--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 13:03:33 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/nusA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1420.79 -1425.13 2 -1420.80 -1423.81 -------------------------------------- TOTAL -1420.79 -1424.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.906132 0.089958 0.346014 1.498441 0.871133 1468.19 1484.60 1.000 r(A<->C){all} 0.171779 0.020016 0.000030 0.447066 0.137692 240.49 248.95 1.002 r(A<->G){all} 0.158744 0.017660 0.000228 0.431435 0.127745 179.08 180.16 1.000 r(A<->T){all} 0.168728 0.020311 0.000025 0.454520 0.130604 201.12 246.69 1.001 r(C<->G){all} 0.166525 0.018588 0.000199 0.431068 0.134617 233.69 438.02 1.000 r(C<->T){all} 0.161523 0.019160 0.000119 0.445028 0.123431 224.73 251.32 1.014 r(G<->T){all} 0.172701 0.020332 0.000067 0.471857 0.136291 145.70 214.99 1.001 pi(A){all} 0.197048 0.000147 0.173946 0.221976 0.196931 1156.55 1232.80 1.000 pi(C){all} 0.273477 0.000190 0.246386 0.300061 0.273429 1044.37 1181.35 1.000 pi(G){all} 0.327252 0.000207 0.297164 0.354976 0.326898 1210.04 1300.91 1.000 pi(T){all} 0.202223 0.000160 0.176765 0.226826 0.202156 1060.36 1202.34 1.000 alpha{1,2} 0.422758 0.236418 0.000149 1.419422 0.252236 1209.69 1224.48 1.000 alpha{3} 0.470568 0.262473 0.000186 1.514822 0.298842 949.26 1137.24 1.000 pinvar{all} 0.998587 0.000003 0.995497 0.999999 0.999119 1160.83 1228.96 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1369.714787 Model 2: PositiveSelection -1369.714925 Model 0: one-ratio -1369.714737 Model 7: beta -1369.7146 Model 8: beta&w>1 -1369.714553 Model 0 vs 1 9.999999974752427E-5 Model 2 vs 1 2.760000002126617E-4 Model 8 vs 7 9.399999999004649E-5
>C1 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C2 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C3 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C4 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C5 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C6 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=347 C1 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C2 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C3 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C4 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C5 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C6 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR ************************************************** C1 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C2 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C3 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C4 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C5 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C6 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ************************************************** C1 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C2 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C3 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C4 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C5 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C6 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE ************************************************** C1 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C2 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C3 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C4 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C5 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C6 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ************************************************** C1 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C2 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C3 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C4 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C5 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C6 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL ************************************************** C1 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C2 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C3 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C4 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C5 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C6 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS ************************************************** C1 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C2 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C3 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C4 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C5 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C6 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER *********************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 347 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 347 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10410] Library Relaxation: Multi_proