.406) [-1035.244] * [-1033.966] (-1037.381) (-1037.065) (-1036.585) -- 0:00:28
526500 -- (-1036.342) [-1035.243] (-1034.561) (-1033.888) * [-1035.096] (-1036.416) (-1035.428) (-1038.087) -- 0:00:28
527000 -- (-1037.183) (-1034.980) (-1038.964) [-1034.350] * [-1034.964] (-1034.517) (-1035.560) (-1035.135) -- 0:00:28
527500 -- [-1035.269] (-1035.554) (-1036.503) (-1036.779) * (-1035.601) [-1034.878] (-1034.859) (-1036.795) -- 0:00:28
528000 -- [-1033.751] (-1036.107) (-1036.090) (-1039.741) * (-1036.981) (-1034.381) (-1034.182) [-1035.061] -- 0:00:28
528500 -- (-1036.435) [-1036.210] (-1037.305) (-1039.122) * (-1034.635) [-1034.542] (-1034.398) (-1034.900) -- 0:00:28
529000 -- (-1038.072) [-1038.184] (-1035.776) (-1038.367) * (-1035.281) (-1036.017) [-1033.826] (-1036.585) -- 0:00:28
529500 -- [-1037.928] (-1036.552) (-1036.094) (-1037.307) * (-1036.536) (-1036.559) [-1034.983] (-1033.645) -- 0:00:28
530000 -- (-1036.147) [-1037.208] (-1037.570) (-1037.532) * [-1034.803] (-1035.291) (-1034.136) (-1035.468) -- 0:00:28
Average standard deviation of split frequencies: 0.010294
530500 -- (-1035.339) [-1036.247] (-1038.144) (-1038.557) * (-1034.829) [-1034.923] (-1034.051) (-1034.428) -- 0:00:28
531000 -- [-1036.830] (-1034.025) (-1035.567) (-1040.604) * (-1036.360) (-1036.297) (-1034.046) [-1039.136] -- 0:00:28
531500 -- (-1034.547) (-1036.273) [-1034.952] (-1037.553) * (-1038.188) [-1037.097] (-1034.405) (-1039.217) -- 0:00:28
532000 -- [-1033.901] (-1035.609) (-1034.213) (-1035.036) * (-1034.912) [-1036.473] (-1036.441) (-1039.529) -- 0:00:28
532500 -- (-1034.703) [-1034.001] (-1037.005) (-1036.568) * [-1036.141] (-1037.532) (-1034.035) (-1035.167) -- 0:00:28
533000 -- (-1035.348) (-1035.477) (-1035.378) [-1036.760] * [-1035.811] (-1037.029) (-1034.372) (-1039.399) -- 0:00:28
533500 -- (-1037.607) (-1033.729) [-1034.979] (-1039.157) * [-1036.140] (-1034.668) (-1039.902) (-1035.856) -- 0:00:27
534000 -- (-1034.952) [-1033.387] (-1035.768) (-1035.082) * (-1036.509) (-1035.648) (-1038.677) [-1033.839] -- 0:00:27
534500 -- (-1041.712) [-1034.156] (-1035.000) (-1038.587) * (-1038.985) (-1035.261) (-1034.259) [-1037.719] -- 0:00:27
535000 -- [-1037.498] (-1034.324) (-1033.644) (-1041.980) * [-1037.060] (-1036.812) (-1034.349) (-1035.565) -- 0:00:27
Average standard deviation of split frequencies: 0.010606
535500 -- [-1038.772] (-1036.506) (-1035.299) (-1036.420) * (-1034.913) (-1034.196) [-1034.396] (-1035.909) -- 0:00:27
536000 -- (-1034.700) (-1033.550) [-1037.114] (-1036.484) * (-1036.407) (-1034.509) (-1040.377) [-1035.926] -- 0:00:27
536500 -- (-1035.495) [-1033.664] (-1035.355) (-1044.004) * (-1033.853) (-1038.236) [-1034.286] (-1038.461) -- 0:00:27
537000 -- (-1037.697) (-1033.506) [-1033.562] (-1042.527) * (-1036.374) (-1036.997) [-1033.986] (-1037.674) -- 0:00:27
537500 -- [-1034.798] (-1035.486) (-1033.621) (-1042.786) * (-1036.679) (-1034.382) [-1038.246] (-1034.182) -- 0:00:27
538000 -- [-1037.434] (-1035.252) (-1033.619) (-1039.798) * (-1035.393) (-1034.008) [-1038.804] (-1034.392) -- 0:00:27
538500 -- [-1035.441] (-1040.861) (-1033.643) (-1037.097) * (-1036.124) (-1036.539) (-1035.475) [-1038.449] -- 0:00:27
539000 -- (-1036.499) (-1036.906) (-1033.902) [-1035.764] * [-1034.814] (-1034.228) (-1040.287) (-1038.858) -- 0:00:27
539500 -- (-1035.853) (-1040.254) (-1033.824) [-1034.807] * [-1034.304] (-1037.199) (-1034.639) (-1040.568) -- 0:00:27
540000 -- (-1035.718) (-1035.255) (-1034.726) [-1034.854] * [-1033.552] (-1036.723) (-1035.643) (-1034.597) -- 0:00:27
Average standard deviation of split frequencies: 0.009745
540500 -- [-1034.332] (-1033.886) (-1035.560) (-1035.740) * [-1034.234] (-1038.784) (-1039.611) (-1035.642) -- 0:00:27
541000 -- [-1035.839] (-1033.760) (-1035.066) (-1035.454) * (-1037.617) (-1036.288) [-1033.512] (-1034.731) -- 0:00:27
541500 -- (-1036.650) (-1033.823) (-1035.609) [-1035.453] * [-1036.973] (-1036.354) (-1038.178) (-1037.963) -- 0:00:27
542000 -- (-1034.450) (-1035.336) (-1035.612) [-1034.128] * (-1034.147) [-1034.915] (-1038.944) (-1038.254) -- 0:00:27
542500 -- [-1036.331] (-1034.984) (-1034.089) (-1035.838) * (-1035.489) (-1037.332) [-1034.649] (-1036.505) -- 0:00:27
543000 -- (-1036.933) (-1034.399) [-1034.379] (-1035.773) * (-1035.836) (-1040.811) (-1038.664) [-1036.683] -- 0:00:27
543500 -- [-1034.646] (-1035.043) (-1034.137) (-1038.106) * (-1035.691) [-1038.355] (-1037.576) (-1038.825) -- 0:00:27
544000 -- (-1037.513) (-1036.000) [-1033.731] (-1034.651) * [-1034.926] (-1037.391) (-1037.491) (-1036.658) -- 0:00:27
544500 -- [-1037.680] (-1042.633) (-1035.192) (-1034.535) * (-1037.760) (-1036.307) (-1043.862) [-1035.158] -- 0:00:27
545000 -- (-1036.816) (-1042.024) (-1036.313) [-1035.583] * (-1035.044) (-1034.609) (-1035.529) [-1034.333] -- 0:00:27
Average standard deviation of split frequencies: 0.009345
545500 -- [-1042.095] (-1036.741) (-1038.691) (-1035.999) * (-1034.216) [-1034.424] (-1034.300) (-1036.929) -- 0:00:27
546000 -- [-1035.830] (-1036.524) (-1035.368) (-1036.788) * (-1034.723) (-1039.253) (-1036.867) [-1035.569] -- 0:00:27
546500 -- (-1034.874) [-1035.091] (-1036.296) (-1035.093) * (-1035.507) [-1034.763] (-1037.155) (-1034.290) -- 0:00:27
547000 -- (-1034.759) (-1034.712) (-1036.808) [-1036.375] * (-1037.767) (-1035.154) [-1035.357] (-1036.031) -- 0:00:27
547500 -- (-1035.044) (-1033.819) (-1035.560) [-1034.721] * (-1037.008) (-1036.531) [-1036.019] (-1034.585) -- 0:00:27
548000 -- (-1034.692) [-1033.791] (-1034.428) (-1035.608) * [-1038.077] (-1036.660) (-1038.971) (-1037.674) -- 0:00:27
548500 -- [-1034.136] (-1034.084) (-1035.884) (-1035.859) * [-1034.919] (-1039.513) (-1040.998) (-1034.337) -- 0:00:27
549000 -- (-1034.227) (-1034.727) (-1034.928) [-1038.889] * (-1035.934) (-1035.272) [-1036.821] (-1036.070) -- 0:00:27
549500 -- (-1034.562) (-1038.930) (-1035.632) [-1037.343] * (-1036.294) (-1037.727) [-1033.782] (-1035.292) -- 0:00:27
550000 -- (-1035.756) (-1035.872) (-1034.325) [-1034.602] * (-1035.680) (-1039.134) (-1033.710) [-1034.951] -- 0:00:27
Average standard deviation of split frequencies: 0.008913
550500 -- [-1035.698] (-1036.234) (-1037.636) (-1034.255) * (-1039.992) (-1037.063) (-1034.961) [-1034.558] -- 0:00:26
551000 -- (-1035.792) (-1038.796) (-1034.382) [-1034.294] * (-1036.397) [-1034.748] (-1036.603) (-1036.759) -- 0:00:26
551500 -- [-1034.858] (-1036.704) (-1040.022) (-1034.244) * (-1035.695) [-1034.716] (-1035.855) (-1038.880) -- 0:00:26
552000 -- (-1036.302) (-1035.981) (-1035.698) [-1037.054] * (-1035.560) (-1035.429) (-1036.326) [-1039.708] -- 0:00:26
552500 -- (-1033.770) [-1035.296] (-1033.489) (-1034.304) * (-1040.743) (-1036.430) (-1035.922) [-1035.971] -- 0:00:26
553000 -- [-1034.293] (-1036.284) (-1037.222) (-1034.267) * [-1035.150] (-1038.651) (-1033.423) (-1035.990) -- 0:00:26
553500 -- (-1036.642) [-1037.554] (-1037.007) (-1034.079) * (-1034.981) (-1044.506) (-1034.914) [-1033.708] -- 0:00:26
554000 -- (-1037.279) [-1035.327] (-1037.226) (-1035.889) * [-1034.623] (-1037.901) (-1036.731) (-1034.135) -- 0:00:26
554500 -- (-1035.933) (-1034.039) [-1035.160] (-1037.753) * (-1034.359) (-1039.785) (-1036.556) [-1033.687] -- 0:00:26
555000 -- (-1037.699) (-1035.131) (-1038.483) [-1034.201] * (-1034.445) (-1034.475) (-1034.897) [-1034.292] -- 0:00:26
Average standard deviation of split frequencies: 0.009276
555500 -- [-1038.318] (-1036.777) (-1035.141) (-1039.520) * (-1037.312) [-1037.656] (-1037.134) (-1034.987) -- 0:00:26
556000 -- (-1035.272) [-1037.482] (-1034.333) (-1038.313) * (-1033.514) [-1034.097] (-1036.041) (-1034.753) -- 0:00:26
556500 -- (-1036.991) [-1034.442] (-1038.014) (-1034.886) * (-1035.712) [-1034.915] (-1037.720) (-1035.340) -- 0:00:26
557000 -- (-1036.584) (-1033.430) [-1036.451] (-1035.187) * (-1040.673) (-1033.797) [-1033.859] (-1034.472) -- 0:00:26
557500 -- [-1033.589] (-1033.973) (-1038.237) (-1037.549) * (-1036.866) (-1034.515) [-1035.129] (-1034.087) -- 0:00:26
558000 -- [-1037.016] (-1035.545) (-1035.304) (-1037.509) * (-1035.343) (-1036.084) (-1035.430) [-1034.232] -- 0:00:26
558500 -- (-1037.611) (-1035.742) [-1035.831] (-1036.051) * (-1034.230) (-1035.151) [-1035.922] (-1033.753) -- 0:00:26
559000 -- (-1034.227) (-1034.462) [-1037.667] (-1034.121) * (-1033.750) (-1035.226) (-1036.180) [-1034.838] -- 0:00:26
559500 -- [-1036.672] (-1035.013) (-1036.073) (-1033.816) * [-1034.390] (-1034.649) (-1035.676) (-1038.341) -- 0:00:26
560000 -- [-1035.746] (-1036.491) (-1036.079) (-1035.635) * (-1036.886) (-1037.793) [-1035.589] (-1038.366) -- 0:00:26
Average standard deviation of split frequencies: 0.009150
560500 -- [-1034.654] (-1036.727) (-1035.662) (-1037.048) * (-1036.161) (-1035.416) (-1037.150) [-1034.420] -- 0:00:26
561000 -- (-1035.276) (-1040.120) (-1035.116) [-1034.598] * (-1036.294) (-1037.235) (-1036.737) [-1034.125] -- 0:00:26
561500 -- (-1035.273) (-1039.189) (-1040.368) [-1034.670] * (-1040.216) [-1034.565] (-1038.456) (-1035.505) -- 0:00:26
562000 -- [-1036.321] (-1036.088) (-1034.678) (-1035.580) * (-1041.034) (-1034.997) [-1035.609] (-1034.534) -- 0:00:26
562500 -- (-1036.077) [-1034.296] (-1041.269) (-1034.798) * (-1036.213) (-1034.967) [-1034.323] (-1033.932) -- 0:00:26
563000 -- (-1036.218) (-1036.793) [-1033.526] (-1036.667) * (-1037.152) [-1034.944] (-1035.843) (-1035.597) -- 0:00:26
563500 -- (-1042.484) (-1033.996) (-1036.119) [-1034.726] * (-1037.612) (-1035.702) [-1033.469] (-1035.116) -- 0:00:26
564000 -- (-1034.420) (-1033.729) [-1039.445] (-1037.877) * (-1034.336) [-1037.070] (-1034.289) (-1034.682) -- 0:00:26
564500 -- (-1034.600) [-1036.826] (-1037.031) (-1039.167) * (-1038.260) (-1035.443) [-1036.176] (-1034.950) -- 0:00:26
565000 -- (-1036.070) (-1038.290) [-1035.553] (-1034.029) * (-1038.549) [-1035.658] (-1037.294) (-1035.778) -- 0:00:26
Average standard deviation of split frequencies: 0.009113
565500 -- (-1036.897) [-1038.272] (-1034.524) (-1033.933) * (-1035.895) (-1034.489) (-1034.172) [-1034.390] -- 0:00:26
566000 -- (-1039.160) (-1034.722) [-1034.432] (-1037.104) * (-1036.667) (-1033.962) [-1034.638] (-1035.073) -- 0:00:26
566500 -- (-1037.685) [-1041.163] (-1034.048) (-1035.742) * (-1036.022) (-1035.196) [-1034.635] (-1037.223) -- 0:00:26
567000 -- (-1034.956) (-1037.174) [-1036.927] (-1035.449) * (-1037.946) [-1037.605] (-1034.950) (-1034.446) -- 0:00:25
567500 -- (-1035.163) (-1037.477) [-1038.070] (-1037.977) * (-1036.992) (-1040.950) (-1035.031) [-1035.940] -- 0:00:25
568000 -- (-1036.775) [-1035.728] (-1038.250) (-1036.534) * (-1036.663) [-1034.854] (-1035.096) (-1035.389) -- 0:00:25
568500 -- [-1037.548] (-1034.447) (-1037.776) (-1037.719) * (-1034.120) [-1033.660] (-1035.604) (-1037.673) -- 0:00:25
569000 -- (-1037.157) (-1038.910) [-1034.483] (-1037.584) * [-1033.989] (-1034.766) (-1036.705) (-1034.372) -- 0:00:25
569500 -- (-1036.774) (-1040.096) [-1035.268] (-1039.381) * (-1035.070) (-1036.643) [-1034.273] (-1035.691) -- 0:00:25
570000 -- (-1034.192) (-1035.445) [-1034.446] (-1035.185) * [-1035.034] (-1036.308) (-1035.089) (-1035.006) -- 0:00:25
Average standard deviation of split frequencies: 0.009232
570500 -- (-1036.215) [-1038.386] (-1036.052) (-1038.135) * (-1034.706) (-1035.445) [-1034.922] (-1035.794) -- 0:00:25
571000 -- (-1037.659) (-1035.811) [-1037.335] (-1035.438) * (-1034.706) [-1034.378] (-1035.073) (-1036.681) -- 0:00:25
571500 -- (-1033.764) (-1034.925) (-1035.537) [-1037.068] * (-1035.819) [-1035.075] (-1034.966) (-1036.847) -- 0:00:25
572000 -- (-1037.769) [-1035.149] (-1035.813) (-1034.449) * (-1034.246) (-1037.090) [-1036.324] (-1036.511) -- 0:00:25
572500 -- (-1037.213) (-1034.894) (-1037.290) [-1035.047] * (-1036.359) (-1036.630) (-1035.103) [-1036.261] -- 0:00:25
573000 -- (-1036.571) [-1036.085] (-1036.133) (-1034.267) * (-1035.196) (-1037.638) [-1035.214] (-1035.282) -- 0:00:25
573500 -- [-1035.417] (-1037.676) (-1039.749) (-1035.766) * [-1035.644] (-1040.287) (-1036.155) (-1035.844) -- 0:00:25
574000 -- [-1036.302] (-1034.071) (-1035.729) (-1034.775) * (-1034.441) (-1035.668) (-1036.418) [-1034.117] -- 0:00:25
574500 -- (-1034.087) (-1034.044) [-1036.433] (-1034.070) * [-1037.472] (-1035.729) (-1036.476) (-1034.247) -- 0:00:25
575000 -- (-1037.919) [-1033.853] (-1035.271) (-1036.747) * (-1034.853) (-1038.075) (-1038.320) [-1034.282] -- 0:00:25
Average standard deviation of split frequencies: 0.009730
575500 -- (-1035.705) [-1034.942] (-1034.555) (-1036.408) * (-1034.429) [-1034.861] (-1036.355) (-1037.663) -- 0:00:25
576000 -- (-1035.583) (-1036.036) [-1034.515] (-1036.757) * (-1033.732) (-1035.860) [-1036.659] (-1036.264) -- 0:00:25
576500 -- (-1040.143) (-1038.174) (-1033.835) [-1036.844] * (-1033.866) [-1036.994] (-1037.900) (-1037.122) -- 0:00:25
577000 -- [-1035.723] (-1037.196) (-1034.468) (-1042.424) * [-1034.671] (-1037.586) (-1037.893) (-1037.960) -- 0:00:25
577500 -- [-1037.982] (-1033.905) (-1035.474) (-1037.389) * (-1038.173) (-1036.507) [-1035.109] (-1037.000) -- 0:00:25
578000 -- (-1035.918) (-1039.437) [-1037.123] (-1038.159) * (-1037.468) (-1037.305) (-1034.585) [-1036.061] -- 0:00:25
578500 -- (-1038.540) [-1036.824] (-1035.456) (-1037.590) * (-1036.548) (-1034.879) (-1034.316) [-1034.536] -- 0:00:25
579000 -- (-1040.100) (-1036.824) (-1039.941) [-1033.650] * (-1034.387) (-1036.989) [-1035.437] (-1035.546) -- 0:00:25
579500 -- (-1035.481) (-1035.128) [-1034.367] (-1034.724) * [-1034.909] (-1035.803) (-1035.440) (-1037.263) -- 0:00:25
580000 -- [-1033.890] (-1034.568) (-1036.017) (-1034.545) * (-1039.070) (-1035.024) [-1034.801] (-1034.396) -- 0:00:25
Average standard deviation of split frequencies: 0.010076
580500 -- (-1038.557) [-1034.916] (-1035.859) (-1034.529) * (-1035.549) (-1037.817) [-1034.778] (-1034.578) -- 0:00:25
581000 -- (-1038.013) [-1033.799] (-1034.836) (-1035.562) * (-1044.813) (-1034.999) (-1034.899) [-1035.208] -- 0:00:25
581500 -- [-1036.164] (-1035.592) (-1041.730) (-1034.901) * (-1039.461) [-1036.674] (-1037.383) (-1034.892) -- 0:00:25
582000 -- (-1033.603) (-1034.273) (-1043.068) [-1036.089] * [-1037.839] (-1038.756) (-1035.724) (-1037.264) -- 0:00:25
582500 -- [-1033.978] (-1034.361) (-1034.740) (-1036.410) * (-1036.380) (-1035.022) (-1036.646) [-1039.646] -- 0:00:25
583000 -- (-1034.965) (-1034.195) (-1046.088) [-1034.684] * (-1036.203) (-1035.010) (-1034.441) [-1038.218] -- 0:00:25
583500 -- (-1035.903) [-1035.251] (-1035.871) (-1036.916) * (-1035.651) [-1036.060] (-1037.667) (-1037.712) -- 0:00:24
584000 -- (-1035.617) (-1037.409) [-1035.259] (-1040.960) * [-1033.952] (-1037.345) (-1042.081) (-1036.821) -- 0:00:24
584500 -- [-1036.303] (-1035.548) (-1034.366) (-1040.988) * [-1038.919] (-1035.466) (-1043.841) (-1038.374) -- 0:00:24
585000 -- (-1038.734) (-1035.245) (-1036.352) [-1036.569] * (-1034.941) (-1034.935) [-1034.528] (-1037.122) -- 0:00:24
Average standard deviation of split frequencies: 0.009743
585500 -- (-1036.296) (-1035.496) (-1035.036) [-1036.455] * (-1034.964) (-1035.936) [-1034.035] (-1036.632) -- 0:00:24
586000 -- (-1034.484) (-1035.312) [-1036.709] (-1035.557) * (-1033.667) [-1035.925] (-1034.551) (-1036.076) -- 0:00:24
586500 -- (-1036.772) (-1035.709) [-1035.251] (-1034.952) * (-1033.683) (-1035.477) (-1034.575) [-1036.053] -- 0:00:24
587000 -- (-1037.075) (-1036.327) [-1034.874] (-1034.518) * (-1035.741) (-1034.902) [-1034.241] (-1038.710) -- 0:00:24
587500 -- (-1036.943) [-1039.929] (-1035.258) (-1035.553) * (-1035.744) [-1034.746] (-1035.022) (-1038.025) -- 0:00:24
588000 -- (-1034.276) (-1034.130) (-1033.774) [-1034.542] * (-1036.786) [-1034.266] (-1036.468) (-1036.497) -- 0:00:24
588500 -- (-1034.910) (-1034.703) (-1035.418) [-1035.492] * [-1034.015] (-1034.817) (-1035.094) (-1037.974) -- 0:00:24
589000 -- (-1036.536) (-1033.880) (-1035.011) [-1033.546] * [-1034.501] (-1034.498) (-1036.673) (-1037.851) -- 0:00:24
589500 -- (-1034.351) [-1033.634] (-1035.518) (-1035.339) * [-1034.749] (-1036.096) (-1038.283) (-1035.465) -- 0:00:24
590000 -- (-1034.563) (-1034.147) (-1038.688) [-1034.971] * (-1036.760) (-1036.245) [-1036.020] (-1037.001) -- 0:00:24
Average standard deviation of split frequencies: 0.008826
590500 -- (-1035.399) (-1036.162) [-1038.420] (-1034.540) * (-1034.719) (-1036.787) [-1040.448] (-1037.236) -- 0:00:24
591000 -- (-1038.092) (-1033.967) (-1039.424) [-1034.117] * (-1033.840) [-1034.836] (-1035.009) (-1036.865) -- 0:00:24
591500 -- (-1035.000) [-1035.637] (-1040.615) (-1038.056) * [-1033.920] (-1035.002) (-1039.885) (-1035.865) -- 0:00:24
592000 -- (-1035.312) (-1034.980) (-1036.886) [-1039.810] * (-1037.951) (-1036.308) (-1034.635) [-1035.327] -- 0:00:24
592500 -- (-1034.488) [-1036.454] (-1037.798) (-1034.433) * (-1036.124) (-1036.128) [-1035.552] (-1036.654) -- 0:00:24
593000 -- [-1035.089] (-1036.097) (-1038.581) (-1035.770) * (-1037.199) [-1035.840] (-1033.830) (-1035.456) -- 0:00:24
593500 -- [-1036.015] (-1036.256) (-1037.081) (-1036.583) * (-1039.443) (-1038.790) [-1036.292] (-1036.798) -- 0:00:24
594000 -- (-1035.126) [-1033.887] (-1043.687) (-1036.332) * (-1037.856) [-1033.785] (-1039.376) (-1034.862) -- 0:00:24
594500 -- (-1035.044) (-1034.526) (-1037.213) [-1036.985] * (-1035.148) [-1035.725] (-1040.507) (-1035.125) -- 0:00:24
595000 -- (-1034.651) [-1033.662] (-1035.547) (-1035.217) * (-1039.872) (-1038.706) [-1036.300] (-1036.376) -- 0:00:24
Average standard deviation of split frequencies: 0.008375
595500 -- (-1035.936) (-1034.608) (-1033.931) [-1034.163] * (-1037.538) (-1036.028) (-1034.993) [-1034.917] -- 0:00:24
596000 -- (-1039.457) (-1035.393) (-1033.938) [-1035.620] * (-1034.835) (-1037.338) [-1036.643] (-1035.172) -- 0:00:24
596500 -- (-1038.250) (-1036.025) [-1035.689] (-1034.012) * [-1035.225] (-1036.467) (-1038.618) (-1035.821) -- 0:00:24
597000 -- [-1034.484] (-1035.859) (-1034.825) (-1034.388) * (-1036.981) [-1036.404] (-1035.350) (-1034.733) -- 0:00:24
597500 -- [-1036.387] (-1035.820) (-1034.205) (-1034.746) * (-1037.211) (-1041.017) (-1040.217) [-1036.362] -- 0:00:24
598000 -- (-1036.546) (-1041.913) (-1036.298) [-1034.412] * (-1039.134) (-1042.725) (-1034.231) [-1036.361] -- 0:00:24
598500 -- (-1036.112) (-1034.884) (-1033.859) [-1035.664] * [-1034.438] (-1044.242) (-1034.538) (-1035.777) -- 0:00:24
599000 -- (-1037.541) (-1034.354) [-1034.199] (-1036.822) * (-1035.147) (-1041.977) (-1037.209) [-1034.721] -- 0:00:24
599500 -- (-1036.067) (-1039.695) [-1033.758] (-1035.958) * (-1035.602) (-1034.690) [-1034.303] (-1034.632) -- 0:00:24
600000 -- (-1035.629) [-1035.300] (-1034.615) (-1035.472) * (-1035.112) [-1036.764] (-1036.067) (-1034.049) -- 0:00:24
Average standard deviation of split frequencies: 0.008771
600500 -- (-1035.445) (-1036.089) (-1036.070) [-1037.100] * [-1035.863] (-1037.535) (-1038.747) (-1035.116) -- 0:00:23
601000 -- [-1034.047] (-1037.034) (-1035.590) (-1034.219) * (-1034.899) [-1035.104] (-1037.633) (-1033.695) -- 0:00:23
601500 -- (-1035.331) (-1034.948) (-1037.118) [-1034.898] * [-1035.341] (-1036.755) (-1036.833) (-1033.781) -- 0:00:23
602000 -- (-1034.741) [-1037.530] (-1036.032) (-1034.831) * [-1035.128] (-1035.221) (-1036.561) (-1034.494) -- 0:00:23
602500 -- (-1037.707) (-1034.279) (-1037.640) [-1034.267] * [-1034.936] (-1034.675) (-1035.610) (-1034.916) -- 0:00:23
603000 -- (-1041.599) (-1040.059) (-1037.406) [-1033.660] * (-1041.175) (-1040.897) [-1035.727] (-1034.813) -- 0:00:23
603500 -- (-1034.980) (-1037.480) (-1035.803) [-1035.765] * [-1039.605] (-1040.508) (-1034.465) (-1034.485) -- 0:00:23
604000 -- (-1036.848) (-1035.517) (-1034.776) [-1034.479] * (-1039.084) (-1041.563) [-1036.831] (-1037.597) -- 0:00:23
604500 -- (-1036.831) [-1033.742] (-1036.142) (-1036.024) * (-1040.315) (-1035.462) [-1034.977] (-1037.651) -- 0:00:23
605000 -- (-1036.310) (-1036.835) [-1035.747] (-1033.672) * [-1039.713] (-1034.763) (-1035.039) (-1041.509) -- 0:00:23
Average standard deviation of split frequencies: 0.008989
605500 -- [-1035.326] (-1035.103) (-1037.508) (-1034.982) * [-1033.938] (-1037.357) (-1034.247) (-1045.713) -- 0:00:23
606000 -- [-1035.436] (-1037.883) (-1036.947) (-1040.283) * (-1033.632) [-1034.803] (-1038.090) (-1040.135) -- 0:00:23
606500 -- (-1036.061) (-1037.955) [-1039.125] (-1036.499) * (-1035.747) (-1035.775) (-1035.998) [-1034.619] -- 0:00:23
607000 -- (-1033.898) (-1040.199) [-1035.535] (-1042.493) * (-1037.116) (-1038.095) [-1037.931] (-1034.834) -- 0:00:23
607500 -- (-1037.664) [-1035.899] (-1035.433) (-1034.699) * (-1035.937) [-1035.176] (-1037.749) (-1036.403) -- 0:00:23
608000 -- [-1034.209] (-1039.408) (-1038.999) (-1035.681) * (-1034.703) [-1035.786] (-1035.713) (-1036.089) -- 0:00:23
608500 -- (-1036.671) (-1036.048) [-1037.452] (-1034.746) * (-1034.883) (-1037.922) (-1035.050) [-1034.455] -- 0:00:23
609000 -- (-1041.331) [-1034.818] (-1035.115) (-1035.618) * (-1036.481) (-1038.368) (-1035.909) [-1038.024] -- 0:00:23
609500 -- (-1035.799) [-1036.252] (-1037.787) (-1035.396) * [-1034.794] (-1037.560) (-1035.586) (-1035.121) -- 0:00:23
610000 -- (-1036.037) (-1036.076) (-1037.583) [-1036.278] * (-1035.218) (-1036.025) [-1034.719] (-1034.203) -- 0:00:23
Average standard deviation of split frequencies: 0.008920
610500 -- [-1036.059] (-1035.112) (-1037.039) (-1034.332) * (-1033.977) (-1036.157) (-1036.060) [-1035.446] -- 0:00:23
611000 -- (-1038.584) (-1038.907) (-1035.713) [-1037.165] * [-1035.679] (-1034.454) (-1033.979) (-1034.938) -- 0:00:23
611500 -- (-1034.014) (-1035.220) [-1034.538] (-1034.068) * [-1035.895] (-1035.094) (-1034.863) (-1034.922) -- 0:00:23
612000 -- [-1034.944] (-1035.138) (-1035.460) (-1035.085) * (-1035.306) (-1036.377) (-1035.113) [-1033.579] -- 0:00:23
612500 -- (-1034.429) (-1040.986) [-1035.757] (-1039.603) * (-1034.818) [-1033.683] (-1038.072) (-1034.842) -- 0:00:23
613000 -- (-1033.580) (-1036.236) (-1034.662) [-1035.238] * [-1037.055] (-1035.926) (-1036.593) (-1034.276) -- 0:00:23
613500 -- (-1038.077) (-1038.268) (-1035.584) [-1038.115] * (-1034.546) [-1034.812] (-1035.775) (-1039.075) -- 0:00:23
614000 -- [-1036.549] (-1038.417) (-1040.575) (-1035.109) * (-1034.090) [-1036.233] (-1035.981) (-1035.293) -- 0:00:23
614500 -- (-1036.144) [-1036.333] (-1035.802) (-1034.326) * [-1034.832] (-1035.625) (-1035.610) (-1035.478) -- 0:00:23
615000 -- (-1039.296) [-1035.920] (-1036.855) (-1035.198) * [-1035.659] (-1034.284) (-1034.160) (-1035.343) -- 0:00:23
Average standard deviation of split frequencies: 0.009396
615500 -- (-1037.908) (-1034.139) [-1034.460] (-1038.226) * (-1043.280) (-1034.555) (-1035.176) [-1035.344] -- 0:00:23
616000 -- (-1037.441) (-1035.050) [-1034.450] (-1043.699) * (-1038.517) (-1034.113) [-1036.501] (-1037.218) -- 0:00:23
616500 -- (-1038.954) [-1034.204] (-1035.297) (-1040.243) * [-1036.901] (-1033.838) (-1034.622) (-1039.680) -- 0:00:23
617000 -- [-1035.615] (-1034.233) (-1036.727) (-1035.678) * [-1036.958] (-1034.070) (-1034.146) (-1036.455) -- 0:00:22
617500 -- (-1033.963) (-1037.308) (-1036.699) [-1034.751] * [-1037.568] (-1036.228) (-1034.511) (-1037.058) -- 0:00:22
618000 -- (-1036.834) (-1038.631) (-1033.928) [-1033.573] * [-1034.267] (-1035.248) (-1037.802) (-1041.886) -- 0:00:22
618500 -- (-1038.614) (-1035.095) (-1034.052) [-1033.549] * (-1034.966) (-1034.607) (-1037.805) [-1037.763] -- 0:00:22
619000 -- (-1035.802) [-1034.966] (-1035.645) (-1036.401) * (-1037.682) (-1036.248) [-1036.714] (-1035.652) -- 0:00:22
619500 -- (-1038.445) (-1034.978) (-1034.346) [-1036.390] * (-1039.920) [-1036.696] (-1036.625) (-1034.296) -- 0:00:22
620000 -- (-1036.680) (-1034.447) (-1033.934) [-1034.062] * [-1036.501] (-1036.363) (-1035.615) (-1034.248) -- 0:00:22
Average standard deviation of split frequencies: 0.009338
620500 -- (-1033.668) [-1034.814] (-1035.843) (-1033.862) * (-1034.664) [-1040.423] (-1034.586) (-1036.737) -- 0:00:22
621000 -- (-1034.464) (-1037.506) [-1035.304] (-1037.216) * (-1037.480) (-1037.380) (-1038.614) [-1037.248] -- 0:00:22
621500 -- (-1034.933) [-1034.128] (-1034.701) (-1037.304) * (-1036.938) (-1041.086) [-1043.703] (-1034.143) -- 0:00:22
622000 -- (-1034.558) (-1035.105) [-1034.534] (-1039.392) * (-1036.610) [-1037.555] (-1036.265) (-1034.799) -- 0:00:22
622500 -- (-1037.037) [-1039.439] (-1033.788) (-1038.357) * (-1035.592) (-1037.117) [-1035.290] (-1036.588) -- 0:00:22
623000 -- [-1036.370] (-1035.758) (-1034.206) (-1036.838) * (-1035.140) (-1038.514) [-1036.091] (-1036.680) -- 0:00:22
623500 -- (-1038.816) [-1035.099] (-1034.883) (-1037.877) * (-1034.512) (-1033.378) [-1034.400] (-1034.637) -- 0:00:22
624000 -- [-1035.097] (-1036.739) (-1036.826) (-1037.943) * [-1037.737] (-1037.174) (-1034.943) (-1034.753) -- 0:00:22
624500 -- (-1033.706) [-1035.539] (-1034.444) (-1040.471) * (-1034.712) [-1035.947] (-1034.043) (-1035.952) -- 0:00:22
625000 -- [-1035.222] (-1035.970) (-1038.157) (-1041.783) * (-1035.965) (-1036.895) (-1035.666) [-1035.339] -- 0:00:22
Average standard deviation of split frequencies: 0.009329
625500 -- (-1035.116) (-1041.735) [-1036.449] (-1037.622) * (-1038.520) (-1037.580) [-1036.204] (-1036.073) -- 0:00:22
626000 -- (-1038.096) (-1038.995) (-1035.862) [-1036.981] * (-1039.105) [-1036.593] (-1038.514) (-1038.592) -- 0:00:22
626500 -- (-1035.042) (-1034.263) [-1034.370] (-1036.644) * (-1035.757) [-1035.563] (-1034.689) (-1033.907) -- 0:00:22
627000 -- (-1035.080) (-1035.157) [-1036.118] (-1034.465) * [-1040.477] (-1038.659) (-1034.784) (-1034.068) -- 0:00:22
627500 -- (-1034.858) [-1036.267] (-1035.695) (-1041.415) * (-1035.554) (-1039.286) [-1037.789] (-1034.836) -- 0:00:22
628000 -- (-1036.303) (-1034.605) (-1035.055) [-1036.782] * (-1034.948) (-1035.958) [-1036.383] (-1035.256) -- 0:00:22
628500 -- (-1037.350) (-1034.244) (-1036.040) [-1036.226] * (-1035.201) (-1035.900) (-1038.008) [-1037.385] -- 0:00:22
629000 -- [-1033.911] (-1036.225) (-1034.035) (-1034.835) * (-1034.733) (-1034.885) (-1036.396) [-1038.238] -- 0:00:22
629500 -- (-1034.515) (-1034.217) [-1034.173] (-1034.852) * (-1039.659) (-1036.598) [-1036.573] (-1036.462) -- 0:00:22
630000 -- (-1035.135) (-1034.464) [-1033.838] (-1037.474) * [-1035.782] (-1037.719) (-1034.402) (-1034.954) -- 0:00:22
Average standard deviation of split frequencies: 0.009409
630500 -- (-1037.459) [-1035.577] (-1036.322) (-1043.658) * (-1037.800) (-1038.490) (-1033.894) [-1033.463] -- 0:00:22
631000 -- (-1035.711) [-1039.336] (-1035.813) (-1036.925) * (-1039.985) [-1037.744] (-1034.509) (-1033.540) -- 0:00:22
631500 -- (-1037.174) (-1035.236) [-1034.475] (-1035.850) * (-1041.885) [-1036.438] (-1039.917) (-1034.097) -- 0:00:22
632000 -- (-1035.208) (-1034.420) [-1034.410] (-1037.095) * (-1036.416) (-1036.412) [-1038.453] (-1034.622) -- 0:00:22
632500 -- (-1034.910) (-1035.067) [-1035.962] (-1037.131) * (-1035.139) (-1036.199) (-1034.501) [-1035.658] -- 0:00:22
633000 -- [-1035.909] (-1036.689) (-1036.465) (-1034.334) * (-1036.546) [-1036.994] (-1042.002) (-1035.536) -- 0:00:22
633500 -- (-1034.563) (-1041.223) (-1034.446) [-1034.847] * (-1036.087) (-1036.202) [-1035.644] (-1036.584) -- 0:00:21
634000 -- (-1036.955) (-1035.213) (-1035.961) [-1034.025] * (-1035.291) [-1035.324] (-1035.933) (-1036.191) -- 0:00:21
634500 -- [-1034.408] (-1034.247) (-1038.408) (-1037.746) * (-1034.282) [-1034.580] (-1036.958) (-1036.788) -- 0:00:21
635000 -- (-1036.738) (-1034.286) [-1036.146] (-1038.923) * (-1036.159) (-1036.294) [-1035.641] (-1037.719) -- 0:00:21
Average standard deviation of split frequencies: 0.008676
635500 -- (-1037.225) (-1040.110) (-1039.632) [-1034.381] * (-1034.249) (-1035.801) (-1037.670) [-1036.418] -- 0:00:21
636000 -- (-1039.847) (-1038.373) (-1036.066) [-1034.705] * (-1033.634) (-1036.429) [-1037.696] (-1033.944) -- 0:00:21
636500 -- [-1039.079] (-1038.101) (-1039.831) (-1035.218) * [-1037.695] (-1036.633) (-1036.698) (-1037.116) -- 0:00:21
637000 -- [-1036.898] (-1042.802) (-1038.896) (-1035.010) * (-1038.333) (-1038.362) (-1036.086) [-1038.221] -- 0:00:21
637500 -- (-1035.983) (-1034.928) (-1034.341) [-1038.472] * (-1038.156) (-1037.481) (-1035.222) [-1033.663] -- 0:00:21
638000 -- (-1037.509) (-1036.138) [-1034.237] (-1039.412) * [-1040.545] (-1041.173) (-1035.379) (-1034.819) -- 0:00:21
638500 -- (-1037.554) (-1036.064) [-1040.996] (-1034.458) * (-1038.812) (-1035.908) (-1035.918) [-1035.585] -- 0:00:21
639000 -- (-1035.666) (-1035.292) (-1035.656) [-1034.688] * (-1034.992) [-1035.286] (-1038.141) (-1035.728) -- 0:00:21
639500 -- (-1035.407) (-1035.055) [-1033.998] (-1036.091) * (-1034.543) (-1036.585) (-1036.896) [-1038.119] -- 0:00:21
640000 -- (-1035.554) (-1035.903) (-1035.205) [-1038.364] * (-1040.627) [-1034.590] (-1039.823) (-1037.687) -- 0:00:21
Average standard deviation of split frequencies: 0.009219
640500 -- (-1035.065) (-1035.639) [-1035.937] (-1042.084) * (-1035.586) (-1040.600) (-1035.114) [-1035.965] -- 0:00:21
641000 -- (-1035.480) (-1034.558) (-1039.677) [-1038.098] * (-1040.313) (-1035.772) [-1033.992] (-1035.643) -- 0:00:21
641500 -- (-1033.905) (-1034.580) [-1035.262] (-1038.122) * [-1037.651] (-1035.383) (-1034.272) (-1036.389) -- 0:00:21
642000 -- [-1035.299] (-1034.584) (-1037.521) (-1034.843) * [-1036.944] (-1036.790) (-1037.975) (-1038.085) -- 0:00:21
642500 -- (-1035.796) (-1036.218) [-1034.278] (-1034.409) * [-1034.414] (-1038.437) (-1036.505) (-1038.514) -- 0:00:21
643000 -- (-1035.091) (-1038.316) [-1037.493] (-1034.208) * [-1033.943] (-1037.521) (-1036.141) (-1036.245) -- 0:00:21
643500 -- (-1034.131) [-1037.827] (-1035.121) (-1034.352) * (-1035.801) [-1036.649] (-1036.774) (-1036.814) -- 0:00:21
644000 -- [-1034.689] (-1035.089) (-1034.189) (-1036.196) * (-1036.023) [-1034.665] (-1036.733) (-1038.563) -- 0:00:21
644500 -- (-1037.338) (-1036.497) [-1034.106] (-1034.798) * (-1037.647) (-1035.037) [-1035.741] (-1039.105) -- 0:00:21
645000 -- (-1040.182) (-1035.853) [-1035.862] (-1034.523) * (-1036.111) (-1036.906) [-1034.876] (-1034.478) -- 0:00:21
Average standard deviation of split frequencies: 0.009057
645500 -- (-1035.232) [-1034.705] (-1036.510) (-1036.052) * (-1035.748) [-1036.456] (-1035.570) (-1035.877) -- 0:00:21
646000 -- [-1038.079] (-1034.466) (-1035.783) (-1036.654) * (-1038.133) (-1035.117) [-1033.968] (-1035.390) -- 0:00:21
646500 -- (-1034.182) [-1035.717] (-1036.416) (-1039.233) * (-1036.316) (-1033.856) [-1035.132] (-1036.709) -- 0:00:21
647000 -- (-1035.794) [-1040.401] (-1037.852) (-1038.018) * (-1040.166) (-1034.907) [-1037.559] (-1037.811) -- 0:00:21
647500 -- (-1034.706) (-1037.439) [-1034.856] (-1034.712) * (-1034.163) (-1035.252) [-1036.919] (-1037.078) -- 0:00:21
648000 -- (-1036.506) (-1036.002) (-1034.568) [-1034.560] * (-1034.010) (-1036.888) (-1042.624) [-1034.550] -- 0:00:21
648500 -- (-1037.700) [-1034.061] (-1037.171) (-1036.467) * (-1039.061) [-1034.886] (-1035.833) (-1035.155) -- 0:00:21
649000 -- [-1036.678] (-1038.486) (-1042.373) (-1038.340) * (-1034.298) (-1036.515) [-1035.644] (-1040.325) -- 0:00:21
649500 -- (-1038.875) [-1039.507] (-1036.726) (-1036.996) * (-1034.393) (-1035.477) (-1035.741) [-1038.415] -- 0:00:21
650000 -- (-1039.137) (-1034.977) (-1035.358) [-1035.106] * [-1036.793] (-1034.917) (-1036.789) (-1036.359) -- 0:00:21
Average standard deviation of split frequencies: 0.009163
650500 -- (-1035.050) [-1034.258] (-1035.716) (-1041.065) * [-1034.477] (-1035.634) (-1035.458) (-1037.495) -- 0:00:20
651000 -- (-1034.848) (-1041.150) (-1034.863) [-1038.583] * (-1034.854) [-1033.922] (-1036.480) (-1035.353) -- 0:00:20
651500 -- (-1034.848) (-1034.659) (-1037.093) [-1034.842] * (-1036.278) (-1034.777) (-1037.002) [-1035.447] -- 0:00:20
652000 -- [-1034.828] (-1035.465) (-1037.774) (-1035.052) * [-1035.205] (-1037.055) (-1036.658) (-1036.634) -- 0:00:20
652500 -- [-1035.330] (-1035.413) (-1037.235) (-1034.070) * (-1034.780) (-1036.669) (-1036.988) [-1036.412] -- 0:00:20
653000 -- (-1036.154) (-1035.002) (-1035.460) [-1034.663] * (-1035.623) (-1036.559) [-1035.104] (-1035.771) -- 0:00:20
653500 -- (-1036.259) [-1034.603] (-1034.860) (-1034.537) * [-1038.946] (-1036.759) (-1036.629) (-1036.788) -- 0:00:20
654000 -- (-1034.028) [-1035.120] (-1035.273) (-1034.776) * [-1039.792] (-1036.297) (-1039.649) (-1037.177) -- 0:00:20
654500 -- (-1034.315) (-1035.661) (-1034.985) [-1034.395] * (-1036.453) [-1035.517] (-1038.271) (-1035.105) -- 0:00:20
655000 -- [-1033.978] (-1036.806) (-1034.700) (-1035.064) * [-1034.065] (-1038.028) (-1037.831) (-1033.912) -- 0:00:20
Average standard deviation of split frequencies: 0.009046
655500 -- (-1034.880) (-1036.032) [-1036.553] (-1035.380) * (-1034.338) (-1036.025) (-1038.518) [-1033.889] -- 0:00:21
656000 -- [-1035.586] (-1037.239) (-1035.295) (-1033.978) * (-1034.538) (-1033.624) [-1035.209] (-1034.047) -- 0:00:20
656500 -- [-1034.230] (-1037.606) (-1033.981) (-1034.303) * (-1035.390) (-1034.043) [-1035.332] (-1034.238) -- 0:00:20
657000 -- (-1034.765) (-1037.044) [-1034.246] (-1034.972) * [-1034.191] (-1036.308) (-1035.357) (-1033.890) -- 0:00:20
657500 -- [-1036.915] (-1036.528) (-1035.922) (-1034.967) * (-1034.465) (-1035.079) (-1036.450) [-1035.892] -- 0:00:20
658000 -- (-1036.085) (-1037.630) (-1037.614) [-1035.642] * (-1036.574) [-1035.175] (-1035.563) (-1034.252) -- 0:00:20
658500 -- (-1035.374) [-1036.286] (-1035.210) (-1037.112) * [-1036.094] (-1035.830) (-1034.621) (-1034.684) -- 0:00:20
659000 -- (-1035.097) (-1034.527) (-1037.019) [-1036.536] * [-1037.035] (-1041.120) (-1034.905) (-1034.438) -- 0:00:20
659500 -- (-1036.910) (-1035.287) (-1035.982) [-1035.062] * (-1038.256) [-1034.765] (-1035.852) (-1035.222) -- 0:00:20
660000 -- (-1034.863) [-1035.153] (-1033.895) (-1036.272) * [-1034.244] (-1035.494) (-1034.254) (-1038.181) -- 0:00:20
Average standard deviation of split frequencies: 0.009444
660500 -- (-1034.585) (-1034.900) [-1033.831] (-1037.052) * [-1035.798] (-1034.557) (-1036.773) (-1036.590) -- 0:00:20
661000 -- [-1034.585] (-1033.863) (-1034.537) (-1034.269) * (-1037.804) [-1039.305] (-1037.352) (-1036.963) -- 0:00:20
661500 -- (-1035.523) (-1038.344) (-1038.989) [-1034.179] * (-1035.754) (-1035.846) [-1035.400] (-1035.035) -- 0:00:20
662000 -- (-1036.993) (-1036.191) [-1034.315] (-1035.198) * [-1036.793] (-1035.636) (-1035.306) (-1034.256) -- 0:00:20
662500 -- (-1034.908) [-1033.350] (-1039.642) (-1036.277) * [-1037.637] (-1037.679) (-1040.118) (-1034.256) -- 0:00:20
663000 -- (-1035.416) (-1034.509) [-1035.738] (-1036.999) * (-1040.854) (-1035.768) [-1037.620] (-1037.757) -- 0:00:20
663500 -- (-1035.567) [-1034.323] (-1035.952) (-1035.065) * (-1034.543) (-1037.653) (-1039.803) [-1036.772] -- 0:00:20
664000 -- [-1036.444] (-1038.497) (-1037.434) (-1038.670) * [-1034.274] (-1035.535) (-1035.010) (-1037.596) -- 0:00:20
664500 -- [-1037.136] (-1034.753) (-1034.173) (-1039.902) * (-1035.382) (-1036.608) [-1034.781] (-1035.814) -- 0:00:20
665000 -- [-1036.191] (-1038.799) (-1039.263) (-1034.236) * (-1038.865) [-1035.254] (-1034.315) (-1034.873) -- 0:00:20
Average standard deviation of split frequencies: 0.009909
665500 -- [-1037.663] (-1037.253) (-1034.500) (-1034.312) * (-1040.935) (-1040.000) [-1034.792] (-1035.001) -- 0:00:20
666000 -- (-1034.338) (-1041.844) (-1036.459) [-1036.106] * [-1035.744] (-1034.709) (-1035.978) (-1035.169) -- 0:00:20
666500 -- [-1036.647] (-1040.752) (-1033.859) (-1036.835) * (-1037.058) [-1037.630] (-1035.497) (-1035.659) -- 0:00:20
667000 -- (-1035.347) [-1035.433] (-1036.107) (-1039.736) * (-1037.402) (-1037.476) (-1034.454) [-1035.821] -- 0:00:19
667500 -- (-1035.048) (-1036.474) (-1033.748) [-1035.341] * (-1035.896) (-1034.549) (-1037.659) [-1034.359] -- 0:00:19
668000 -- (-1034.887) (-1035.805) (-1034.323) [-1034.637] * (-1034.680) (-1035.252) (-1045.644) [-1036.108] -- 0:00:19
668500 -- (-1035.650) (-1037.509) (-1035.380) [-1034.454] * [-1034.594] (-1034.423) (-1037.068) (-1034.585) -- 0:00:19
669000 -- (-1035.568) (-1034.083) (-1036.976) [-1034.713] * (-1034.618) (-1036.339) [-1034.409] (-1035.561) -- 0:00:19
669500 -- [-1035.348] (-1034.982) (-1035.339) (-1033.873) * (-1033.760) (-1033.894) [-1034.859] (-1034.297) -- 0:00:19
670000 -- [-1035.521] (-1034.506) (-1034.196) (-1034.138) * (-1036.126) (-1037.086) (-1035.775) [-1035.280] -- 0:00:19
Average standard deviation of split frequencies: 0.010006
670500 -- [-1037.567] (-1034.532) (-1037.272) (-1033.883) * (-1035.137) (-1034.669) (-1038.723) [-1035.497] -- 0:00:19
671000 -- (-1034.710) (-1034.802) (-1037.741) [-1034.339] * (-1034.908) (-1034.298) [-1037.023] (-1034.930) -- 0:00:19
671500 -- (-1034.445) (-1033.740) [-1035.556] (-1039.625) * [-1034.680] (-1039.272) (-1037.836) (-1035.488) -- 0:00:20
672000 -- (-1043.821) [-1038.291] (-1038.661) (-1035.208) * (-1035.469) [-1036.751] (-1035.698) (-1035.848) -- 0:00:20
672500 -- (-1039.508) (-1038.043) [-1034.832] (-1042.501) * [-1037.354] (-1037.923) (-1036.035) (-1037.808) -- 0:00:19
673000 -- [-1034.243] (-1038.095) (-1044.767) (-1036.246) * (-1042.755) [-1034.836] (-1034.364) (-1034.300) -- 0:00:19
673500 -- (-1033.658) (-1035.115) [-1034.191] (-1037.204) * [-1035.959] (-1036.476) (-1034.656) (-1039.276) -- 0:00:19
674000 -- (-1033.932) (-1036.161) [-1035.804] (-1037.903) * (-1034.596) (-1035.251) [-1039.072] (-1035.807) -- 0:00:19
674500 -- (-1034.063) (-1035.438) [-1036.144] (-1034.305) * [-1036.584] (-1035.667) (-1038.440) (-1036.804) -- 0:00:19
675000 -- (-1036.159) (-1035.398) (-1035.991) [-1033.893] * (-1040.259) (-1035.611) [-1039.901] (-1037.571) -- 0:00:19
Average standard deviation of split frequencies: 0.010173
675500 -- (-1035.307) (-1036.399) [-1037.069] (-1034.344) * [-1036.011] (-1038.278) (-1033.652) (-1039.500) -- 0:00:19
676000 -- (-1040.174) (-1033.774) (-1039.888) [-1038.593] * [-1036.568] (-1035.634) (-1036.927) (-1033.542) -- 0:00:19
676500 -- [-1035.459] (-1033.801) (-1039.483) (-1035.845) * (-1037.596) (-1036.571) (-1038.998) [-1035.047] -- 0:00:19
677000 -- (-1040.738) [-1033.809] (-1036.857) (-1034.676) * (-1036.990) [-1034.212] (-1036.710) (-1035.197) -- 0:00:19
677500 -- (-1034.125) (-1033.721) (-1035.591) [-1037.960] * [-1036.132] (-1036.080) (-1034.425) (-1036.048) -- 0:00:19
678000 -- (-1035.239) (-1033.668) (-1035.017) [-1034.682] * (-1034.129) (-1035.277) (-1035.228) [-1034.153] -- 0:00:19
678500 -- (-1036.278) (-1035.971) (-1034.298) [-1034.775] * (-1033.477) (-1037.587) (-1037.997) [-1034.699] -- 0:00:19
679000 -- [-1038.503] (-1034.733) (-1034.216) (-1037.936) * (-1033.394) (-1037.443) (-1038.087) [-1034.140] -- 0:00:19
679500 -- (-1037.583) (-1035.382) [-1035.401] (-1036.514) * [-1034.177] (-1034.061) (-1035.085) (-1035.887) -- 0:00:19
680000 -- (-1036.983) (-1035.900) [-1036.137] (-1035.842) * (-1033.625) (-1036.898) [-1036.525] (-1037.870) -- 0:00:19
Average standard deviation of split frequencies: 0.009981
680500 -- [-1035.000] (-1037.116) (-1038.496) (-1041.782) * (-1035.595) (-1036.414) (-1037.799) [-1038.175] -- 0:00:19
681000 -- (-1034.757) [-1035.908] (-1037.787) (-1039.402) * (-1038.359) [-1036.800] (-1037.815) (-1033.697) -- 0:00:19
681500 -- (-1034.542) [-1034.142] (-1035.495) (-1040.185) * (-1037.105) (-1036.971) [-1037.337] (-1033.794) -- 0:00:19
682000 -- [-1036.642] (-1036.165) (-1037.362) (-1037.365) * (-1034.724) (-1035.433) (-1035.004) [-1034.746] -- 0:00:19
682500 -- (-1036.812) [-1035.627] (-1035.199) (-1033.597) * [-1034.511] (-1038.750) (-1036.270) (-1035.927) -- 0:00:19
683000 -- (-1035.408) [-1035.910] (-1034.900) (-1037.905) * (-1035.919) (-1036.742) (-1035.489) [-1033.784] -- 0:00:19
683500 -- (-1035.443) (-1034.485) [-1034.785] (-1041.747) * (-1035.168) [-1035.288] (-1034.589) (-1034.113) -- 0:00:18
684000 -- [-1037.926] (-1038.359) (-1038.192) (-1041.095) * (-1038.555) [-1039.812] (-1036.550) (-1034.174) -- 0:00:18
684500 -- (-1036.160) (-1036.668) (-1036.066) [-1035.241] * [-1035.739] (-1036.168) (-1036.600) (-1035.384) -- 0:00:18
685000 -- (-1041.661) (-1035.732) [-1034.891] (-1036.831) * (-1037.839) (-1033.731) [-1035.157] (-1034.933) -- 0:00:18
Average standard deviation of split frequencies: 0.010591
685500 -- (-1035.462) (-1036.061) (-1034.017) [-1036.093] * (-1034.845) [-1034.535] (-1035.807) (-1036.004) -- 0:00:18
686000 -- (-1036.338) (-1034.683) (-1036.686) [-1033.864] * [-1034.016] (-1034.227) (-1035.690) (-1038.424) -- 0:00:18
686500 -- (-1036.783) (-1037.808) [-1037.052] (-1038.188) * (-1035.141) (-1034.050) [-1035.068] (-1037.190) -- 0:00:18
687000 -- (-1040.654) [-1033.622] (-1034.040) (-1036.485) * (-1034.032) (-1035.742) [-1039.058] (-1038.547) -- 0:00:18
687500 -- (-1035.109) [-1035.902] (-1034.902) (-1037.543) * (-1034.746) (-1034.631) [-1037.483] (-1036.137) -- 0:00:18
688000 -- (-1037.328) (-1034.278) (-1037.275) [-1035.354] * (-1037.649) [-1033.795] (-1036.402) (-1036.600) -- 0:00:19
688500 -- (-1033.507) (-1035.944) (-1036.260) [-1038.196] * (-1035.470) (-1033.788) [-1036.180] (-1034.706) -- 0:00:19
689000 -- (-1034.454) (-1040.060) (-1038.118) [-1033.963] * (-1035.013) (-1035.436) (-1034.922) [-1034.022] -- 0:00:18
689500 -- (-1035.582) [-1038.698] (-1035.196) (-1034.089) * (-1034.131) (-1037.102) (-1034.987) [-1034.449] -- 0:00:18
690000 -- (-1035.799) (-1037.638) (-1034.340) [-1036.177] * [-1035.401] (-1034.889) (-1034.022) (-1034.774) -- 0:00:18
Average standard deviation of split frequencies: 0.010599
690500 -- (-1034.777) (-1034.709) [-1036.422] (-1037.432) * [-1034.120] (-1036.311) (-1036.699) (-1034.650) -- 0:00:18
691000 -- (-1036.246) [-1037.106] (-1035.062) (-1036.348) * [-1037.889] (-1034.814) (-1038.077) (-1035.783) -- 0:00:18
691500 -- (-1037.409) [-1035.872] (-1034.310) (-1036.248) * (-1038.247) (-1037.827) [-1036.109] (-1037.724) -- 0:00:18
692000 -- (-1034.604) (-1036.268) (-1034.434) [-1033.870] * (-1035.899) (-1035.936) [-1035.640] (-1035.597) -- 0:00:18
692500 -- (-1036.116) (-1035.205) (-1035.359) [-1033.708] * (-1042.083) (-1035.335) [-1034.745] (-1038.509) -- 0:00:18
693000 -- (-1037.562) (-1039.111) (-1035.747) [-1033.942] * (-1034.518) [-1035.719] (-1035.655) (-1036.548) -- 0:00:18
693500 -- (-1035.473) (-1039.718) [-1036.354] (-1034.328) * (-1034.640) [-1033.902] (-1036.052) (-1035.967) -- 0:00:18
694000 -- [-1035.901] (-1038.566) (-1034.724) (-1037.025) * [-1034.624] (-1035.547) (-1035.793) (-1033.947) -- 0:00:18
694500 -- (-1035.060) [-1035.035] (-1038.129) (-1036.339) * (-1038.497) [-1034.446] (-1037.415) (-1035.241) -- 0:00:18
695000 -- (-1035.142) (-1037.855) [-1036.527] (-1035.012) * (-1034.772) (-1034.369) [-1037.404] (-1034.967) -- 0:00:18
Average standard deviation of split frequencies: 0.009721
695500 -- [-1035.737] (-1036.253) (-1035.676) (-1035.920) * [-1034.115] (-1035.605) (-1035.984) (-1034.523) -- 0:00:18
696000 -- [-1037.147] (-1036.922) (-1034.214) (-1035.936) * (-1034.993) [-1034.160] (-1041.301) (-1034.022) -- 0:00:18
696500 -- (-1036.084) (-1037.737) [-1034.925] (-1038.135) * (-1034.070) [-1034.918] (-1039.119) (-1037.226) -- 0:00:18
697000 -- (-1036.842) (-1036.908) [-1035.336] (-1035.283) * (-1035.360) (-1035.698) (-1035.457) [-1037.636] -- 0:00:18
697500 -- (-1036.624) (-1035.816) (-1036.508) [-1036.033] * (-1034.834) (-1034.205) [-1035.769] (-1036.167) -- 0:00:18
698000 -- (-1034.747) (-1036.128) (-1037.785) [-1035.418] * (-1037.184) (-1036.343) [-1035.176] (-1041.636) -- 0:00:18
698500 -- (-1035.680) (-1034.721) (-1034.483) [-1034.382] * [-1034.087] (-1035.501) (-1036.581) (-1039.723) -- 0:00:18
699000 -- (-1035.134) (-1036.525) [-1034.613] (-1035.121) * (-1033.710) (-1035.797) [-1039.149] (-1037.697) -- 0:00:18
699500 -- (-1035.538) [-1035.022] (-1035.111) (-1034.235) * (-1033.525) [-1034.392] (-1035.601) (-1036.505) -- 0:00:18
700000 -- [-1035.444] (-1036.900) (-1034.435) (-1034.692) * (-1036.826) (-1035.473) (-1035.029) [-1034.600] -- 0:00:18
Average standard deviation of split frequencies: 0.010681
700500 -- (-1036.696) [-1035.899] (-1034.120) (-1034.263) * (-1035.785) (-1036.691) (-1034.285) [-1035.061] -- 0:00:17
701000 -- (-1035.651) [-1034.484] (-1034.252) (-1034.510) * [-1035.553] (-1036.968) (-1034.810) (-1036.403) -- 0:00:17
701500 -- [-1035.450] (-1036.754) (-1036.254) (-1034.336) * (-1034.137) (-1037.780) (-1034.373) [-1035.001] -- 0:00:17
702000 -- (-1034.052) (-1034.597) (-1034.736) [-1034.373] * (-1034.357) (-1034.207) (-1039.299) [-1037.222] -- 0:00:17
702500 -- (-1034.357) [-1037.910] (-1034.601) (-1035.485) * (-1035.946) (-1034.302) [-1039.381] (-1036.078) -- 0:00:17
703000 -- (-1035.432) (-1033.782) [-1034.601] (-1036.183) * (-1034.597) [-1035.330] (-1036.384) (-1036.146) -- 0:00:17
703500 -- (-1039.577) [-1034.125] (-1038.524) (-1039.241) * (-1036.114) (-1035.094) (-1036.098) [-1037.322] -- 0:00:17
704000 -- (-1037.311) [-1036.481] (-1034.518) (-1034.704) * (-1038.109) (-1034.579) [-1035.858] (-1034.825) -- 0:00:18
704500 -- (-1036.779) [-1037.345] (-1036.246) (-1035.947) * (-1035.345) (-1035.719) [-1033.561] (-1036.806) -- 0:00:18
705000 -- [-1036.305] (-1035.603) (-1034.897) (-1034.853) * (-1034.221) [-1034.772] (-1034.837) (-1038.705) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
705500 -- [-1034.639] (-1034.229) (-1037.710) (-1034.258) * (-1040.223) (-1039.787) [-1034.348] (-1040.941) -- 0:00:17
706000 -- [-1034.819] (-1034.933) (-1034.834) (-1035.429) * (-1036.936) (-1036.752) [-1035.047] (-1039.573) -- 0:00:17
706500 -- [-1035.735] (-1035.196) (-1035.356) (-1035.506) * (-1034.788) (-1037.120) (-1033.869) [-1043.864] -- 0:00:17
707000 -- [-1034.706] (-1034.946) (-1036.003) (-1035.269) * (-1041.912) [-1033.525] (-1036.155) (-1034.968) -- 0:00:17
707500 -- (-1034.837) (-1035.554) (-1034.678) [-1035.843] * (-1042.039) [-1035.330] (-1034.144) (-1035.635) -- 0:00:17
708000 -- [-1036.348] (-1035.965) (-1035.567) (-1038.724) * (-1033.573) (-1035.022) [-1036.905] (-1035.075) -- 0:00:17
708500 -- [-1037.809] (-1038.076) (-1037.903) (-1040.116) * (-1039.350) (-1039.699) [-1037.115] (-1036.514) -- 0:00:17
709000 -- (-1034.877) (-1038.978) [-1041.403] (-1036.282) * (-1038.275) (-1037.632) (-1036.912) [-1034.548] -- 0:00:17
709500 -- (-1034.694) (-1036.294) [-1035.614] (-1035.140) * (-1036.347) (-1035.228) (-1035.779) [-1036.237] -- 0:00:17
710000 -- (-1035.154) (-1036.181) [-1034.798] (-1042.402) * (-1039.288) (-1036.175) (-1036.027) [-1037.257] -- 0:00:17
Average standard deviation of split frequencies: 0.009911
710500 -- (-1042.935) (-1036.401) [-1033.948] (-1040.248) * (-1035.309) (-1037.232) [-1040.620] (-1042.164) -- 0:00:17
711000 -- (-1035.973) (-1035.656) [-1036.467] (-1040.309) * (-1034.620) [-1035.775] (-1034.144) (-1037.316) -- 0:00:17
711500 -- [-1034.924] (-1037.104) (-1036.925) (-1035.601) * (-1033.482) [-1036.056] (-1034.335) (-1037.828) -- 0:00:17
712000 -- [-1034.725] (-1039.688) (-1036.678) (-1037.975) * (-1035.456) (-1035.021) (-1036.923) [-1036.711] -- 0:00:17
712500 -- [-1033.837] (-1035.127) (-1035.044) (-1036.529) * (-1035.679) [-1035.956] (-1034.450) (-1036.806) -- 0:00:17
713000 -- (-1035.973) [-1034.770] (-1034.411) (-1035.304) * [-1036.530] (-1035.755) (-1036.508) (-1035.171) -- 0:00:17
713500 -- (-1035.530) (-1035.475) [-1036.554] (-1035.722) * (-1035.388) [-1035.009] (-1035.123) (-1038.085) -- 0:00:17
714000 -- (-1034.997) (-1034.608) [-1036.129] (-1035.893) * [-1035.339] (-1036.750) (-1035.177) (-1038.385) -- 0:00:17
714500 -- (-1034.995) (-1034.326) (-1041.936) [-1036.709] * (-1035.196) (-1041.702) [-1035.774] (-1038.333) -- 0:00:17
715000 -- (-1037.445) [-1034.700] (-1035.021) (-1037.248) * (-1035.712) (-1036.321) (-1035.023) [-1034.718] -- 0:00:17
Average standard deviation of split frequencies: 0.010452
715500 -- (-1034.851) [-1035.849] (-1034.818) (-1036.476) * (-1035.754) [-1034.231] (-1039.939) (-1035.210) -- 0:00:17
716000 -- (-1035.296) [-1037.415] (-1041.568) (-1033.825) * (-1036.783) (-1033.594) (-1035.329) [-1040.017] -- 0:00:17
716500 -- (-1034.413) [-1038.339] (-1034.786) (-1036.554) * (-1035.328) (-1034.353) (-1034.382) [-1035.106] -- 0:00:17
717000 -- [-1034.830] (-1033.802) (-1036.013) (-1034.037) * (-1036.385) (-1034.007) [-1036.343] (-1035.276) -- 0:00:16
717500 -- (-1034.453) (-1037.782) (-1036.772) [-1034.327] * (-1035.031) [-1033.454] (-1039.834) (-1037.067) -- 0:00:16
718000 -- (-1034.881) (-1037.892) (-1035.353) [-1033.534] * [-1035.557] (-1042.395) (-1034.074) (-1033.926) -- 0:00:16
718500 -- [-1037.742] (-1038.180) (-1034.965) (-1034.096) * (-1033.637) (-1035.547) (-1035.541) [-1035.349] -- 0:00:16
719000 -- (-1034.833) (-1039.416) [-1033.686] (-1034.670) * [-1034.364] (-1038.081) (-1039.767) (-1037.462) -- 0:00:16
719500 -- [-1034.726] (-1038.991) (-1035.489) (-1036.540) * (-1034.789) (-1035.896) (-1035.559) [-1035.681] -- 0:00:16
720000 -- [-1035.700] (-1034.700) (-1034.205) (-1036.586) * (-1036.192) [-1038.543] (-1036.550) (-1037.567) -- 0:00:16
Average standard deviation of split frequencies: 0.010425
720500 -- [-1035.002] (-1036.182) (-1036.543) (-1039.785) * (-1035.591) (-1035.134) [-1039.264] (-1035.280) -- 0:00:17
721000 -- (-1035.882) (-1036.470) [-1037.023] (-1036.806) * [-1034.590] (-1036.472) (-1033.659) (-1036.475) -- 0:00:17
721500 -- (-1037.765) (-1035.200) [-1035.040] (-1036.806) * [-1033.639] (-1036.669) (-1034.611) (-1037.114) -- 0:00:16
722000 -- [-1035.824] (-1033.779) (-1034.938) (-1034.633) * (-1034.068) (-1036.679) (-1036.655) [-1035.111] -- 0:00:16
722500 -- (-1035.146) [-1034.600] (-1034.425) (-1037.043) * (-1034.287) [-1036.845] (-1035.606) (-1035.920) -- 0:00:16
723000 -- (-1034.730) (-1034.753) (-1034.954) [-1034.086] * (-1033.717) (-1034.605) [-1035.127] (-1037.559) -- 0:00:16
723500 -- (-1039.053) [-1038.493] (-1036.959) (-1036.305) * (-1034.631) (-1034.103) (-1037.040) [-1035.864] -- 0:00:16
724000 -- (-1034.931) (-1038.145) [-1035.078] (-1037.825) * (-1035.244) (-1035.421) [-1035.433] (-1037.045) -- 0:00:16
724500 -- (-1036.076) (-1034.174) (-1035.521) [-1036.741] * (-1036.576) [-1035.151] (-1034.228) (-1035.315) -- 0:00:16
725000 -- (-1035.461) (-1034.969) [-1035.589] (-1035.835) * [-1034.897] (-1033.711) (-1035.198) (-1034.652) -- 0:00:16
Average standard deviation of split frequencies: 0.010430
725500 -- [-1037.288] (-1035.761) (-1035.331) (-1035.397) * [-1034.549] (-1036.112) (-1035.314) (-1036.078) -- 0:00:16
726000 -- (-1035.899) (-1035.243) [-1034.460] (-1035.100) * (-1034.774) (-1034.638) [-1036.277] (-1037.928) -- 0:00:16
726500 -- (-1036.901) (-1034.010) (-1036.821) [-1037.386] * (-1036.676) [-1038.143] (-1035.007) (-1037.921) -- 0:00:16
727000 -- (-1036.577) [-1035.361] (-1034.402) (-1037.604) * [-1035.408] (-1036.226) (-1034.873) (-1034.593) -- 0:00:16
727500 -- (-1036.745) [-1034.387] (-1035.502) (-1037.760) * (-1037.898) (-1034.943) (-1035.600) [-1034.666] -- 0:00:16
728000 -- (-1041.511) (-1036.275) [-1037.314] (-1036.129) * (-1034.047) [-1034.426] (-1035.896) (-1034.706) -- 0:00:16
728500 -- (-1039.519) [-1034.997] (-1035.996) (-1038.953) * (-1037.643) [-1035.115] (-1038.587) (-1037.066) -- 0:00:16
729000 -- (-1033.743) [-1035.620] (-1037.116) (-1036.900) * [-1035.951] (-1035.090) (-1035.772) (-1037.717) -- 0:00:16
729500 -- [-1035.319] (-1038.411) (-1034.500) (-1036.225) * [-1035.939] (-1034.244) (-1038.838) (-1035.338) -- 0:00:16
730000 -- (-1034.773) (-1034.582) (-1036.768) [-1033.938] * (-1036.131) (-1035.905) [-1035.915] (-1037.053) -- 0:00:16
Average standard deviation of split frequencies: 0.010081
730500 -- (-1034.341) [-1034.474] (-1035.641) (-1035.499) * (-1034.154) (-1034.734) [-1035.098] (-1039.037) -- 0:00:16
731000 -- (-1034.529) (-1042.161) [-1038.389] (-1036.780) * (-1033.605) (-1035.031) [-1037.061] (-1035.173) -- 0:00:16
731500 -- [-1034.347] (-1035.403) (-1036.002) (-1037.603) * (-1034.556) [-1035.130] (-1034.797) (-1034.657) -- 0:00:16
732000 -- (-1034.854) (-1035.753) (-1036.063) [-1038.423] * (-1034.325) [-1035.141] (-1034.685) (-1033.799) -- 0:00:16
732500 -- [-1035.311] (-1035.063) (-1034.965) (-1036.590) * (-1035.900) (-1034.260) [-1035.019] (-1035.529) -- 0:00:16
733000 -- [-1035.603] (-1037.702) (-1041.120) (-1034.735) * [-1037.231] (-1034.663) (-1034.613) (-1036.218) -- 0:00:16
733500 -- (-1036.693) (-1034.039) (-1038.851) [-1034.245] * (-1036.463) (-1038.504) [-1034.521] (-1034.736) -- 0:00:15
734000 -- (-1036.195) (-1037.274) [-1035.472] (-1033.707) * (-1036.493) (-1036.017) [-1035.080] (-1038.099) -- 0:00:15
734500 -- (-1036.406) (-1036.294) (-1036.075) [-1037.708] * (-1037.503) [-1036.846] (-1034.723) (-1035.401) -- 0:00:15
735000 -- (-1035.593) (-1036.376) [-1036.323] (-1035.568) * [-1035.777] (-1036.289) (-1036.400) (-1035.142) -- 0:00:15
Average standard deviation of split frequencies: 0.009808
735500 -- (-1035.257) [-1036.185] (-1036.424) (-1042.069) * (-1035.106) [-1035.716] (-1035.244) (-1036.702) -- 0:00:15
736000 -- (-1038.335) (-1039.158) [-1036.181] (-1036.980) * (-1034.171) (-1035.810) [-1034.250] (-1035.485) -- 0:00:15
736500 -- (-1037.376) (-1034.009) [-1035.511] (-1034.487) * (-1034.765) (-1035.903) [-1038.478] (-1037.832) -- 0:00:15
737000 -- [-1034.203] (-1034.316) (-1034.845) (-1035.278) * (-1037.996) [-1036.055] (-1036.369) (-1036.319) -- 0:00:16
737500 -- (-1034.343) (-1034.316) (-1034.537) [-1034.396] * (-1039.239) (-1038.374) (-1034.178) [-1037.268] -- 0:00:16
738000 -- [-1033.880] (-1034.647) (-1035.809) (-1034.024) * (-1035.697) (-1036.505) [-1035.410] (-1035.894) -- 0:00:15
738500 -- (-1036.516) (-1034.015) [-1034.753] (-1033.876) * (-1038.264) [-1034.852] (-1035.421) (-1035.520) -- 0:00:15
739000 -- (-1034.196) (-1034.924) [-1037.244] (-1034.313) * (-1035.349) (-1034.035) [-1033.671] (-1038.581) -- 0:00:15
739500 -- (-1037.714) [-1033.831] (-1041.075) (-1035.301) * [-1034.442] (-1034.381) (-1034.219) (-1038.267) -- 0:00:15
740000 -- (-1035.256) [-1035.080] (-1037.106) (-1035.191) * (-1035.113) (-1034.825) [-1036.888] (-1039.047) -- 0:00:15
Average standard deviation of split frequencies: 0.009945
740500 -- (-1035.401) (-1036.999) [-1036.425] (-1036.047) * (-1035.289) (-1034.120) [-1034.048] (-1035.102) -- 0:00:15
741000 -- (-1038.178) (-1033.967) [-1035.694] (-1038.086) * (-1034.231) (-1037.447) (-1035.187) [-1034.384] -- 0:00:15
741500 -- (-1037.422) (-1037.670) [-1035.560] (-1035.658) * (-1037.283) (-1037.444) [-1036.594] (-1034.048) -- 0:00:15
742000 -- (-1035.494) [-1034.371] (-1033.900) (-1036.352) * (-1035.237) [-1036.923] (-1034.896) (-1034.353) -- 0:00:15
742500 -- (-1035.058) [-1038.741] (-1034.743) (-1041.834) * (-1034.720) [-1033.734] (-1035.744) (-1033.630) -- 0:00:15
743000 -- (-1040.667) (-1035.661) (-1042.526) [-1039.342] * (-1034.852) (-1036.099) [-1034.004] (-1035.337) -- 0:00:15
743500 -- [-1036.791] (-1035.984) (-1035.512) (-1034.460) * (-1040.721) (-1034.503) [-1034.050] (-1033.793) -- 0:00:15
744000 -- [-1035.791] (-1035.942) (-1036.961) (-1037.823) * (-1038.118) (-1036.525) [-1034.749] (-1033.487) -- 0:00:15
744500 -- (-1040.311) (-1035.057) (-1036.246) [-1035.833] * (-1034.300) (-1035.681) (-1037.807) [-1034.348] -- 0:00:15
745000 -- (-1037.082) (-1035.875) (-1034.092) [-1034.432] * (-1035.615) [-1036.972] (-1035.828) (-1035.360) -- 0:00:15
Average standard deviation of split frequencies: 0.009795
745500 -- (-1036.756) (-1034.741) [-1034.209] (-1036.137) * [-1035.710] (-1041.334) (-1037.508) (-1041.033) -- 0:00:15
746000 -- [-1035.117] (-1037.330) (-1035.752) (-1038.105) * (-1038.725) (-1036.127) [-1036.144] (-1038.478) -- 0:00:15
746500 -- (-1034.407) [-1036.867] (-1034.026) (-1037.761) * (-1035.311) (-1035.448) [-1036.147] (-1037.739) -- 0:00:15
747000 -- (-1033.645) (-1036.411) (-1034.492) [-1036.016] * [-1034.468] (-1036.478) (-1034.143) (-1038.051) -- 0:00:15
747500 -- [-1035.104] (-1036.170) (-1036.604) (-1036.097) * [-1035.181] (-1037.657) (-1037.294) (-1034.577) -- 0:00:15
748000 -- (-1034.670) [-1033.813] (-1036.867) (-1036.417) * (-1035.698) (-1036.777) (-1036.427) [-1033.681] -- 0:00:15
748500 -- (-1035.069) (-1033.611) [-1035.358] (-1036.764) * (-1034.462) (-1035.222) [-1033.923] (-1036.130) -- 0:00:15
749000 -- (-1035.116) [-1037.387] (-1035.180) (-1034.107) * (-1033.717) (-1036.017) (-1035.737) [-1036.147] -- 0:00:15
749500 -- (-1035.281) (-1036.746) [-1036.149] (-1035.882) * (-1033.919) (-1036.305) (-1035.333) [-1038.774] -- 0:00:15
750000 -- (-1037.084) (-1037.683) (-1038.437) [-1033.489] * (-1038.489) [-1034.905] (-1036.727) (-1040.222) -- 0:00:15
Average standard deviation of split frequencies: 0.009498
750500 -- (-1036.247) [-1034.269] (-1038.535) (-1034.208) * [-1033.574] (-1035.390) (-1039.239) (-1033.852) -- 0:00:14
751000 -- (-1034.921) [-1036.458] (-1033.688) (-1036.098) * (-1035.466) (-1038.493) [-1038.888] (-1035.649) -- 0:00:14
751500 -- (-1038.896) [-1036.483] (-1033.664) (-1034.973) * (-1034.498) [-1033.394] (-1035.624) (-1034.853) -- 0:00:14
752000 -- (-1040.623) (-1033.917) (-1036.884) [-1033.652] * (-1041.233) (-1033.609) [-1035.961] (-1034.710) -- 0:00:14
752500 -- (-1036.482) (-1034.119) [-1034.451] (-1036.777) * (-1039.362) [-1034.927] (-1035.777) (-1035.511) -- 0:00:14
753000 -- [-1034.244] (-1035.051) (-1034.416) (-1034.633) * (-1034.400) [-1035.705] (-1035.665) (-1036.092) -- 0:00:14
753500 -- (-1033.979) (-1034.395) [-1036.618] (-1034.972) * (-1033.744) (-1039.683) [-1034.442] (-1036.913) -- 0:00:15
754000 -- (-1034.623) [-1038.488] (-1036.258) (-1035.496) * (-1033.874) (-1037.549) (-1034.021) [-1035.038] -- 0:00:15
754500 -- (-1037.413) (-1037.858) [-1034.841] (-1035.587) * [-1034.922] (-1038.426) (-1036.114) (-1033.853) -- 0:00:14
755000 -- [-1035.470] (-1035.561) (-1038.693) (-1035.473) * (-1039.273) [-1034.484] (-1040.717) (-1033.824) -- 0:00:14
Average standard deviation of split frequencies: 0.009353
755500 -- (-1036.683) (-1040.720) (-1039.746) [-1036.942] * (-1039.064) (-1036.035) (-1035.916) [-1033.482] -- 0:00:14
756000 -- [-1034.290] (-1041.261) (-1038.987) (-1036.730) * (-1037.141) (-1035.297) (-1034.325) [-1033.971] -- 0:00:14
756500 -- (-1034.467) (-1036.737) [-1039.056] (-1037.983) * [-1039.611] (-1040.017) (-1036.920) (-1034.036) -- 0:00:14
757000 -- (-1036.238) (-1034.624) (-1035.445) [-1037.607] * (-1038.280) (-1037.559) (-1035.751) [-1035.088] -- 0:00:14
757500 -- (-1035.836) (-1034.478) (-1035.314) [-1036.508] * (-1035.530) [-1034.717] (-1035.951) (-1035.324) -- 0:00:14
758000 -- (-1035.186) (-1034.252) (-1038.478) [-1036.167] * (-1035.299) [-1033.644] (-1037.950) (-1034.632) -- 0:00:14
758500 -- [-1036.231] (-1034.864) (-1037.736) (-1034.138) * [-1035.264] (-1034.571) (-1037.268) (-1035.201) -- 0:00:14
759000 -- (-1035.740) [-1038.022] (-1040.420) (-1036.276) * (-1035.973) (-1037.612) [-1041.024] (-1034.862) -- 0:00:14
759500 -- (-1037.470) (-1037.124) (-1039.309) [-1036.017] * (-1035.559) (-1035.099) [-1037.298] (-1036.801) -- 0:00:14
760000 -- [-1035.370] (-1033.825) (-1036.022) (-1036.457) * (-1035.543) [-1038.968] (-1034.315) (-1039.404) -- 0:00:14
Average standard deviation of split frequencies: 0.009412
760500 -- (-1035.537) (-1034.782) [-1034.838] (-1037.680) * (-1034.932) (-1037.921) [-1039.303] (-1041.272) -- 0:00:14
761000 -- (-1035.671) (-1035.574) [-1035.573] (-1038.357) * (-1036.057) [-1033.804] (-1035.944) (-1038.846) -- 0:00:14
761500 -- (-1035.397) [-1035.614] (-1034.365) (-1037.662) * (-1037.376) (-1037.972) (-1036.167) [-1040.034] -- 0:00:14
762000 -- (-1036.526) [-1036.937] (-1035.336) (-1035.306) * (-1033.754) [-1033.507] (-1035.130) (-1036.095) -- 0:00:14
762500 -- (-1036.128) (-1036.024) [-1035.521] (-1035.884) * [-1033.771] (-1038.747) (-1036.304) (-1036.854) -- 0:00:14
763000 -- [-1036.037] (-1036.178) (-1037.264) (-1036.223) * (-1034.135) (-1034.935) (-1039.082) [-1039.733] -- 0:00:14
763500 -- (-1036.947) (-1036.007) [-1036.264] (-1035.208) * (-1035.042) [-1034.565] (-1038.443) (-1036.025) -- 0:00:14
764000 -- (-1036.345) (-1035.559) [-1036.907] (-1035.289) * (-1035.726) (-1034.477) (-1037.745) [-1036.871] -- 0:00:14
764500 -- (-1041.585) (-1034.384) [-1037.178] (-1035.953) * [-1039.271] (-1034.540) (-1036.930) (-1034.506) -- 0:00:14
765000 -- (-1034.396) (-1035.941) [-1034.570] (-1038.657) * (-1033.974) (-1034.017) [-1036.146] (-1034.519) -- 0:00:14
Average standard deviation of split frequencies: 0.009347
765500 -- (-1038.452) (-1038.180) [-1038.832] (-1035.898) * [-1035.511] (-1034.048) (-1034.170) (-1035.520) -- 0:00:14
766000 -- (-1035.740) (-1040.612) (-1036.551) [-1034.173] * (-1034.688) (-1035.166) (-1035.066) [-1034.759] -- 0:00:14
766500 -- (-1038.441) (-1039.113) (-1035.087) [-1036.742] * (-1035.262) (-1034.608) (-1035.914) [-1037.556] -- 0:00:14
767000 -- (-1035.801) (-1042.967) (-1036.071) [-1037.266] * [-1037.447] (-1034.976) (-1037.120) (-1036.128) -- 0:00:13
767500 -- (-1037.025) (-1038.238) [-1035.141] (-1035.706) * (-1035.588) [-1036.705] (-1034.466) (-1035.440) -- 0:00:13
768000 -- [-1036.409] (-1035.551) (-1035.138) (-1036.944) * (-1036.817) (-1038.131) [-1035.662] (-1035.327) -- 0:00:13
768500 -- (-1035.636) (-1035.934) [-1035.471] (-1037.068) * (-1039.951) [-1036.459] (-1036.226) (-1036.242) -- 0:00:13
769000 -- (-1034.354) (-1035.859) [-1034.058] (-1039.212) * (-1039.363) [-1035.692] (-1035.813) (-1035.641) -- 0:00:13
769500 -- [-1035.169] (-1035.692) (-1034.120) (-1038.310) * [-1039.448] (-1041.827) (-1035.392) (-1036.622) -- 0:00:13
770000 -- (-1034.384) [-1037.421] (-1038.421) (-1036.599) * (-1037.283) (-1036.303) [-1034.820] (-1041.935) -- 0:00:14
Average standard deviation of split frequencies: 0.009405
770500 -- (-1034.971) (-1035.031) [-1033.862] (-1033.470) * (-1037.129) [-1034.877] (-1035.431) (-1038.060) -- 0:00:13
771000 -- (-1034.119) (-1036.105) (-1035.948) [-1035.633] * [-1034.343] (-1036.016) (-1035.080) (-1041.397) -- 0:00:13
771500 -- (-1035.996) [-1034.632] (-1035.756) (-1039.824) * (-1038.724) (-1037.480) (-1036.315) [-1034.507] -- 0:00:13
772000 -- (-1037.393) [-1034.804] (-1038.504) (-1038.720) * [-1035.327] (-1039.438) (-1035.591) (-1033.937) -- 0:00:13
772500 -- (-1035.569) (-1037.807) [-1034.910] (-1036.825) * (-1035.945) (-1036.539) (-1035.007) [-1034.468] -- 0:00:13
773000 -- (-1034.992) (-1037.830) [-1036.834] (-1035.820) * [-1036.861] (-1036.009) (-1034.956) (-1036.768) -- 0:00:13
773500 -- (-1034.275) [-1034.273] (-1035.449) (-1036.656) * (-1041.448) (-1035.309) [-1037.222] (-1040.043) -- 0:00:13
774000 -- (-1036.302) (-1036.225) (-1036.656) [-1034.990] * [-1034.540] (-1033.527) (-1046.842) (-1035.519) -- 0:00:13
774500 -- (-1034.140) [-1040.940] (-1038.375) (-1036.084) * (-1035.221) (-1036.521) [-1034.998] (-1034.425) -- 0:00:13
775000 -- [-1034.823] (-1037.811) (-1038.442) (-1034.614) * (-1034.757) (-1035.540) (-1034.019) [-1035.038] -- 0:00:13
Average standard deviation of split frequencies: 0.009720
775500 -- (-1037.173) (-1037.586) (-1037.544) [-1039.801] * (-1035.891) (-1034.032) [-1038.612] (-1035.049) -- 0:00:13
776000 -- [-1035.395] (-1034.691) (-1034.162) (-1037.952) * (-1035.312) (-1034.428) [-1035.888] (-1037.360) -- 0:00:13
776500 -- [-1034.849] (-1036.301) (-1038.951) (-1035.149) * (-1035.521) (-1034.644) [-1035.610] (-1034.035) -- 0:00:13
777000 -- (-1034.784) (-1033.845) [-1035.403] (-1034.966) * (-1034.392) (-1034.711) [-1037.020] (-1033.890) -- 0:00:13
777500 -- (-1039.299) (-1033.740) (-1037.240) [-1039.530] * [-1034.463] (-1037.929) (-1036.911) (-1033.760) -- 0:00:13
778000 -- (-1037.764) (-1035.302) (-1037.686) [-1036.920] * (-1035.019) (-1036.570) [-1035.100] (-1035.835) -- 0:00:13
778500 -- (-1038.373) [-1034.239] (-1034.361) (-1036.258) * [-1034.111] (-1035.563) (-1035.787) (-1037.058) -- 0:00:13
779000 -- (-1035.799) (-1037.452) [-1037.361] (-1036.146) * (-1036.548) [-1036.679] (-1038.878) (-1034.475) -- 0:00:13
779500 -- (-1036.893) (-1036.818) [-1035.427] (-1035.377) * (-1037.246) (-1035.774) [-1038.447] (-1035.391) -- 0:00:13
780000 -- (-1035.366) (-1039.050) [-1033.636] (-1034.233) * (-1037.928) [-1036.506] (-1036.339) (-1034.257) -- 0:00:13
Average standard deviation of split frequencies: 0.009850
780500 -- (-1039.265) (-1037.406) [-1036.022] (-1035.814) * (-1035.332) [-1035.525] (-1035.870) (-1037.838) -- 0:00:13
781000 -- [-1037.118] (-1034.867) (-1036.572) (-1036.010) * (-1037.349) [-1036.057] (-1035.522) (-1034.705) -- 0:00:13
781500 -- (-1039.438) (-1035.768) (-1036.882) [-1035.571] * (-1038.757) (-1034.615) (-1035.466) [-1034.653] -- 0:00:13
782000 -- [-1039.362] (-1038.582) (-1036.498) (-1035.706) * (-1036.245) (-1033.791) [-1036.636] (-1034.858) -- 0:00:13
782500 -- (-1036.927) [-1034.812] (-1042.948) (-1034.674) * [-1034.920] (-1034.711) (-1037.826) (-1034.388) -- 0:00:13
783000 -- (-1043.506) [-1034.221] (-1034.361) (-1034.573) * (-1037.817) [-1034.740] (-1035.558) (-1034.445) -- 0:00:13
783500 -- (-1036.017) [-1034.696] (-1034.062) (-1035.766) * [-1033.741] (-1034.344) (-1035.963) (-1036.732) -- 0:00:12
784000 -- (-1036.795) [-1036.428] (-1033.402) (-1033.854) * (-1033.846) [-1038.252] (-1040.189) (-1038.718) -- 0:00:12
784500 -- [-1036.741] (-1033.746) (-1035.176) (-1036.520) * (-1035.896) (-1035.733) (-1036.203) [-1036.132] -- 0:00:12
785000 -- (-1035.362) (-1034.810) (-1034.230) [-1036.962] * (-1035.641) (-1035.469) (-1035.613) [-1033.529] -- 0:00:12
Average standard deviation of split frequencies: 0.010046
785500 -- (-1036.126) [-1034.096] (-1036.130) (-1033.536) * [-1037.954] (-1034.839) (-1036.682) (-1039.390) -- 0:00:12
786000 -- [-1034.210] (-1034.584) (-1036.483) (-1036.341) * (-1033.730) (-1036.329) [-1036.164] (-1035.612) -- 0:00:12
786500 -- [-1035.491] (-1034.651) (-1035.040) (-1037.968) * (-1036.824) [-1035.758] (-1040.959) (-1036.164) -- 0:00:13
787000 -- (-1037.478) [-1033.779] (-1037.988) (-1043.814) * (-1035.801) (-1034.234) (-1036.894) [-1034.926] -- 0:00:12
787500 -- (-1036.155) [-1034.103] (-1036.902) (-1041.337) * (-1041.989) [-1034.169] (-1037.435) (-1035.357) -- 0:00:12
788000 -- (-1035.029) (-1038.531) (-1035.923) [-1034.110] * (-1041.190) [-1033.864] (-1035.759) (-1038.368) -- 0:00:12
788500 -- (-1037.023) [-1035.542] (-1037.856) (-1033.901) * (-1038.624) (-1035.822) [-1035.233] (-1035.634) -- 0:00:12
789000 -- (-1035.642) [-1035.090] (-1034.229) (-1034.669) * (-1035.743) (-1036.920) [-1034.375] (-1039.744) -- 0:00:12
789500 -- (-1036.640) [-1037.404] (-1034.348) (-1035.674) * (-1033.581) (-1036.668) (-1034.863) [-1034.818] -- 0:00:12
790000 -- [-1036.512] (-1033.889) (-1033.825) (-1034.523) * [-1034.895] (-1037.872) (-1037.232) (-1037.118) -- 0:00:12
Average standard deviation of split frequencies: 0.010061
790500 -- (-1035.554) (-1033.744) (-1034.532) [-1035.933] * (-1035.360) (-1036.377) (-1035.876) [-1036.222] -- 0:00:12
791000 -- [-1035.388] (-1039.547) (-1035.168) (-1034.765) * (-1034.111) [-1035.000] (-1034.804) (-1038.083) -- 0:00:12
791500 -- (-1035.625) (-1036.835) (-1043.155) [-1037.519] * (-1033.995) [-1034.550] (-1034.721) (-1033.919) -- 0:00:12
792000 -- (-1036.701) (-1035.100) (-1036.587) [-1039.532] * [-1034.777] (-1037.763) (-1035.523) (-1037.243) -- 0:00:12
792500 -- [-1033.707] (-1037.570) (-1042.338) (-1039.219) * [-1036.677] (-1036.990) (-1036.530) (-1035.825) -- 0:00:12
793000 -- [-1034.169] (-1036.534) (-1035.214) (-1038.012) * (-1038.611) [-1035.412] (-1035.963) (-1037.692) -- 0:00:12
793500 -- [-1033.849] (-1035.205) (-1040.184) (-1035.323) * (-1035.146) [-1035.460] (-1039.095) (-1040.866) -- 0:00:12
794000 -- (-1034.940) (-1035.416) (-1037.299) [-1035.191] * [-1036.717] (-1035.104) (-1036.475) (-1035.248) -- 0:00:12
794500 -- [-1035.786] (-1034.449) (-1038.643) (-1038.375) * (-1036.121) [-1036.620] (-1036.780) (-1034.495) -- 0:00:12
795000 -- (-1036.751) (-1033.931) (-1042.545) [-1036.534] * [-1035.588] (-1036.428) (-1036.216) (-1038.294) -- 0:00:12
Average standard deviation of split frequencies: 0.009772
795500 -- (-1040.406) [-1033.902] (-1041.108) (-1034.882) * (-1034.680) (-1039.106) [-1034.907] (-1034.928) -- 0:00:12
796000 -- (-1035.979) (-1034.443) [-1034.013] (-1034.620) * [-1034.667] (-1039.358) (-1034.397) (-1036.728) -- 0:00:12
796500 -- (-1036.832) (-1033.871) [-1034.033] (-1035.106) * (-1034.927) (-1037.338) [-1033.633] (-1037.081) -- 0:00:12
797000 -- [-1034.396] (-1033.598) (-1037.821) (-1035.419) * (-1036.336) (-1036.179) (-1033.653) [-1039.263] -- 0:00:12
797500 -- (-1036.891) (-1035.048) (-1037.818) [-1034.320] * (-1037.119) (-1035.775) (-1035.205) [-1034.608] -- 0:00:12
798000 -- (-1035.448) (-1036.347) (-1034.527) [-1035.196] * (-1035.630) (-1037.048) [-1034.800] (-1033.877) -- 0:00:12
798500 -- (-1035.032) (-1038.433) [-1036.344] (-1038.653) * (-1036.237) (-1036.749) (-1036.531) [-1035.247] -- 0:00:12
799000 -- [-1035.184] (-1035.900) (-1041.812) (-1036.008) * [-1034.964] (-1044.740) (-1053.441) (-1034.876) -- 0:00:12
799500 -- (-1034.784) (-1038.937) [-1036.134] (-1036.741) * (-1037.102) (-1034.949) (-1034.525) [-1033.459] -- 0:00:12
800000 -- (-1034.112) (-1036.192) [-1038.524] (-1037.411) * [-1035.040] (-1035.830) (-1034.288) (-1034.771) -- 0:00:12
Average standard deviation of split frequencies: 0.009420
800500 -- [-1035.101] (-1034.354) (-1037.094) (-1037.937) * (-1035.911) (-1036.917) [-1035.883] (-1037.123) -- 0:00:11
801000 -- (-1038.045) (-1034.258) [-1035.156] (-1035.899) * [-1035.213] (-1034.762) (-1040.350) (-1036.680) -- 0:00:11
801500 -- [-1036.336] (-1033.833) (-1036.905) (-1034.505) * (-1034.982) (-1034.215) (-1035.119) [-1038.374] -- 0:00:11
802000 -- (-1036.262) [-1034.621] (-1035.760) (-1039.456) * (-1033.989) [-1035.120] (-1034.449) (-1034.295) -- 0:00:11
802500 -- (-1038.816) [-1033.732] (-1035.296) (-1040.064) * (-1035.900) [-1041.599] (-1034.410) (-1034.509) -- 0:00:11
803000 -- [-1035.110] (-1036.907) (-1034.835) (-1039.497) * [-1035.391] (-1036.731) (-1036.434) (-1035.114) -- 0:00:12
803500 -- (-1034.862) [-1035.030] (-1034.817) (-1037.795) * [-1034.210] (-1035.393) (-1034.678) (-1035.593) -- 0:00:11
804000 -- (-1034.221) [-1034.936] (-1036.760) (-1034.460) * (-1035.806) (-1035.224) (-1035.890) [-1035.764] -- 0:00:11
804500 -- [-1036.289] (-1036.286) (-1036.650) (-1035.466) * (-1035.686) (-1035.504) [-1036.531] (-1034.621) -- 0:00:11
805000 -- (-1036.842) (-1035.662) (-1038.178) [-1035.532] * (-1038.094) (-1038.576) [-1034.106] (-1037.800) -- 0:00:11
Average standard deviation of split frequencies: 0.009212
805500 -- (-1036.919) (-1039.285) (-1036.364) [-1037.861] * (-1035.779) (-1036.830) [-1034.571] (-1034.514) -- 0:00:11
806000 -- [-1036.834] (-1035.652) (-1038.771) (-1039.868) * [-1035.361] (-1038.089) (-1036.136) (-1036.146) -- 0:00:11
806500 -- (-1036.727) [-1036.986] (-1035.457) (-1034.876) * (-1035.011) (-1035.659) (-1035.052) [-1035.846] -- 0:00:11
807000 -- (-1037.991) (-1034.576) [-1035.208] (-1038.941) * (-1040.813) (-1040.660) [-1035.273] (-1035.182) -- 0:00:11
807500 -- (-1036.885) [-1035.198] (-1037.562) (-1041.681) * (-1034.570) (-1035.668) [-1035.044] (-1035.770) -- 0:00:11
808000 -- [-1035.037] (-1033.901) (-1038.730) (-1034.041) * (-1036.725) [-1036.099] (-1036.121) (-1039.166) -- 0:00:11
808500 -- (-1034.688) (-1035.233) (-1038.533) [-1035.088] * (-1041.934) [-1036.304] (-1036.275) (-1036.606) -- 0:00:11
809000 -- (-1041.097) [-1034.604] (-1035.774) (-1036.056) * (-1035.079) (-1036.581) [-1037.054] (-1036.006) -- 0:00:11
809500 -- (-1037.368) [-1034.461] (-1035.877) (-1035.312) * (-1033.861) (-1036.219) [-1033.904] (-1034.691) -- 0:00:11
810000 -- (-1040.633) (-1034.120) (-1037.861) [-1036.194] * (-1033.659) (-1038.502) [-1035.328] (-1034.811) -- 0:00:11
Average standard deviation of split frequencies: 0.009086
810500 -- (-1037.997) (-1034.350) [-1039.631] (-1035.075) * [-1035.108] (-1039.672) (-1035.902) (-1034.381) -- 0:00:11
811000 -- (-1034.560) (-1035.091) [-1037.820] (-1034.682) * [-1034.787] (-1042.045) (-1036.404) (-1036.988) -- 0:00:11
811500 -- (-1035.543) (-1039.790) (-1036.136) [-1034.775] * [-1035.282] (-1038.955) (-1039.100) (-1037.729) -- 0:00:11
812000 -- (-1034.705) (-1037.545) [-1034.391] (-1035.129) * (-1039.358) (-1035.296) (-1036.595) [-1034.726] -- 0:00:11
812500 -- [-1034.403] (-1037.063) (-1033.810) (-1037.342) * [-1043.149] (-1042.921) (-1036.673) (-1037.067) -- 0:00:11
813000 -- (-1034.928) (-1035.883) (-1034.658) [-1035.172] * (-1037.861) [-1035.061] (-1039.332) (-1038.675) -- 0:00:11
813500 -- (-1037.394) (-1034.859) (-1035.664) [-1034.461] * (-1041.054) [-1035.318] (-1036.874) (-1039.919) -- 0:00:11
814000 -- (-1037.394) [-1034.443] (-1038.197) (-1034.187) * (-1036.677) (-1034.485) (-1035.897) [-1039.349] -- 0:00:11
814500 -- (-1034.399) [-1034.357] (-1035.237) (-1036.549) * (-1036.063) [-1034.843] (-1035.749) (-1035.348) -- 0:00:11
815000 -- [-1034.781] (-1037.475) (-1036.873) (-1035.574) * (-1036.838) [-1035.403] (-1036.045) (-1035.555) -- 0:00:11
Average standard deviation of split frequencies: 0.008485
815500 -- (-1037.656) (-1035.989) (-1036.922) [-1034.815] * (-1035.944) [-1035.865] (-1035.788) (-1036.117) -- 0:00:11
816000 -- (-1035.631) (-1034.669) [-1033.690] (-1035.206) * (-1036.395) (-1035.961) [-1034.788] (-1038.582) -- 0:00:11
816500 -- (-1035.631) [-1034.002] (-1038.551) (-1037.154) * (-1035.485) (-1036.613) (-1036.564) [-1035.341] -- 0:00:11
817000 -- (-1036.170) [-1035.142] (-1038.250) (-1037.223) * [-1034.400] (-1036.345) (-1036.616) (-1035.526) -- 0:00:10
817500 -- [-1034.989] (-1034.732) (-1034.110) (-1034.002) * (-1034.373) (-1036.107) (-1035.829) [-1037.129] -- 0:00:10
818000 -- (-1035.466) (-1035.305) (-1035.428) [-1034.538] * (-1037.847) [-1035.786] (-1033.995) (-1035.816) -- 0:00:10
818500 -- [-1036.122] (-1040.294) (-1034.837) (-1034.981) * [-1034.991] (-1035.064) (-1035.794) (-1033.682) -- 0:00:10
819000 -- (-1035.297) (-1036.952) [-1036.742] (-1034.950) * (-1034.845) (-1036.832) (-1034.797) [-1035.268] -- 0:00:10
819500 -- [-1036.429] (-1034.910) (-1034.805) (-1035.705) * [-1038.857] (-1037.089) (-1035.986) (-1034.756) -- 0:00:11
820000 -- (-1036.464) (-1034.537) (-1036.203) [-1036.709] * (-1035.779) (-1038.151) [-1034.841] (-1035.621) -- 0:00:10
Average standard deviation of split frequencies: 0.008401
820500 -- (-1035.913) (-1035.288) [-1033.597] (-1036.038) * (-1034.289) [-1035.224] (-1034.391) (-1036.309) -- 0:00:10
821000 -- (-1035.932) (-1035.119) (-1036.650) [-1034.530] * (-1035.793) (-1034.681) (-1036.476) [-1036.990] -- 0:00:10
821500 -- (-1036.540) (-1035.369) (-1040.029) [-1035.819] * (-1035.961) (-1035.566) [-1036.051] (-1036.498) -- 0:00:10
822000 -- (-1035.327) (-1036.006) [-1034.084] (-1036.584) * (-1034.842) [-1034.595] (-1034.977) (-1036.611) -- 0:00:10
822500 -- [-1038.372] (-1035.504) (-1037.778) (-1035.238) * [-1037.335] (-1037.792) (-1035.339) (-1034.770) -- 0:00:10
823000 -- [-1038.640] (-1037.244) (-1034.576) (-1034.170) * (-1034.522) (-1036.368) (-1036.939) [-1037.597] -- 0:00:10
823500 -- (-1047.137) (-1037.042) [-1036.211] (-1035.031) * (-1034.991) [-1037.173] (-1040.198) (-1035.272) -- 0:00:10
824000 -- [-1036.328] (-1036.280) (-1043.126) (-1034.990) * (-1037.176) [-1036.807] (-1035.842) (-1034.615) -- 0:00:10
824500 -- (-1036.775) (-1034.068) [-1040.264] (-1033.929) * (-1038.490) [-1036.928] (-1035.708) (-1038.497) -- 0:00:10
825000 -- (-1037.445) (-1035.562) (-1036.381) [-1033.829] * (-1037.178) (-1039.433) [-1038.464] (-1035.979) -- 0:00:10
Average standard deviation of split frequencies: 0.008347
825500 -- (-1034.860) [-1034.862] (-1036.536) (-1034.036) * [-1037.442] (-1039.314) (-1038.773) (-1035.868) -- 0:00:10
826000 -- [-1035.004] (-1038.584) (-1036.171) (-1034.675) * (-1042.739) [-1038.391] (-1035.958) (-1035.167) -- 0:00:10
826500 -- [-1034.386] (-1034.669) (-1039.089) (-1035.125) * (-1037.743) [-1039.775] (-1033.834) (-1037.722) -- 0:00:10
827000 -- [-1037.392] (-1044.537) (-1040.166) (-1036.723) * (-1038.518) (-1039.455) (-1037.645) [-1033.601] -- 0:00:10
827500 -- (-1035.146) (-1035.332) (-1035.394) [-1036.034] * (-1045.142) (-1035.637) (-1035.563) [-1033.642] -- 0:00:10
828000 -- [-1035.349] (-1037.572) (-1035.023) (-1033.805) * (-1033.769) (-1037.238) (-1035.687) [-1035.041] -- 0:00:10
828500 -- (-1038.824) (-1036.195) [-1034.814] (-1035.740) * [-1033.806] (-1036.186) (-1035.175) (-1034.337) -- 0:00:10
829000 -- (-1036.935) (-1034.357) (-1034.506) [-1035.032] * (-1037.019) (-1037.163) [-1036.105] (-1035.927) -- 0:00:10
829500 -- (-1034.728) (-1035.828) [-1036.327] (-1037.109) * (-1036.072) [-1034.389] (-1039.360) (-1035.134) -- 0:00:10
830000 -- (-1036.344) (-1037.965) [-1036.322] (-1034.772) * (-1037.286) (-1036.107) (-1037.659) [-1036.061] -- 0:00:10
Average standard deviation of split frequencies: 0.008619
830500 -- (-1035.215) [-1035.650] (-1038.641) (-1037.230) * (-1035.367) [-1033.662] (-1033.972) (-1036.877) -- 0:00:10
831000 -- (-1035.476) [-1034.395] (-1036.634) (-1034.424) * [-1035.361] (-1034.581) (-1036.278) (-1034.614) -- 0:00:10
831500 -- (-1041.284) [-1036.258] (-1034.743) (-1034.891) * [-1034.618] (-1036.194) (-1038.526) (-1034.897) -- 0:00:10
832000 -- [-1042.711] (-1036.623) (-1035.527) (-1033.900) * (-1034.834) (-1037.219) [-1035.223] (-1033.929) -- 0:00:10
832500 -- (-1033.603) (-1035.212) (-1033.806) [-1033.900] * (-1037.643) [-1037.826] (-1034.574) (-1034.883) -- 0:00:10
833000 -- (-1040.660) (-1034.413) (-1034.620) [-1038.169] * (-1038.500) (-1034.854) [-1035.767] (-1036.330) -- 0:00:10
833500 -- (-1040.868) [-1034.021] (-1035.145) (-1037.741) * [-1039.771] (-1040.303) (-1035.242) (-1035.542) -- 0:00:09
834000 -- (-1035.986) (-1035.040) [-1034.624] (-1036.965) * (-1039.889) [-1034.557] (-1036.704) (-1036.911) -- 0:00:09
834500 -- [-1038.318] (-1037.053) (-1035.102) (-1035.739) * (-1037.292) [-1039.168] (-1036.343) (-1036.350) -- 0:00:09
835000 -- [-1036.970] (-1035.693) (-1034.159) (-1036.517) * (-1037.566) (-1039.653) (-1035.182) [-1033.619] -- 0:00:09
Average standard deviation of split frequencies: 0.008952
835500 -- [-1034.526] (-1036.680) (-1035.491) (-1034.217) * (-1036.566) (-1037.071) (-1037.032) [-1035.498] -- 0:00:10
836000 -- (-1039.908) (-1035.554) [-1034.837] (-1038.038) * (-1040.657) [-1034.439] (-1035.863) (-1035.019) -- 0:00:10
836500 -- (-1037.398) (-1037.303) (-1035.087) [-1038.773] * (-1035.378) [-1036.801] (-1036.097) (-1034.930) -- 0:00:09
837000 -- (-1040.218) (-1034.254) (-1034.975) [-1034.539] * (-1038.977) [-1035.406] (-1036.283) (-1035.844) -- 0:00:09
837500 -- (-1038.962) [-1036.109] (-1036.015) (-1038.007) * [-1036.978] (-1035.854) (-1035.561) (-1039.127) -- 0:00:09
838000 -- (-1035.560) (-1033.379) [-1037.402] (-1041.069) * (-1035.834) (-1035.961) (-1033.761) [-1034.721] -- 0:00:09
838500 -- (-1034.575) [-1036.537] (-1034.676) (-1036.338) * (-1035.478) (-1041.170) [-1036.843] (-1035.402) -- 0:00:09
839000 -- (-1036.364) (-1038.150) [-1037.627] (-1033.612) * (-1035.483) (-1034.917) (-1034.504) [-1036.141] -- 0:00:09
839500 -- (-1034.527) (-1038.286) (-1038.032) [-1033.762] * [-1038.222] (-1034.682) (-1036.910) (-1034.484) -- 0:00:09
840000 -- [-1034.299] (-1038.519) (-1036.292) (-1034.196) * (-1034.577) (-1034.822) (-1037.382) [-1036.234] -- 0:00:09
Average standard deviation of split frequencies: 0.009007
840500 -- (-1033.818) (-1034.124) (-1035.239) [-1035.686] * [-1036.616] (-1041.368) (-1035.685) (-1040.190) -- 0:00:09
841000 -- (-1034.878) [-1036.222] (-1036.674) (-1036.820) * (-1033.835) (-1033.675) [-1034.697] (-1040.893) -- 0:00:09
841500 -- (-1038.814) (-1038.363) [-1034.189] (-1033.742) * (-1035.087) [-1033.671] (-1036.525) (-1035.476) -- 0:00:09
842000 -- (-1039.039) [-1036.568] (-1034.152) (-1037.527) * [-1035.941] (-1036.143) (-1036.256) (-1035.319) -- 0:00:09
842500 -- (-1039.581) [-1039.255] (-1036.053) (-1037.728) * (-1037.548) (-1037.013) [-1036.134] (-1036.025) -- 0:00:09
843000 -- (-1037.192) [-1033.481] (-1039.817) (-1035.152) * (-1035.385) (-1035.208) [-1034.321] (-1035.215) -- 0:00:09
843500 -- (-1036.335) (-1034.918) (-1035.837) [-1034.270] * (-1037.374) (-1034.472) (-1034.575) [-1035.244] -- 0:00:09
844000 -- (-1036.672) (-1035.911) (-1036.012) [-1034.202] * (-1038.595) (-1037.797) [-1036.817] (-1033.927) -- 0:00:09
844500 -- [-1037.213] (-1038.181) (-1037.566) (-1033.750) * (-1035.014) (-1035.509) [-1036.445] (-1034.542) -- 0:00:09
845000 -- (-1037.211) (-1037.253) [-1034.475] (-1036.164) * (-1035.673) [-1034.143] (-1036.081) (-1034.456) -- 0:00:09
Average standard deviation of split frequencies: 0.009159
845500 -- (-1039.494) (-1036.950) [-1035.791] (-1040.296) * (-1035.631) (-1035.369) [-1035.258] (-1039.008) -- 0:00:09
846000 -- (-1037.974) [-1034.651] (-1037.209) (-1034.662) * (-1034.135) (-1037.274) [-1034.943] (-1035.215) -- 0:00:09
846500 -- [-1036.187] (-1034.826) (-1036.652) (-1038.432) * (-1036.172) [-1037.307] (-1034.155) (-1034.649) -- 0:00:09
847000 -- (-1037.809) (-1039.610) (-1034.189) [-1035.220] * (-1037.076) (-1034.912) (-1036.096) [-1033.701] -- 0:00:09
847500 -- (-1040.199) (-1036.291) [-1035.114] (-1038.273) * (-1035.563) (-1038.427) [-1034.136] (-1040.384) -- 0:00:09
848000 -- (-1035.754) [-1033.892] (-1035.239) (-1035.945) * (-1034.756) (-1035.596) (-1036.743) [-1037.821] -- 0:00:09
848500 -- (-1034.842) [-1034.676] (-1036.388) (-1037.762) * (-1034.773) (-1040.869) (-1034.769) [-1037.516] -- 0:00:09
849000 -- (-1034.563) (-1035.369) [-1038.668] (-1034.644) * (-1036.734) (-1036.671) (-1034.822) [-1040.578] -- 0:00:09
849500 -- (-1035.540) [-1033.649] (-1037.413) (-1040.901) * [-1037.630] (-1037.227) (-1035.729) (-1038.160) -- 0:00:09
850000 -- (-1037.589) (-1035.982) (-1036.263) [-1036.094] * (-1038.337) (-1036.904) [-1035.220] (-1037.596) -- 0:00:09
Average standard deviation of split frequencies: 0.008901
850500 -- (-1035.432) (-1034.419) (-1037.124) [-1036.144] * [-1034.952] (-1034.919) (-1040.925) (-1036.385) -- 0:00:08
851000 -- (-1034.761) [-1034.240] (-1033.988) (-1037.233) * (-1036.682) (-1034.299) (-1036.430) [-1035.459] -- 0:00:08
851500 -- (-1034.677) [-1034.490] (-1035.420) (-1037.134) * (-1037.159) (-1034.299) (-1038.098) [-1036.542] -- 0:00:08
852000 -- [-1035.045] (-1036.542) (-1033.922) (-1035.963) * (-1035.921) (-1037.188) [-1033.859] (-1035.060) -- 0:00:09
852500 -- (-1036.112) (-1043.626) (-1035.270) [-1036.331] * (-1034.543) (-1043.895) (-1037.288) [-1037.805] -- 0:00:08
853000 -- (-1035.695) (-1036.944) [-1035.726] (-1039.718) * [-1036.539] (-1037.827) (-1036.903) (-1034.730) -- 0:00:08
853500 -- (-1037.316) [-1039.022] (-1034.116) (-1034.958) * [-1037.697] (-1037.332) (-1036.120) (-1038.548) -- 0:00:08
854000 -- (-1035.673) [-1035.080] (-1034.804) (-1034.712) * (-1039.510) (-1038.078) (-1035.384) [-1036.646] -- 0:00:08
854500 -- (-1035.415) (-1034.621) [-1034.215] (-1035.190) * (-1034.319) (-1034.799) (-1034.070) [-1034.747] -- 0:00:08
855000 -- [-1036.944] (-1035.942) (-1034.551) (-1037.171) * [-1035.155] (-1035.137) (-1036.929) (-1035.147) -- 0:00:08
Average standard deviation of split frequencies: 0.008811
855500 -- [-1034.826] (-1034.967) (-1036.991) (-1036.672) * (-1037.720) (-1035.509) (-1041.391) [-1034.861] -- 0:00:08
856000 -- (-1034.768) (-1035.326) [-1035.525] (-1035.507) * (-1037.929) (-1035.941) (-1036.903) [-1034.552] -- 0:00:08
856500 -- (-1035.817) (-1033.819) (-1037.014) [-1034.093] * (-1037.630) [-1034.218] (-1034.342) (-1035.904) -- 0:00:08
857000 -- (-1035.596) (-1034.714) (-1036.972) [-1034.923] * (-1038.298) [-1034.523] (-1034.878) (-1038.622) -- 0:00:08
857500 -- (-1034.228) (-1034.922) [-1036.028] (-1038.162) * (-1034.128) (-1038.940) (-1035.807) [-1034.530] -- 0:00:08
858000 -- (-1035.894) [-1036.141] (-1034.246) (-1036.918) * (-1034.719) [-1035.312] (-1036.814) (-1035.985) -- 0:00:08
858500 -- (-1035.380) [-1041.135] (-1034.462) (-1035.769) * (-1035.035) (-1035.036) [-1035.060] (-1035.424) -- 0:00:08
859000 -- (-1037.308) (-1040.530) (-1037.196) [-1035.594] * (-1037.037) [-1035.038] (-1037.592) (-1035.665) -- 0:00:08
859500 -- (-1037.950) (-1041.208) [-1035.217] (-1038.266) * (-1038.670) [-1034.685] (-1035.439) (-1035.228) -- 0:00:08
860000 -- (-1034.803) (-1035.452) [-1035.387] (-1039.660) * (-1037.722) (-1037.023) [-1035.452] (-1035.289) -- 0:00:08
Average standard deviation of split frequencies: 0.008524
860500 -- (-1036.766) (-1039.764) [-1036.091] (-1036.050) * [-1034.945] (-1035.867) (-1035.414) (-1041.264) -- 0:00:08
861000 -- [-1038.617] (-1036.878) (-1036.956) (-1034.929) * (-1033.894) (-1038.604) (-1039.185) [-1035.751] -- 0:00:08
861500 -- (-1034.425) (-1038.967) (-1036.758) [-1036.625] * [-1033.894] (-1035.281) (-1036.242) (-1035.728) -- 0:00:08
862000 -- (-1034.443) (-1036.355) (-1036.640) [-1034.578] * (-1034.015) (-1035.053) [-1037.382] (-1036.441) -- 0:00:08
862500 -- (-1037.243) [-1036.795] (-1034.558) (-1034.755) * (-1035.683) [-1036.887] (-1034.940) (-1036.935) -- 0:00:08
863000 -- (-1037.656) (-1036.303) (-1037.162) [-1034.103] * (-1037.316) (-1035.260) [-1036.013] (-1034.449) -- 0:00:08
863500 -- (-1036.101) (-1040.320) (-1035.370) [-1034.785] * (-1034.826) (-1035.347) (-1037.863) [-1034.021] -- 0:00:08
864000 -- (-1033.668) [-1034.297] (-1035.086) (-1034.491) * (-1036.846) (-1041.678) [-1034.660] (-1034.317) -- 0:00:08
864500 -- (-1035.055) (-1035.841) [-1037.671] (-1035.111) * (-1035.361) (-1034.554) [-1035.276] (-1035.026) -- 0:00:08
865000 -- [-1034.915] (-1035.826) (-1036.916) (-1037.477) * [-1035.528] (-1034.574) (-1040.697) (-1038.540) -- 0:00:08
Average standard deviation of split frequencies: 0.008710
865500 -- (-1037.455) [-1035.250] (-1034.694) (-1035.811) * (-1034.697) (-1036.207) (-1039.350) [-1034.502] -- 0:00:08
866000 -- (-1034.464) (-1036.056) [-1037.553] (-1039.085) * (-1042.447) [-1034.736] (-1035.730) (-1036.523) -- 0:00:08
866500 -- (-1034.486) (-1034.664) (-1038.076) [-1034.614] * (-1044.696) [-1035.493] (-1033.900) (-1035.491) -- 0:00:08
867000 -- [-1034.273] (-1034.885) (-1036.389) (-1035.006) * (-1041.302) (-1034.803) (-1033.922) [-1034.776] -- 0:00:07
867500 -- (-1038.856) (-1034.938) (-1035.864) [-1036.714] * (-1036.845) (-1042.751) (-1035.902) [-1035.044] -- 0:00:07
868000 -- (-1035.794) (-1033.923) (-1038.343) [-1034.875] * (-1045.680) [-1036.973] (-1034.539) (-1034.991) -- 0:00:07
868500 -- (-1036.625) [-1041.223] (-1035.389) (-1035.766) * (-1035.045) (-1035.253) [-1035.688] (-1034.600) -- 0:00:08
869000 -- (-1033.870) (-1037.218) (-1035.165) [-1034.437] * [-1033.998] (-1038.753) (-1034.123) (-1035.989) -- 0:00:07
869500 -- (-1033.759) (-1038.354) (-1037.368) [-1035.010] * (-1033.883) (-1033.958) (-1036.765) [-1036.045] -- 0:00:07
870000 -- [-1033.862] (-1038.215) (-1034.194) (-1034.446) * (-1036.109) (-1034.963) (-1034.806) [-1039.413] -- 0:00:07
Average standard deviation of split frequencies: 0.008900
870500 -- [-1034.943] (-1037.517) (-1035.620) (-1037.843) * (-1036.084) (-1034.323) (-1036.332) [-1037.788] -- 0:00:07
871000 -- (-1035.711) (-1036.350) [-1035.882] (-1034.577) * [-1035.831] (-1033.874) (-1036.890) (-1039.020) -- 0:00:07
871500 -- (-1040.390) (-1035.184) (-1035.112) [-1034.957] * (-1035.493) (-1037.493) [-1034.420] (-1035.483) -- 0:00:07
872000 -- [-1035.484] (-1034.085) (-1037.424) (-1035.867) * (-1036.132) (-1034.734) [-1033.753] (-1034.788) -- 0:00:07
872500 -- (-1034.061) [-1039.816] (-1037.467) (-1035.682) * (-1039.294) (-1036.078) [-1034.055] (-1043.961) -- 0:00:07
873000 -- (-1034.101) (-1035.305) [-1035.458] (-1035.107) * [-1037.717] (-1039.380) (-1035.404) (-1040.510) -- 0:00:07
873500 -- (-1035.500) [-1034.759] (-1039.537) (-1035.395) * (-1036.923) (-1038.097) [-1034.982] (-1035.826) -- 0:00:07
874000 -- (-1035.353) (-1034.156) (-1035.909) [-1036.006] * [-1040.539] (-1036.726) (-1035.566) (-1033.831) -- 0:00:07
874500 -- (-1035.511) [-1034.693] (-1033.770) (-1035.871) * (-1040.867) (-1035.900) (-1035.762) [-1035.497] -- 0:00:07
875000 -- (-1039.390) [-1034.571] (-1034.180) (-1033.688) * (-1033.717) (-1034.581) [-1034.344] (-1036.269) -- 0:00:07
Average standard deviation of split frequencies: 0.008913
875500 -- [-1040.476] (-1039.420) (-1033.833) (-1038.169) * (-1039.361) (-1035.663) (-1038.969) [-1035.221] -- 0:00:07
876000 -- (-1035.627) (-1036.620) [-1033.853] (-1034.747) * (-1040.932) (-1039.803) [-1034.237] (-1034.625) -- 0:00:07
876500 -- (-1033.859) (-1034.170) [-1035.430] (-1039.715) * (-1037.525) [-1036.266] (-1036.476) (-1034.888) -- 0:00:07
877000 -- (-1035.251) (-1036.557) [-1033.460] (-1035.866) * (-1038.152) (-1036.524) [-1037.215] (-1036.357) -- 0:00:07
877500 -- (-1038.171) (-1036.652) [-1033.745] (-1035.760) * [-1035.118] (-1037.854) (-1035.549) (-1040.221) -- 0:00:07
878000 -- (-1038.538) [-1034.913] (-1035.055) (-1035.984) * (-1033.967) [-1037.658] (-1034.910) (-1036.429) -- 0:00:07
878500 -- (-1045.299) (-1033.897) (-1035.837) [-1035.116] * (-1034.628) (-1036.581) (-1035.854) [-1037.473] -- 0:00:07
879000 -- (-1037.523) (-1038.825) [-1035.161] (-1037.194) * (-1034.958) (-1037.067) (-1036.368) [-1035.665] -- 0:00:07
879500 -- [-1037.354] (-1040.563) (-1036.990) (-1035.887) * (-1037.702) [-1033.655] (-1036.880) (-1034.916) -- 0:00:07
880000 -- [-1034.364] (-1034.032) (-1038.448) (-1035.469) * (-1035.719) (-1035.215) [-1034.993] (-1038.782) -- 0:00:07
Average standard deviation of split frequencies: 0.008672
880500 -- (-1036.288) [-1036.671] (-1040.400) (-1035.732) * (-1034.158) (-1037.957) [-1037.411] (-1034.319) -- 0:00:07
881000 -- [-1035.244] (-1037.417) (-1037.208) (-1036.053) * (-1034.058) (-1034.839) [-1041.082] (-1034.827) -- 0:00:07
881500 -- [-1033.486] (-1035.100) (-1034.139) (-1035.401) * (-1037.514) (-1034.440) [-1036.469] (-1035.099) -- 0:00:07
882000 -- (-1034.416) (-1036.504) (-1034.281) [-1034.886] * [-1035.077] (-1035.031) (-1035.489) (-1037.118) -- 0:00:07
882500 -- [-1034.862] (-1037.910) (-1035.630) (-1034.063) * (-1035.495) (-1036.065) (-1039.498) [-1035.365] -- 0:00:07
883000 -- [-1035.801] (-1036.012) (-1035.989) (-1034.555) * (-1035.710) (-1034.711) [-1038.476] (-1037.531) -- 0:00:07
883500 -- [-1034.693] (-1038.983) (-1035.904) (-1034.643) * (-1037.529) [-1036.796] (-1034.107) (-1035.017) -- 0:00:06
884000 -- (-1037.758) (-1035.679) [-1035.340] (-1036.560) * [-1040.406] (-1034.603) (-1034.158) (-1039.751) -- 0:00:06
884500 -- (-1035.068) (-1035.863) (-1034.249) [-1038.816] * (-1034.183) (-1034.307) [-1037.163] (-1035.293) -- 0:00:06
885000 -- (-1036.482) [-1035.277] (-1037.093) (-1038.247) * [-1034.791] (-1035.113) (-1036.618) (-1035.777) -- 0:00:07
Average standard deviation of split frequencies: 0.008655
885500 -- (-1033.490) [-1034.751] (-1035.221) (-1037.433) * (-1036.297) (-1040.534) [-1034.613] (-1038.030) -- 0:00:06
886000 -- (-1037.236) (-1036.905) (-1035.611) [-1034.525] * [-1037.518] (-1035.981) (-1034.830) (-1037.773) -- 0:00:06
886500 -- (-1036.373) (-1038.501) (-1036.445) [-1035.069] * [-1034.585] (-1035.375) (-1036.537) (-1034.379) -- 0:00:06
887000 -- (-1037.643) [-1039.034] (-1035.640) (-1039.267) * (-1036.705) [-1039.141] (-1039.728) (-1034.848) -- 0:00:06
887500 -- (-1038.689) (-1034.290) [-1035.366] (-1036.420) * (-1035.728) (-1034.601) [-1038.047] (-1034.820) -- 0:00:06
888000 -- (-1037.070) [-1034.922] (-1035.105) (-1034.882) * (-1035.579) [-1033.423] (-1034.105) (-1035.621) -- 0:00:06
888500 -- (-1036.312) [-1034.590] (-1040.274) (-1034.197) * (-1034.092) (-1034.171) [-1034.398] (-1033.664) -- 0:00:06
889000 -- (-1034.749) (-1035.347) [-1034.285] (-1035.078) * (-1037.157) (-1037.040) [-1037.590] (-1034.226) -- 0:00:06
889500 -- (-1033.657) (-1037.877) (-1036.992) [-1033.932] * (-1038.789) [-1037.086] (-1040.944) (-1034.803) -- 0:00:06
890000 -- [-1039.480] (-1037.028) (-1037.195) (-1034.521) * (-1038.306) (-1034.155) [-1036.880] (-1034.986) -- 0:00:06
Average standard deviation of split frequencies: 0.008568
890500 -- (-1034.575) (-1038.625) (-1034.526) [-1034.696] * [-1034.595] (-1034.066) (-1034.614) (-1034.529) -- 0:00:06
891000 -- [-1034.350] (-1034.721) (-1034.454) (-1036.445) * (-1037.153) (-1034.712) [-1034.939] (-1033.848) -- 0:00:06
891500 -- (-1034.859) (-1035.236) (-1037.109) [-1034.853] * [-1040.642] (-1036.437) (-1035.656) (-1034.250) -- 0:00:06
892000 -- (-1039.390) (-1035.938) (-1034.215) [-1034.974] * (-1039.750) [-1035.485] (-1039.583) (-1036.420) -- 0:00:06
892500 -- [-1033.877] (-1035.415) (-1041.898) (-1035.461) * [-1039.934] (-1037.383) (-1043.056) (-1035.601) -- 0:00:06
893000 -- (-1033.715) [-1034.771] (-1034.529) (-1041.368) * [-1033.785] (-1035.730) (-1035.213) (-1040.757) -- 0:00:06
893500 -- (-1035.971) (-1035.573) (-1035.101) [-1034.211] * (-1037.357) (-1036.639) [-1034.843] (-1034.501) -- 0:00:06
894000 -- [-1036.991] (-1036.121) (-1035.669) (-1035.401) * [-1035.388] (-1036.795) (-1035.353) (-1037.407) -- 0:00:06
894500 -- [-1036.675] (-1037.507) (-1036.773) (-1040.323) * (-1034.516) (-1036.998) [-1035.440] (-1038.855) -- 0:00:06
895000 -- (-1034.660) (-1035.788) (-1042.205) [-1038.599] * (-1037.029) (-1034.115) [-1038.833] (-1037.714) -- 0:00:06
Average standard deviation of split frequencies: 0.008385
895500 -- (-1039.715) [-1037.106] (-1035.041) (-1036.834) * [-1034.505] (-1034.519) (-1037.655) (-1035.866) -- 0:00:06
896000 -- (-1036.755) (-1042.829) (-1036.758) [-1037.439] * (-1034.903) [-1037.989] (-1035.279) (-1034.284) -- 0:00:06
896500 -- (-1035.204) (-1035.367) [-1040.667] (-1036.347) * [-1035.556] (-1042.953) (-1035.367) (-1034.763) -- 0:00:06
897000 -- [-1033.963] (-1036.480) (-1036.328) (-1039.054) * (-1034.035) [-1037.532] (-1034.767) (-1034.538) -- 0:00:06
897500 -- (-1035.192) [-1035.536] (-1036.740) (-1037.879) * (-1034.035) (-1035.412) [-1035.091] (-1035.124) -- 0:00:06
898000 -- (-1035.462) (-1034.610) (-1037.018) [-1035.926] * (-1037.116) (-1035.690) [-1035.705] (-1034.271) -- 0:00:06
898500 -- (-1035.603) (-1033.917) [-1034.809] (-1038.372) * (-1036.442) (-1036.462) [-1037.740] (-1034.017) -- 0:00:06
899000 -- [-1034.649] (-1033.804) (-1034.317) (-1042.409) * [-1035.738] (-1034.395) (-1035.482) (-1035.562) -- 0:00:06
899500 -- (-1036.103) [-1034.618] (-1037.539) (-1039.149) * [-1035.510] (-1034.289) (-1035.231) (-1034.181) -- 0:00:06
900000 -- (-1037.415) [-1034.618] (-1035.140) (-1036.463) * (-1034.276) (-1038.632) (-1034.429) [-1034.158] -- 0:00:06
Average standard deviation of split frequencies: 0.008165
900500 -- (-1035.917) [-1034.967] (-1037.108) (-1034.452) * (-1036.838) [-1036.004] (-1034.308) (-1035.037) -- 0:00:05
901000 -- [-1036.686] (-1034.409) (-1038.789) (-1035.507) * (-1034.218) (-1035.276) [-1034.896] (-1037.664) -- 0:00:06
901500 -- (-1034.835) (-1035.401) [-1035.774] (-1036.977) * (-1034.118) [-1035.079] (-1036.508) (-1035.586) -- 0:00:06
902000 -- [-1035.498] (-1033.968) (-1034.318) (-1034.765) * (-1034.918) [-1037.062] (-1034.242) (-1040.417) -- 0:00:05
902500 -- (-1034.979) (-1035.606) (-1034.903) [-1034.377] * (-1035.255) (-1040.696) [-1035.693] (-1038.066) -- 0:00:05
903000 -- (-1036.201) (-1037.180) (-1035.204) [-1038.174] * (-1035.355) [-1039.424] (-1033.797) (-1045.203) -- 0:00:05
903500 -- (-1036.278) (-1037.726) (-1037.154) [-1038.198] * (-1038.787) (-1036.664) [-1037.246] (-1035.333) -- 0:00:05
904000 -- (-1035.991) (-1035.053) [-1034.539] (-1036.974) * (-1033.387) (-1036.733) (-1038.918) [-1036.145] -- 0:00:05
904500 -- (-1034.210) [-1036.554] (-1037.345) (-1036.141) * (-1034.711) [-1035.922] (-1035.875) (-1036.023) -- 0:00:05
905000 -- (-1033.791) (-1035.440) (-1035.172) [-1033.985] * (-1037.041) [-1034.853] (-1035.687) (-1035.419) -- 0:00:05
Average standard deviation of split frequencies: 0.008293
905500 -- (-1034.748) (-1036.779) [-1035.974] (-1036.729) * (-1036.590) (-1034.843) (-1035.993) [-1035.865] -- 0:00:05
906000 -- (-1035.265) [-1038.644] (-1034.052) (-1037.242) * (-1034.804) (-1035.938) (-1034.862) [-1035.067] -- 0:00:05
906500 -- (-1037.266) (-1033.832) [-1036.599] (-1037.297) * (-1034.372) [-1037.618] (-1036.118) (-1036.596) -- 0:00:05
907000 -- (-1036.128) (-1036.540) [-1036.082] (-1035.768) * (-1034.302) [-1035.789] (-1034.844) (-1037.527) -- 0:00:05
907500 -- (-1036.072) (-1036.571) [-1036.015] (-1037.031) * (-1036.521) (-1034.670) (-1037.067) [-1037.050] -- 0:00:05
908000 -- (-1036.450) (-1034.359) (-1035.801) [-1035.791] * (-1034.929) (-1036.604) (-1044.027) [-1034.636] -- 0:00:05
908500 -- (-1044.031) (-1036.280) [-1034.291] (-1036.163) * (-1036.251) (-1035.648) (-1035.982) [-1036.878] -- 0:00:05
909000 -- [-1034.771] (-1034.334) (-1034.163) (-1037.168) * (-1035.297) (-1038.049) [-1035.666] (-1039.798) -- 0:00:05
909500 -- (-1035.743) [-1034.557] (-1034.770) (-1034.735) * (-1036.206) [-1035.322] (-1036.072) (-1039.525) -- 0:00:05
910000 -- (-1039.485) [-1034.223] (-1035.138) (-1036.380) * [-1035.784] (-1039.906) (-1034.305) (-1033.565) -- 0:00:05
Average standard deviation of split frequencies: 0.008476
910500 -- [-1035.635] (-1036.469) (-1034.521) (-1034.579) * [-1035.871] (-1034.887) (-1042.041) (-1037.870) -- 0:00:05
911000 -- (-1035.134) [-1034.744] (-1035.487) (-1036.684) * (-1041.212) [-1037.308] (-1037.040) (-1034.522) -- 0:00:05
911500 -- [-1035.191] (-1034.771) (-1034.754) (-1035.341) * [-1038.922] (-1035.186) (-1036.001) (-1037.739) -- 0:00:05
912000 -- [-1036.020] (-1036.200) (-1036.965) (-1034.391) * (-1037.263) (-1038.142) (-1035.578) [-1035.288] -- 0:00:05
912500 -- (-1036.017) (-1038.192) (-1037.761) [-1034.207] * (-1037.485) (-1036.694) (-1036.783) [-1035.456] -- 0:00:05
913000 -- (-1033.871) (-1037.258) (-1034.533) [-1038.317] * (-1034.846) (-1035.937) (-1038.858) [-1035.829] -- 0:00:05
913500 -- [-1033.478] (-1033.986) (-1035.299) (-1036.065) * (-1035.580) (-1035.309) [-1034.583] (-1036.303) -- 0:00:05
914000 -- (-1036.131) [-1035.515] (-1035.808) (-1037.848) * (-1036.246) (-1035.900) (-1034.202) [-1035.853] -- 0:00:05
914500 -- [-1035.496] (-1034.340) (-1035.491) (-1038.089) * [-1034.674] (-1037.307) (-1034.385) (-1037.339) -- 0:00:05
915000 -- (-1035.972) (-1037.226) (-1035.455) [-1037.051] * (-1038.870) (-1037.544) (-1034.779) [-1038.574] -- 0:00:05
Average standard deviation of split frequencies: 0.008166
915500 -- (-1036.940) [-1033.841] (-1033.793) (-1041.242) * [-1034.077] (-1039.471) (-1034.504) (-1036.065) -- 0:00:05
916000 -- (-1034.011) (-1036.231) (-1036.649) [-1034.412] * (-1035.305) [-1035.220] (-1034.216) (-1035.559) -- 0:00:05
916500 -- (-1036.482) (-1035.084) [-1036.006] (-1037.987) * (-1037.189) (-1034.460) [-1034.327] (-1035.320) -- 0:00:05
917000 -- (-1036.276) [-1041.189] (-1033.798) (-1035.367) * (-1038.272) [-1035.030] (-1034.516) (-1035.285) -- 0:00:04
917500 -- [-1035.738] (-1038.375) (-1033.580) (-1037.778) * (-1033.931) (-1037.428) [-1033.623] (-1034.880) -- 0:00:05
918000 -- (-1033.887) (-1039.296) [-1035.277] (-1036.600) * (-1035.664) [-1039.368] (-1034.974) (-1036.690) -- 0:00:05
918500 -- (-1037.009) [-1034.910] (-1036.429) (-1037.503) * (-1036.217) [-1036.246] (-1034.476) (-1040.648) -- 0:00:04
919000 -- (-1036.418) (-1037.006) (-1034.716) [-1034.711] * (-1035.758) (-1035.514) [-1034.193] (-1045.110) -- 0:00:04
919500 -- (-1037.176) [-1035.778] (-1034.787) (-1034.784) * (-1034.815) (-1035.200) (-1035.810) [-1036.460] -- 0:00:04
920000 -- [-1035.820] (-1034.886) (-1035.094) (-1035.396) * [-1035.249] (-1035.308) (-1034.670) (-1033.753) -- 0:00:04
Average standard deviation of split frequencies: 0.008397
920500 -- (-1035.332) (-1033.917) (-1036.358) [-1034.162] * (-1035.771) [-1034.438] (-1034.398) (-1034.364) -- 0:00:04
921000 -- [-1034.599] (-1037.139) (-1036.855) (-1033.603) * [-1033.870] (-1036.906) (-1037.500) (-1039.479) -- 0:00:04
921500 -- (-1035.778) (-1035.010) [-1038.045] (-1036.252) * (-1035.249) [-1039.413] (-1035.772) (-1036.832) -- 0:00:04
922000 -- [-1036.624] (-1035.422) (-1037.102) (-1034.930) * (-1034.187) [-1036.096] (-1035.005) (-1039.828) -- 0:00:04
922500 -- (-1037.245) (-1043.066) [-1036.459] (-1033.997) * (-1036.313) (-1037.339) (-1041.100) [-1036.474] -- 0:00:04
923000 -- (-1035.826) (-1035.109) (-1037.270) [-1033.544] * (-1038.102) (-1034.056) (-1036.050) [-1033.492] -- 0:00:04
923500 -- (-1035.014) (-1034.142) [-1034.503] (-1033.776) * (-1035.261) [-1035.248] (-1035.091) (-1035.793) -- 0:00:04
924000 -- (-1034.797) [-1034.009] (-1039.927) (-1034.044) * (-1035.999) (-1035.888) (-1034.970) [-1036.696] -- 0:00:04
924500 -- (-1034.979) (-1034.405) (-1034.096) [-1036.443] * (-1034.676) (-1035.804) [-1036.403] (-1035.479) -- 0:00:04
925000 -- [-1034.929] (-1034.403) (-1034.338) (-1035.392) * (-1037.180) [-1037.714] (-1033.799) (-1035.189) -- 0:00:04
Average standard deviation of split frequencies: 0.008281
925500 -- [-1035.630] (-1036.214) (-1034.744) (-1035.557) * (-1038.275) [-1035.454] (-1035.834) (-1037.297) -- 0:00:04
926000 -- (-1035.947) (-1036.300) (-1036.085) [-1035.304] * (-1037.424) [-1035.404] (-1037.368) (-1037.819) -- 0:00:04
926500 -- (-1038.809) [-1035.161] (-1035.441) (-1036.544) * (-1036.404) (-1038.722) (-1039.766) [-1035.144] -- 0:00:04
927000 -- (-1035.457) (-1038.370) (-1034.939) [-1033.564] * (-1035.980) (-1034.539) (-1039.714) [-1034.940] -- 0:00:04
927500 -- (-1036.720) (-1034.532) [-1035.887] (-1037.136) * [-1034.324] (-1034.208) (-1035.114) (-1038.864) -- 0:00:04
928000 -- (-1036.223) [-1034.223] (-1036.633) (-1038.144) * (-1034.880) (-1034.905) (-1041.108) [-1036.837] -- 0:00:04
928500 -- (-1035.175) [-1035.748] (-1040.541) (-1039.370) * [-1035.491] (-1040.177) (-1035.356) (-1034.158) -- 0:00:04
929000 -- (-1038.257) (-1037.409) (-1037.176) [-1035.858] * (-1038.989) (-1034.969) (-1035.484) [-1033.963] -- 0:00:04
929500 -- [-1035.722] (-1037.053) (-1035.395) (-1036.856) * (-1035.532) (-1041.340) [-1035.209] (-1042.105) -- 0:00:04
930000 -- [-1037.454] (-1034.275) (-1037.274) (-1034.688) * (-1036.211) (-1035.768) [-1038.242] (-1037.813) -- 0:00:04
Average standard deviation of split frequencies: 0.008071
930500 -- (-1037.556) [-1036.359] (-1034.563) (-1037.109) * (-1036.255) (-1035.260) [-1036.918] (-1035.902) -- 0:00:04
931000 -- (-1036.849) (-1039.244) (-1036.778) [-1036.336] * [-1035.050] (-1037.302) (-1035.447) (-1035.006) -- 0:00:04
931500 -- (-1035.842) [-1038.096] (-1041.378) (-1036.814) * [-1036.433] (-1036.790) (-1034.840) (-1034.576) -- 0:00:04
932000 -- [-1039.142] (-1035.600) (-1035.770) (-1038.923) * (-1033.566) (-1036.156) (-1036.576) [-1033.940] -- 0:00:04
932500 -- (-1037.092) [-1037.779] (-1034.641) (-1038.336) * (-1036.520) [-1035.544] (-1034.695) (-1034.012) -- 0:00:04
933000 -- (-1042.395) (-1035.754) (-1037.103) [-1037.952] * (-1037.409) (-1038.041) (-1040.680) [-1036.072] -- 0:00:04
933500 -- [-1035.647] (-1035.401) (-1036.492) (-1036.773) * (-1035.968) [-1037.001] (-1041.550) (-1041.166) -- 0:00:03
934000 -- [-1037.385] (-1034.777) (-1037.090) (-1035.641) * (-1035.479) (-1036.431) [-1034.646] (-1037.301) -- 0:00:04
934500 -- (-1036.438) (-1035.570) (-1033.899) [-1034.082] * (-1036.404) (-1036.454) (-1036.045) [-1034.909] -- 0:00:03
935000 -- [-1035.861] (-1035.459) (-1036.767) (-1036.805) * (-1034.748) (-1036.239) [-1036.732] (-1038.820) -- 0:00:03
Average standard deviation of split frequencies: 0.007857
935500 -- (-1037.877) (-1038.594) (-1035.501) [-1035.334] * [-1034.166] (-1036.498) (-1033.830) (-1034.288) -- 0:00:03
936000 -- [-1037.294] (-1036.843) (-1034.010) (-1035.090) * (-1035.730) [-1035.284] (-1034.375) (-1035.725) -- 0:00:03
936500 -- [-1035.814] (-1034.948) (-1036.773) (-1034.856) * (-1036.264) (-1035.631) [-1034.471] (-1036.877) -- 0:00:03
937000 -- (-1035.511) (-1034.808) [-1036.646] (-1036.784) * (-1036.224) [-1035.503] (-1036.133) (-1035.130) -- 0:00:03
937500 -- (-1036.585) [-1035.535] (-1035.169) (-1035.346) * (-1036.804) (-1038.341) [-1034.483] (-1036.178) -- 0:00:03
938000 -- [-1035.652] (-1036.162) (-1036.827) (-1036.044) * (-1035.451) (-1036.943) (-1037.988) [-1039.399] -- 0:00:03
938500 -- [-1034.852] (-1035.270) (-1036.280) (-1037.752) * (-1035.966) (-1035.825) [-1035.424] (-1036.324) -- 0:00:03
939000 -- (-1036.899) (-1036.457) [-1037.545] (-1040.012) * (-1037.239) (-1037.380) [-1034.680] (-1040.140) -- 0:00:03
939500 -- (-1036.527) [-1036.093] (-1037.789) (-1041.400) * (-1034.420) [-1036.178] (-1035.121) (-1044.617) -- 0:00:03
940000 -- (-1034.271) [-1035.754] (-1038.875) (-1036.851) * (-1038.390) (-1034.900) (-1034.931) [-1040.690] -- 0:00:03
Average standard deviation of split frequencies: 0.007885
940500 -- (-1036.556) (-1035.526) (-1036.860) [-1035.563] * (-1039.699) (-1037.052) [-1036.292] (-1034.629) -- 0:00:03
941000 -- (-1034.295) [-1035.643] (-1034.065) (-1034.125) * (-1038.123) (-1036.771) [-1035.023] (-1035.067) -- 0:00:03
941500 -- (-1036.537) (-1033.984) [-1035.750] (-1035.012) * (-1035.781) (-1034.766) [-1037.766] (-1035.215) -- 0:00:03
942000 -- (-1039.740) [-1034.879] (-1037.111) (-1034.456) * (-1035.722) [-1034.820] (-1034.585) (-1035.359) -- 0:00:03
942500 -- [-1034.511] (-1037.980) (-1034.537) (-1035.065) * [-1037.429] (-1035.515) (-1035.942) (-1042.231) -- 0:00:03
943000 -- (-1036.777) (-1038.249) (-1034.687) [-1034.412] * (-1035.280) [-1035.315] (-1034.509) (-1036.258) -- 0:00:03
943500 -- (-1034.707) (-1036.674) (-1034.565) [-1035.008] * (-1034.861) (-1033.666) (-1036.814) [-1036.342] -- 0:00:03
944000 -- (-1035.247) (-1037.545) (-1037.784) [-1039.246] * [-1035.097] (-1036.104) (-1037.140) (-1035.608) -- 0:00:03
944500 -- (-1033.833) (-1036.996) [-1036.722] (-1036.455) * (-1033.939) (-1036.325) [-1035.514] (-1039.987) -- 0:00:03
945000 -- [-1036.157] (-1033.984) (-1034.108) (-1034.680) * (-1033.546) (-1037.713) [-1036.619] (-1034.518) -- 0:00:03
Average standard deviation of split frequencies: 0.008206
945500 -- (-1035.289) [-1034.775] (-1033.919) (-1033.804) * (-1035.215) (-1037.762) (-1033.962) [-1034.651] -- 0:00:03
946000 -- (-1035.588) (-1035.397) (-1035.811) [-1033.855] * (-1036.633) (-1034.582) [-1036.234] (-1036.946) -- 0:00:03
946500 -- (-1036.019) (-1034.715) [-1035.764] (-1036.866) * (-1036.122) (-1034.823) [-1038.813] (-1038.706) -- 0:00:03
947000 -- (-1036.626) [-1034.444] (-1034.196) (-1036.118) * (-1034.893) (-1035.983) [-1036.222] (-1039.301) -- 0:00:03
947500 -- (-1037.700) [-1034.914] (-1034.276) (-1036.889) * [-1036.093] (-1036.688) (-1034.299) (-1035.185) -- 0:00:03
948000 -- (-1037.731) (-1035.423) [-1034.562] (-1035.415) * (-1034.967) (-1035.265) (-1037.161) [-1033.806] -- 0:00:03
948500 -- (-1036.451) [-1037.353] (-1035.208) (-1040.184) * [-1034.621] (-1033.754) (-1038.697) (-1035.260) -- 0:00:03
949000 -- (-1035.953) (-1034.662) [-1033.876] (-1043.017) * [-1036.883] (-1036.244) (-1038.661) (-1036.379) -- 0:00:03
949500 -- (-1036.695) (-1034.814) (-1034.990) [-1037.900] * (-1034.730) [-1035.323] (-1035.870) (-1034.358) -- 0:00:03
950000 -- (-1035.796) [-1036.268] (-1035.540) (-1035.706) * (-1035.190) [-1039.549] (-1036.915) (-1033.918) -- 0:00:03
Average standard deviation of split frequencies: 0.008616
950500 -- (-1037.752) [-1037.103] (-1035.270) (-1034.226) * (-1037.984) (-1039.171) [-1035.493] (-1035.693) -- 0:00:03
951000 -- [-1037.261] (-1035.311) (-1040.084) (-1034.692) * (-1033.917) (-1037.380) (-1036.719) [-1036.187] -- 0:00:02
951500 -- (-1036.709) (-1034.586) (-1036.646) [-1036.897] * (-1037.705) (-1039.076) (-1039.272) [-1034.379] -- 0:00:02
952000 -- (-1035.791) (-1034.807) [-1035.246] (-1034.932) * (-1039.346) (-1043.638) (-1037.431) [-1034.981] -- 0:00:02
952500 -- (-1041.190) (-1036.955) [-1033.776] (-1033.758) * [-1036.265] (-1037.406) (-1038.445) (-1034.663) -- 0:00:02
953000 -- [-1039.111] (-1034.204) (-1034.437) (-1034.383) * (-1041.300) [-1035.300] (-1036.427) (-1038.352) -- 0:00:02
953500 -- [-1037.744] (-1033.942) (-1034.972) (-1037.179) * (-1038.236) (-1035.075) (-1034.427) [-1034.592] -- 0:00:02
954000 -- (-1038.041) (-1035.093) (-1036.842) [-1039.230] * (-1042.006) [-1035.427] (-1034.637) (-1036.258) -- 0:00:02
954500 -- [-1033.876] (-1033.953) (-1039.058) (-1037.081) * (-1037.708) (-1039.523) [-1034.657] (-1037.002) -- 0:00:02
955000 -- (-1033.725) (-1034.016) [-1037.976] (-1034.943) * (-1034.002) (-1038.591) [-1035.837] (-1036.882) -- 0:00:02
Average standard deviation of split frequencies: 0.008414
955500 -- [-1033.952] (-1034.429) (-1037.335) (-1034.452) * (-1037.393) [-1034.499] (-1036.005) (-1036.002) -- 0:00:02
956000 -- (-1033.926) (-1038.214) [-1034.831] (-1035.285) * (-1036.623) (-1034.830) (-1035.558) [-1037.471] -- 0:00:02
956500 -- [-1037.383] (-1036.017) (-1039.975) (-1033.728) * (-1034.685) (-1033.983) (-1035.406) [-1036.215] -- 0:00:02
957000 -- (-1034.903) (-1040.681) (-1033.741) [-1039.902] * (-1033.549) (-1036.591) [-1034.810] (-1040.688) -- 0:00:02
957500 -- (-1035.033) (-1035.637) (-1036.901) [-1037.427] * (-1037.288) [-1035.393] (-1038.907) (-1035.860) -- 0:00:02
958000 -- (-1039.977) (-1035.268) [-1035.996] (-1037.906) * (-1039.872) [-1036.568] (-1036.862) (-1035.713) -- 0:00:02
958500 -- [-1035.019] (-1034.193) (-1039.210) (-1034.820) * (-1034.654) (-1037.721) (-1039.033) [-1037.197] -- 0:00:02
959000 -- (-1036.709) (-1033.985) [-1035.956] (-1036.794) * (-1038.600) [-1035.670] (-1039.531) (-1039.248) -- 0:00:02
959500 -- [-1036.741] (-1036.119) (-1039.921) (-1035.436) * (-1039.657) [-1035.699] (-1037.733) (-1036.141) -- 0:00:02
960000 -- (-1037.506) (-1034.917) (-1037.805) [-1035.505] * (-1038.358) (-1040.372) (-1038.942) [-1034.496] -- 0:00:02
Average standard deviation of split frequencies: 0.007982
960500 -- (-1037.306) [-1033.790] (-1037.106) (-1034.977) * (-1039.559) (-1037.091) (-1034.533) [-1040.498] -- 0:00:02
961000 -- [-1037.035] (-1034.528) (-1036.016) (-1034.752) * (-1041.153) (-1033.918) (-1036.176) [-1035.966] -- 0:00:02
961500 -- (-1035.552) (-1036.439) (-1036.298) [-1034.715] * (-1035.505) (-1034.159) (-1035.901) [-1036.838] -- 0:00:02
962000 -- [-1036.617] (-1036.763) (-1038.130) (-1035.643) * (-1034.077) [-1034.175] (-1033.629) (-1034.408) -- 0:00:02
962500 -- [-1036.652] (-1035.221) (-1038.681) (-1035.236) * (-1033.781) (-1035.623) [-1033.583] (-1035.895) -- 0:00:02
963000 -- (-1036.453) (-1036.419) (-1034.862) [-1033.495] * [-1035.708] (-1036.367) (-1035.705) (-1034.817) -- 0:00:02
963500 -- (-1037.525) [-1033.878] (-1034.500) (-1033.557) * [-1039.287] (-1037.895) (-1036.711) (-1037.307) -- 0:00:02
964000 -- (-1036.624) [-1036.391] (-1034.331) (-1035.581) * (-1036.733) (-1035.197) [-1033.839] (-1036.675) -- 0:00:02
964500 -- (-1034.159) [-1035.151] (-1035.036) (-1036.394) * (-1036.994) (-1038.023) [-1035.154] (-1035.622) -- 0:00:02
965000 -- [-1033.904] (-1036.568) (-1035.379) (-1036.630) * (-1035.322) (-1034.589) (-1035.219) [-1035.351] -- 0:00:02
Average standard deviation of split frequencies: 0.008101
965500 -- (-1034.157) (-1040.197) [-1037.314] (-1035.924) * (-1036.108) (-1035.410) (-1034.614) [-1034.526] -- 0:00:02
966000 -- (-1035.662) [-1039.478] (-1036.073) (-1040.184) * [-1034.619] (-1035.865) (-1035.316) (-1033.841) -- 0:00:02
966500 -- (-1035.232) (-1035.025) (-1040.229) [-1034.486] * [-1035.511] (-1034.348) (-1035.715) (-1033.841) -- 0:00:02
967000 -- (-1037.673) (-1034.628) (-1039.498) [-1034.657] * (-1036.464) [-1035.767] (-1036.354) (-1035.877) -- 0:00:02
967500 -- (-1037.702) [-1034.678] (-1035.784) (-1034.037) * (-1034.055) [-1035.643] (-1034.672) (-1034.133) -- 0:00:01
968000 -- (-1037.990) (-1037.250) (-1033.712) [-1034.817] * [-1037.269] (-1037.241) (-1035.584) (-1035.936) -- 0:00:01
968500 -- (-1037.817) (-1037.420) [-1034.163] (-1034.513) * (-1036.894) (-1039.061) (-1044.685) [-1036.943] -- 0:00:01
969000 -- (-1034.367) (-1035.726) (-1037.247) [-1034.998] * (-1036.893) (-1037.968) (-1036.320) [-1034.977] -- 0:00:01
969500 -- (-1035.887) (-1037.212) [-1034.882] (-1034.056) * [-1036.888] (-1034.190) (-1034.201) (-1037.408) -- 0:00:01
970000 -- (-1033.703) (-1036.192) (-1036.569) [-1036.244] * [-1034.512] (-1034.549) (-1036.609) (-1036.911) -- 0:00:01
Average standard deviation of split frequencies: 0.007803
970500 -- [-1035.043] (-1034.750) (-1034.890) (-1035.927) * [-1034.835] (-1034.604) (-1035.317) (-1038.278) -- 0:00:01
971000 -- (-1035.030) (-1034.458) (-1036.248) [-1036.721] * (-1036.594) [-1034.400] (-1038.232) (-1035.884) -- 0:00:01
971500 -- (-1034.376) [-1035.291] (-1036.698) (-1036.016) * (-1037.031) (-1034.379) (-1035.094) [-1035.268] -- 0:00:01
972000 -- (-1035.295) [-1035.415] (-1036.116) (-1035.713) * [-1035.182] (-1039.954) (-1034.295) (-1034.948) -- 0:00:01
972500 -- (-1040.112) (-1035.037) [-1034.972] (-1037.766) * (-1035.471) (-1039.597) (-1034.252) [-1036.693] -- 0:00:01
973000 -- (-1041.194) (-1034.932) (-1035.286) [-1039.109] * [-1036.146] (-1038.767) (-1034.289) (-1038.413) -- 0:00:01
973500 -- (-1038.403) (-1034.529) (-1034.786) [-1035.305] * (-1036.956) [-1034.417] (-1035.681) (-1037.077) -- 0:00:01
974000 -- (-1033.948) (-1034.664) [-1033.842] (-1034.305) * (-1038.095) [-1038.270] (-1037.665) (-1038.479) -- 0:00:01
974500 -- (-1035.480) [-1035.233] (-1036.903) (-1039.346) * (-1035.304) (-1037.042) [-1036.829] (-1036.239) -- 0:00:01
975000 -- (-1035.206) (-1034.451) [-1035.092] (-1039.484) * (-1036.325) (-1035.800) [-1033.740] (-1036.453) -- 0:00:01
Average standard deviation of split frequencies: 0.007309
975500 -- (-1034.663) [-1034.691] (-1035.047) (-1036.768) * [-1036.938] (-1034.066) (-1035.684) (-1034.125) -- 0:00:01
976000 -- [-1033.789] (-1039.727) (-1034.571) (-1036.630) * (-1035.319) (-1035.049) [-1040.663] (-1034.063) -- 0:00:01
976500 -- (-1033.905) (-1035.741) [-1033.749] (-1036.351) * (-1034.783) (-1034.452) (-1035.261) [-1035.438] -- 0:00:01
977000 -- (-1034.035) (-1036.472) [-1033.479] (-1034.112) * (-1038.469) (-1033.804) (-1039.782) [-1035.662] -- 0:00:01
977500 -- [-1038.654] (-1035.437) (-1034.361) (-1035.064) * (-1036.075) [-1036.270] (-1033.591) (-1034.718) -- 0:00:01
978000 -- [-1034.249] (-1037.799) (-1039.183) (-1037.749) * (-1038.768) [-1036.759] (-1033.951) (-1037.945) -- 0:00:01
978500 -- (-1044.652) (-1036.273) (-1036.218) [-1038.839] * [-1043.473] (-1037.250) (-1035.202) (-1035.779) -- 0:00:01
979000 -- (-1037.611) (-1035.731) (-1035.455) [-1038.601] * (-1035.902) [-1040.581] (-1034.809) (-1034.340) -- 0:00:01
979500 -- [-1037.430] (-1034.225) (-1040.623) (-1034.354) * (-1035.152) [-1040.301] (-1034.622) (-1035.702) -- 0:00:01
980000 -- (-1036.789) (-1037.921) (-1035.025) [-1034.656] * (-1037.271) (-1036.196) (-1034.606) [-1035.181] -- 0:00:01
Average standard deviation of split frequencies: 0.007243
980500 -- (-1033.769) (-1039.155) [-1036.251] (-1034.560) * [-1037.828] (-1035.169) (-1034.150) (-1037.413) -- 0:00:01
981000 -- (-1036.558) (-1038.262) (-1036.023) [-1037.382] * [-1034.731] (-1035.983) (-1034.155) (-1035.897) -- 0:00:01
981500 -- (-1035.326) [-1035.352] (-1038.413) (-1035.234) * (-1039.036) [-1036.155] (-1035.211) (-1037.342) -- 0:00:01
982000 -- [-1036.874] (-1040.048) (-1035.755) (-1036.563) * (-1035.076) (-1038.202) [-1033.736] (-1035.298) -- 0:00:01
982500 -- [-1035.432] (-1037.027) (-1037.136) (-1036.643) * (-1037.719) (-1037.149) [-1035.358] (-1034.364) -- 0:00:01
983000 -- (-1035.299) (-1035.963) (-1038.880) [-1035.849] * (-1037.586) (-1035.715) [-1035.121] (-1036.201) -- 0:00:01
983500 -- (-1034.719) [-1034.979] (-1039.156) (-1034.712) * (-1039.613) [-1035.853] (-1034.242) (-1038.495) -- 0:00:01
984000 -- (-1038.394) (-1034.904) (-1043.795) [-1034.281] * (-1039.512) [-1036.055] (-1034.212) (-1034.695) -- 0:00:00
984500 -- (-1035.908) [-1035.751] (-1034.620) (-1033.678) * (-1037.791) [-1034.312] (-1037.224) (-1037.705) -- 0:00:00
985000 -- (-1033.560) [-1036.316] (-1034.443) (-1039.315) * (-1036.870) (-1035.370) [-1037.826] (-1037.815) -- 0:00:00
Average standard deviation of split frequencies: 0.007363
985500 -- (-1038.621) (-1036.061) [-1035.830] (-1035.281) * (-1036.023) [-1034.791] (-1039.224) (-1035.689) -- 0:00:00
986000 -- (-1035.512) [-1036.071] (-1034.852) (-1036.829) * (-1036.077) (-1036.925) (-1036.014) [-1033.611] -- 0:00:00
986500 -- [-1035.342] (-1036.404) (-1035.624) (-1034.016) * (-1041.211) (-1033.589) [-1035.056] (-1035.025) -- 0:00:00
987000 -- [-1034.818] (-1036.610) (-1035.540) (-1036.433) * (-1039.014) (-1033.946) [-1035.762] (-1036.762) -- 0:00:00
987500 -- (-1034.127) [-1034.027] (-1041.150) (-1035.773) * (-1036.464) [-1039.154] (-1035.179) (-1037.405) -- 0:00:00
988000 -- (-1034.642) (-1034.437) [-1035.685] (-1034.918) * (-1040.398) (-1037.505) [-1034.576] (-1036.728) -- 0:00:00
988500 -- (-1035.092) [-1034.571] (-1036.252) (-1034.621) * (-1036.237) [-1036.127] (-1034.052) (-1038.720) -- 0:00:00
989000 -- (-1037.174) (-1038.710) [-1037.051] (-1034.952) * (-1035.477) (-1036.983) (-1037.002) [-1034.768] -- 0:00:00
989500 -- (-1034.573) (-1034.681) (-1037.853) [-1034.745] * (-1038.584) (-1039.638) [-1039.028] (-1037.821) -- 0:00:00
990000 -- (-1034.358) (-1037.269) [-1041.509] (-1034.459) * (-1035.528) [-1033.664] (-1036.952) (-1036.313) -- 0:00:00
Average standard deviation of split frequencies: 0.007360
990500 -- (-1034.881) (-1035.686) (-1037.160) [-1040.690] * (-1035.932) (-1037.578) (-1042.424) [-1034.800] -- 0:00:00
991000 -- (-1036.240) (-1035.144) [-1035.326] (-1037.271) * (-1037.740) [-1034.439] (-1041.417) (-1034.641) -- 0:00:00
991500 -- (-1034.958) (-1037.408) [-1034.666] (-1034.716) * (-1034.188) [-1038.463] (-1036.977) (-1034.978) -- 0:00:00
992000 -- (-1038.006) (-1035.318) (-1034.447) [-1035.665] * (-1035.160) [-1037.580] (-1035.616) (-1036.974) -- 0:00:00
992500 -- (-1034.738) (-1035.379) [-1034.053] (-1037.987) * (-1038.564) (-1036.755) [-1035.386] (-1035.113) -- 0:00:00
993000 -- (-1033.973) [-1036.537] (-1035.912) (-1035.625) * (-1040.939) (-1035.874) [-1036.193] (-1035.002) -- 0:00:00
993500 -- [-1034.450] (-1039.247) (-1037.380) (-1034.160) * (-1034.933) [-1035.197] (-1036.763) (-1038.420) -- 0:00:00
994000 -- [-1036.324] (-1036.383) (-1038.727) (-1034.758) * (-1037.482) (-1036.225) [-1035.480] (-1036.962) -- 0:00:00
994500 -- (-1039.180) (-1037.033) [-1034.231] (-1036.386) * (-1039.549) (-1037.888) (-1036.365) [-1034.784] -- 0:00:00
995000 -- (-1040.243) (-1036.921) [-1035.918] (-1033.554) * (-1037.759) (-1036.157) (-1035.264) [-1036.068] -- 0:00:00
Average standard deviation of split frequencies: 0.007131
995500 -- (-1033.922) [-1035.099] (-1035.216) (-1037.104) * (-1038.600) (-1035.958) [-1039.887] (-1034.104) -- 0:00:00
996000 -- (-1038.865) (-1034.010) [-1034.433] (-1034.257) * [-1036.547] (-1035.125) (-1039.712) (-1036.676) -- 0:00:00
996500 -- (-1035.853) (-1035.289) [-1036.196] (-1037.064) * (-1034.740) (-1036.539) [-1037.057] (-1037.632) -- 0:00:00
997000 -- (-1039.508) (-1035.090) (-1034.618) [-1038.012] * (-1033.690) (-1036.967) (-1039.904) [-1037.340] -- 0:00:00
997500 -- (-1039.375) [-1037.215] (-1040.421) (-1035.081) * (-1034.489) (-1034.591) [-1036.196] (-1034.218) -- 0:00:00
998000 -- (-1034.712) (-1037.904) (-1038.337) [-1036.018] * (-1033.957) [-1033.705] (-1036.875) (-1034.780) -- 0:00:00
998500 -- [-1036.171] (-1035.568) (-1037.106) (-1036.302) * (-1037.615) (-1035.909) (-1034.054) [-1035.724] -- 0:00:00
999000 -- [-1034.777] (-1035.396) (-1034.834) (-1036.831) * (-1038.414) (-1037.091) [-1034.570] (-1037.470) -- 0:00:00
999500 -- (-1034.992) [-1033.891] (-1034.694) (-1033.633) * (-1038.953) (-1037.380) (-1034.057) [-1039.345] -- 0:00:00
1000000 -- [-1038.852] (-1033.822) (-1037.976) (-1033.634) * (-1041.193) (-1037.044) [-1036.785] (-1038.704) -- 0:00:00
Average standard deviation of split frequencies: 0.007192
Analysis completed in 1 mins 1 seconds
Analysis used 59.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1033.32
Likelihood of best state for "cold" chain of run 2 was -1033.32
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.3 % ( 26 %) Dirichlet(Pi{all})
29.7 % ( 27 %) Slider(Pi{all})
78.7 % ( 62 %) Multiplier(Alpha{1,2})
77.6 % ( 56 %) Multiplier(Alpha{3})
19.7 % ( 37 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.7 % ( 27 %) Dirichlet(Pi{all})
29.4 % ( 25 %) Slider(Pi{all})
78.6 % ( 42 %) Multiplier(Alpha{1,2})
78.3 % ( 49 %) Multiplier(Alpha{3})
20.3 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166339 0.82 0.67
3 | 167714 166220 0.84
4 | 166460 166292 166975
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166397 0.82 0.67
3 | 166904 166421 0.84
4 | 166599 166924 166755
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1035.02
| 2 |
| 1 2 1 2 |
| 1 2 1 2 |
| 2 1 2 12 1 2 1 2 1 |
| 2 1 1 1 1 |
| 222 2 2 1 1 1 1 1 1 1 *21 2 |
| 12 22 2 11 2 1 12*1 * * 1 1 |
|1 1 11 2 2 22 2 2 * 1 |
| 12 1 1 21 2 11 2 1 2 |
| 2 1 1 2 2 2 2 1|
| 1 1 2 2 12 |
|2 1 1 1 1 2 1 1 2 2 2|
| 2 1 2 2 1 |
| 2 |
| 2 22 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1036.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1035.00 -1038.08
2 -1035.05 -1038.50
--------------------------------------
TOTAL -1035.02 -1038.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892256 0.091547 0.323435 1.464759 0.858998 1465.42 1483.21 1.002
r(A<->C){all} 0.165712 0.020800 0.000012 0.448054 0.125433 118.33 128.36 1.001
r(A<->G){all} 0.170926 0.019692 0.000101 0.455641 0.138380 205.52 233.02 1.000
r(A<->T){all} 0.167144 0.019758 0.000027 0.445220 0.134157 149.62 226.64 1.006
r(C<->G){all} 0.156831 0.017313 0.000042 0.425410 0.122403 267.85 276.52 1.000
r(C<->T){all} 0.167570 0.020565 0.000010 0.457438 0.130056 178.07 230.84 1.000
r(G<->T){all} 0.171817 0.019006 0.000051 0.441436 0.140070 171.45 220.89 1.001
pi(A){all} 0.176967 0.000194 0.148734 0.202392 0.176653 1302.71 1354.88 1.000
pi(C){all} 0.280770 0.000262 0.251175 0.314800 0.280702 1223.51 1258.29 1.000
pi(G){all} 0.321290 0.000273 0.290516 0.354177 0.320745 1192.05 1220.24 1.000
pi(T){all} 0.220973 0.000222 0.193410 0.251933 0.220503 1261.54 1340.65 1.000
alpha{1,2} 0.441312 0.259045 0.000175 1.448115 0.262177 1092.28 1234.20 1.001
alpha{3} 0.464769 0.246824 0.000116 1.461967 0.301316 1177.94 1232.12 1.000
pinvar{all} 0.997970 0.000006 0.993396 0.999999 0.998738 1319.88 1330.93 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..*.*.
9 -- .*...*
10 -- .**...
11 -- ..**..
12 -- .**.**
13 -- ...**.
14 -- ..*..*
15 -- ..****
16 -- ...*.*
17 -- .*..*.
18 -- ....**
19 -- .*.***
20 -- .***.*
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.010835 0.144570 0.159893 2
8 455 0.151566 0.004240 0.148568 0.154564 2
9 444 0.147901 0.000000 0.147901 0.147901 2
10 441 0.146902 0.001413 0.145903 0.147901 2
11 438 0.145903 0.001884 0.144570 0.147235 2
12 435 0.144903 0.014604 0.134577 0.155230 2
13 434 0.144570 0.006595 0.139907 0.149234 2
14 424 0.141239 0.011306 0.133245 0.149234 2
15 422 0.140573 0.005653 0.136576 0.144570 2
16 422 0.140573 0.002827 0.138574 0.142572 2
17 421 0.140240 0.006124 0.135909 0.144570 2
18 415 0.138241 0.010835 0.130580 0.145903 2
19 411 0.136909 0.010835 0.129247 0.144570 2
20 410 0.136576 0.010364 0.129247 0.143904 2
21 404 0.134577 0.010364 0.127249 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/nth/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098154 0.009722 0.000020 0.300657 0.067827 1.000 2
length{all}[2] 0.102441 0.010160 0.000019 0.295928 0.074879 1.001 2
length{all}[3] 0.096678 0.009478 0.000035 0.293420 0.067718 1.000 2
length{all}[4] 0.101870 0.011315 0.000013 0.302702 0.070305 1.000 2
length{all}[5] 0.096606 0.009453 0.000119 0.290187 0.067146 1.000 2
length{all}[6] 0.099543 0.009862 0.000003 0.295464 0.068878 1.000 2
length{all}[7] 0.097614 0.009051 0.000050 0.283033 0.070132 1.007 2
length{all}[8] 0.105058 0.010673 0.000241 0.315605 0.073318 1.001 2
length{all}[9] 0.102154 0.009404 0.000151 0.279102 0.073521 0.998 2
length{all}[10] 0.091301 0.007952 0.000020 0.272836 0.065063 1.005 2
length{all}[11] 0.096356 0.008921 0.000151 0.271944 0.071554 0.999 2
length{all}[12] 0.099043 0.010181 0.000134 0.309086 0.064889 1.005 2
length{all}[13] 0.098295 0.009551 0.000211 0.285642 0.066723 0.998 2
length{all}[14] 0.098447 0.010768 0.000072 0.290407 0.071469 0.999 2
length{all}[15] 0.098943 0.010822 0.000213 0.298726 0.072653 0.999 2
length{all}[16] 0.103186 0.010047 0.000193 0.304182 0.074454 0.999 2
length{all}[17] 0.099110 0.009637 0.000642 0.303162 0.068963 0.999 2
length{all}[18] 0.095723 0.010128 0.000000 0.291373 0.062828 0.999 2
length{all}[19] 0.100504 0.010850 0.000361 0.298302 0.067164 1.005 2
length{all}[20] 0.101667 0.012265 0.000124 0.312935 0.065772 0.999 2
length{all}[21] 0.094421 0.009728 0.000230 0.279106 0.065052 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007192
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 759
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 253 / 253 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 253 / 253 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103631 0.108528 0.013736 0.069866 0.068248 0.040362 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1114.560158
Iterating by ming2
Initial: fx= 1114.560158
x= 0.10363 0.10853 0.01374 0.06987 0.06825 0.04036 0.30000 1.30000
1 h-m-p 0.0000 0.0001 606.1481 ++ 1094.328846 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0043 84.6958 ----------.. | 1/8
3 h-m-p 0.0000 0.0001 553.5991 ++ 1061.429528 m 0.0001 43 | 2/8
4 h-m-p 0.0008 0.0057 66.2149 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 496.5608 ++ 1033.574637 m 0.0001 74 | 3/8
6 h-m-p 0.0010 0.0091 46.9195 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 431.5667 ++ 1032.356433 m 0.0000 105 | 4/8
8 h-m-p 0.0001 0.0141 33.3848 ---------.. | 4/8
9 h-m-p 0.0000 0.0001 351.7565 ++ 1015.322107 m 0.0001 134 | 5/8
10 h-m-p 0.0016 0.0236 21.6179 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 250.0304 ++ 1014.075916 m 0.0000 165 | 6/8
12 h-m-p 0.0741 8.0000 0.0000 -Y 1014.075916 0 0.0046 177 | 6/8
13 h-m-p 0.5799 8.0000 0.0000 -Y 1014.075916 0 0.0362 191
Out..
lnL = -1014.075916
192 lfun, 192 eigenQcodon, 1152 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061189 0.060721 0.087259 0.036033 0.078074 0.041012 0.299879 0.741241 0.432756
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.474655
np = 9
lnL0 = -1102.764548
Iterating by ming2
Initial: fx= 1102.764548
x= 0.06119 0.06072 0.08726 0.03603 0.07807 0.04101 0.29988 0.74124 0.43276
1 h-m-p 0.0000 0.0002 585.5364 ++ 1050.763811 m 0.0002 14 | 1/9
2 h-m-p 0.0000 0.0001 323.0338 ++ 1044.602509 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 4840.7412 ++ 1025.544970 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 1114.0466 ++ 1025.170848 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 377883.9513 ++ 1016.367675 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 64328.9633 ++ 1014.075850 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1014.075850 m 8.0000 86 | 6/9
8 h-m-p 0.0157 7.8315 0.1256 -------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075850 m 8.0000 130 | 6/9
10 h-m-p 0.0074 3.7212 0.2842 -----------Y 1014.075850 0 0.0000 156 | 6/9
11 h-m-p 0.0160 8.0000 0.0019 +++++ 1014.075847 m 8.0000 174 | 6/9
12 h-m-p 0.0542 3.4565 0.2748 ----------C 1014.075847 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0039 +++++ 1014.075841 m 8.0000 217 | 6/9
14 h-m-p 0.1127 3.7514 0.2784 -----------C 1014.075841 0 0.0000 243 | 6/9
15 h-m-p 0.0160 8.0000 0.0001 -----N 1014.075841 0 0.0000 263 | 6/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1014.075841 m 8.0000 281 | 6/9
17 h-m-p 0.0090 4.4816 0.2493 -------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075840 m 8.0000 325 | 6/9
19 h-m-p 0.0083 4.1593 0.2620 ------------Y 1014.075840 0 0.0000 352 | 6/9
20 h-m-p 0.0160 8.0000 0.0004 +++++ 1014.075840 m 8.0000 370 | 6/9
21 h-m-p 0.0103 2.4038 0.3216 ---------C 1014.075840 0 0.0000 394 | 6/9
22 h-m-p 0.0160 8.0000 0.0007 +++++ 1014.075839 m 8.0000 412 | 6/9
23 h-m-p 0.0191 1.9877 0.2900 -------------.. | 6/9
24 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075838 m 8.0000 456 | 6/9
25 h-m-p 0.0085 4.2401 0.2598 -------------.. | 6/9
26 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075838 m 8.0000 500 | 6/9
27 h-m-p 0.0086 4.3233 0.2552 ---------C 1014.075838 0 0.0000 524 | 6/9
28 h-m-p 0.0160 8.0000 0.0003 +++++ 1014.075838 m 8.0000 542 | 6/9
29 h-m-p 0.0069 1.8856 0.4025 -----------C 1014.075838 0 0.0000 568 | 6/9
30 h-m-p 0.0160 8.0000 0.0002 ----C 1014.075838 0 0.0000 587 | 6/9
31 h-m-p 0.0160 8.0000 0.0001 +++++ 1014.075837 m 8.0000 605 | 6/9
32 h-m-p 0.0038 1.9075 0.4060 ----------Y 1014.075837 0 0.0000 630 | 6/9
33 h-m-p 0.0070 3.4966 0.2219 -------------.. | 6/9
34 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075837 m 8.0000 674 | 6/9
35 h-m-p 0.0088 4.4093 0.2522 -------------.. | 6/9
36 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075836 m 8.0000 718 | 6/9
37 h-m-p 0.0087 4.3576 0.2556 ---------C 1014.075836 0 0.0000 742 | 6/9
38 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075836 m 8.0000 760 | 6/9
39 h-m-p 0.0012 0.2846 1.6033 ----------C 1014.075836 0 0.0000 785 | 6/9
40 h-m-p 0.0160 8.0000 0.0002 +++++ 1014.075836 m 8.0000 800 | 6/9
41 h-m-p 0.0026 0.4694 0.5909 ++++ 1014.075824 m 0.4694 817 | 7/9
42 h-m-p 0.1501 0.7506 0.4006 ++ 1014.075696 m 0.7506 832 | 8/9
43 h-m-p 0.5718 8.0000 0.0264 ++ 1014.075635 m 8.0000 846 | 8/9
44 h-m-p 0.2118 8.0000 0.9988 --------------Y 1014.075635 0 0.0000 873 | 8/9
45 h-m-p 0.0160 8.0000 0.0000 +++++ 1014.075635 m 8.0000 889 | 8/9
46 h-m-p 0.0160 8.0000 0.9667 ------------Y 1014.075635 0 0.0000 914 | 8/9
47 h-m-p 0.0160 8.0000 0.0000 +++++ 1014.075635 m 8.0000 930 | 8/9
48 h-m-p 0.0160 8.0000 0.9241 -------------.. | 8/9
49 h-m-p 0.0160 8.0000 0.0003 +++++ 1014.075634 m 8.0000 970 | 8/9
50 h-m-p 0.0160 8.0000 0.8318 ------------C 1014.075634 0 0.0000 995 | 8/9
51 h-m-p 0.0160 8.0000 0.0000 +++++ 1014.075634 m 8.0000 1011 | 8/9
52 h-m-p 0.0000 0.0100 5.2026 +++++ 1014.075617 m 0.0100 1027 | 9/9
53 h-m-p 0.0160 8.0000 0.0000 Y 1014.075617 0 0.0160 1039 | 9/9
54 h-m-p 0.0160 8.0000 0.0000 Y 1014.075617 0 0.0160 1051
Out..
lnL = -1014.075617
1052 lfun, 3156 eigenQcodon, 12624 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033099 0.039916 0.106512 0.070831 0.057952 0.081691 0.000100 1.374861 0.129946 0.361205 1.529847
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.963831
np = 11
lnL0 = -1106.041177
Iterating by ming2
Initial: fx= 1106.041177
x= 0.03310 0.03992 0.10651 0.07083 0.05795 0.08169 0.00011 1.37486 0.12995 0.36120 1.52985
1 h-m-p 0.0000 0.0000 551.7892 ++ 1105.427959 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 365.8897 +++ 1058.901952 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 501.7923 ++ 1051.825107 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0007 168.1010 ++ 1033.948928 m 0.0007 59 | 4/11
5 h-m-p 0.0000 0.0000 4588.8361 ++ 1024.983268 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 1611.6687 ++ 1022.715932 m 0.0000 87 | 6/11
7 h-m-p 0.0004 0.0021 22.2166 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 336.8222 ++ 1019.857288 m 0.0000 124 | 7/11
9 h-m-p 0.0160 8.0000 6.3453 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 239.6682 ++ 1014.075826 m 0.0001 163 | 8/11
11 h-m-p 0.3090 8.0000 0.0000 +++ 1014.075826 m 8.0000 178 | 8/11
12 h-m-p 0.0160 8.0000 0.0399 --------N 1014.075826 0 0.0000 203 | 8/11
13 h-m-p 0.0160 8.0000 0.0298 +++++ 1014.075819 m 8.0000 223 | 8/11
14 h-m-p 0.0473 8.0000 5.0376 ------------Y 1014.075819 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1014.075819 m 8.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 0.0125 +++++ 1014.075815 m 8.0000 289 | 8/11
17 h-m-p 0.0041 0.0206 14.0272 ++ 1014.075806 m 0.0206 306 | 9/11
18 h-m-p 0.5982 8.0000 0.2083 +Y 1014.075801 0 4.3704 321 | 9/11
19 h-m-p 1.6000 8.0000 0.0206 Y 1014.075801 0 1.0913 337 | 9/11
20 h-m-p 1.6000 8.0000 0.0001 Y 1014.075801 0 2.6875 353 | 9/11
21 h-m-p 1.6000 8.0000 0.0001 ++ 1014.075801 m 8.0000 369 | 9/11
22 h-m-p 0.3771 8.0000 0.0014 +Y 1014.075801 0 3.4169 386 | 9/11
23 h-m-p 1.6000 8.0000 0.0000 ++ 1014.075801 m 8.0000 402 | 9/11
24 h-m-p 0.0160 8.0000 0.8364 +++++ 1014.075706 m 8.0000 421 | 9/11
25 h-m-p 1.6000 8.0000 2.6185 ++ 1014.075617 m 8.0000 437 | 9/11
26 h-m-p 1.6000 8.0000 0.1939 ++ 1014.075617 m 8.0000 451 | 9/11
27 h-m-p 0.5300 8.0000 2.9275 ++ 1014.075617 m 8.0000 467 | 9/11
28 h-m-p 1.6000 8.0000 2.3621 ++ 1014.075617 m 8.0000 481 | 9/11
29 h-m-p 0.5308 2.6542 11.4355 ++ 1014.075617 m 2.6542 495 | 9/11
30 h-m-p 1.6000 8.0000 0.0000 N 1014.075617 0 1.6000 509 | 9/11
31 h-m-p 0.0160 8.0000 0.0000 N 1014.075617 0 0.0160 525
Out..
lnL = -1014.075617
526 lfun, 2104 eigenQcodon, 9468 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1014.120876 S = -1014.076531 -0.017109
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:06
did 20 / 57 patterns 0:06
did 30 / 57 patterns 0:06
did 40 / 57 patterns 0:06
did 50 / 57 patterns 0:06
did 57 / 57 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083363 0.087229 0.067712 0.106170 0.046408 0.068258 0.000100 0.396627 1.822085
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.669051
np = 9
lnL0 = -1119.445221
Iterating by ming2
Initial: fx= 1119.445221
x= 0.08336 0.08723 0.06771 0.10617 0.04641 0.06826 0.00011 0.39663 1.82209
1 h-m-p 0.0000 0.0000 532.6976 ++ 1119.241099 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0079 52.8516 +++++ 1106.046999 m 0.0079 29 | 2/9
3 h-m-p 0.0001 0.0005 921.3953 ++ 1069.060858 m 0.0005 41 | 3/9
4 h-m-p 0.0069 0.0585 62.7246
QuantileBeta(0.15, 0.00500, 2.98026) = 8.246267e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
+ 1047.017715 m 0.0585 53
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.815846e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.91689) = 4.653394e-161 2000 rounds
| 4/9
5 h-m-p 0.0001 0.0005 705.0098
QuantileBeta(0.15, 0.00500, 4.84631) = 4.728591e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.63459) = 4.969460e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
+ 1030.031116 m 0.0005 65
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.231762e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.56401) = 5.055280e-161 2000 rounds
| 5/9
6 h-m-p 0.0000 0.0001 4534.8117
QuantileBeta(0.15, 0.00500, 4.43366) = 5.221825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04262) = 5.794277e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
+ 1025.587724 m 0.0001 77
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.223892e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91227) = 6.013943e-161 2000 rounds
| 6/9
7 h-m-p 0.0000 0.0002 11398.5352
QuantileBeta(0.15, 0.00500, 3.38841) = 7.094040e-161 2000 rounds
++ 1021.639137 m 0.0002 89 | 7/9
8 h-m-p 0.0007 0.0035 366.8994 -----------.. | 7/9
9 h-m-p 0.0000 0.0001 230.8448 ++ 1014.075617 m 0.0001 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 1014.075617 0 1.6000 134
Out..
lnL = -1014.075617
135 lfun, 1485 eigenQcodon, 8100 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071983 0.108161 0.019862 0.038032 0.021510 0.065688 0.000100 0.900000 1.160382 1.653181 1.299879
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.436059
np = 11
lnL0 = -1091.114029
Iterating by ming2
Initial: fx= 1091.114029
x= 0.07198 0.10816 0.01986 0.03803 0.02151 0.06569 0.00011 0.90000 1.16038 1.65318 1.29988
1 h-m-p 0.0000 0.0000 559.7478 ++ 1090.473634 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 153.8832 ++++ 1062.061829 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0000 663.2291 ++ 1060.054582 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0023 109.3175 +++ 1048.158509 m 0.0023 61 | 4/11
5 h-m-p 0.0000 0.0002 914.5603 ++ 1029.793221 m 0.0002 75 | 5/11
6 h-m-p 0.0002 0.0008 327.2127 ++ 1024.858350 m 0.0008 89 | 6/11
7 h-m-p 0.0000 0.0000 44396.1640 +
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+ 1016.794927 m 0.0000 103
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.236640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
| 7/11
8 h-m-p 0.0068 0.0339 32.4689
QuantileBeta(0.15, 0.00500, 2.18199) = 1.206547e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19461) = 1.197810e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19776) = 1.195645e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19855) = 1.195105e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19875) = 1.194970e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19880) = 1.194936e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194928e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194926e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.236640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0000 247.8581
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+ 1014.075918 m 0.0000 142
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.236640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
| 8/11
10 h-m-p 0.3035 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
+ 1014.075918 m 8.0000 157
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.236639e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19893) = 1.194841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19869) = 1.195008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
| 8/11
11 h-m-p 0.0160 8.0000 0.0144
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19882) = 1.194921e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19883) = 1.194910e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19890) = 1.194865e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19916) = 1.194684e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+ 1014.075916 m 8.0000 177
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
12 h-m-p 0.1125 5.3544 1.0258
QuantileBeta(0.15, 0.00500, 2.19881) = 1.194925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19933) = 1.194572e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19946) = 1.194483e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19949) = 1.194461e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194456e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194455e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194453e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
13 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+ 1014.075916 m 8.0000 224
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
14 h-m-p 0.0064 3.2187 0.1340
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
Y 1014.075916 0 0.0000 249
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
15 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
16 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
+ 1014.075916 m 8.0000 297
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
17 h-m-p 0.0023 1.1612 0.3719
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
C 1014.075916 0 0.0000 325
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.236152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19962) = 1.194371e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19938) = 1.194537e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194454e-160 2000 rounds
| 8/11
18 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194455e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19950) = 1.194457e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19948) = 1.194465e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19943) = 1.194499e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19923) = 1.194636e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
+ 1014.075916 m 8.0000 345
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.236519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19910) = 1.194726e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19886) = 1.194893e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
| 8/11
19 h-m-p 0.0024 1.1828 0.6639
QuantileBeta(0.15, 0.00500, 2.19987) = 1.194204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19920) = 1.194658e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19904) = 1.194771e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19900) = 1.194800e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194807e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
Y 1014.075916 0 0.0000 373
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.236519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19910) = 1.194726e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19886) = 1.194893e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
| 8/11
20 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194809e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19898) = 1.194807e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19900) = 1.194800e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19904) = 1.194771e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+ 1014.075916 m 8.0000 393
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236443e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19921) = 1.194652e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19897) = 1.194818e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 8/11
21 h-m-p 0.0054 2.7063 1.1660
QuantileBeta(0.15, 0.00500, 2.19758) = 1.195768e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19871) = 1.194993e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19900) = 1.194799e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19907) = 1.194751e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19908) = 1.194739e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194736e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236443e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194734e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 8/11
22 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+ 1014.075916 m 8.0000 437
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236443e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19921) = 1.194652e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19897) = 1.194818e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 8/11
23 h-m-p 0.0009 0.4294 1.3859
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
+ 1014.075617 m 0.4294 457
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194734e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 9/11
24 h-m-p 1.6000 8.0000 0.0009
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194734e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
Y 1014.075617 0 0.0139 473
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19921) = 1.194651e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19897) = 1.194818e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 9/11
25 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
Y 1014.075617 0 0.4000 489
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.236442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19921) = 1.194651e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19897) = 1.194818e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
| 9/11
26 h-m-p 0.0859 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
Y 1014.075617 0 0.0000 515
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
Out..
lnL = -1014.075617
516 lfun, 6192 eigenQcodon, 34056 P(t)
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1014.134207 S = -1014.076531 -0.025615
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:17
did 20 / 57 patterns 0:17
did 30 / 57 patterns 0:17
did 40 / 57 patterns 0:17
did 50 / 57 patterns 0:17
did 57 / 57 patterns 0:17
QuantileBeta(0.15, 0.00500, 2.19909) = 1.194735e-160 2000 rounds
Time used: 0:17
CodeML output code: -1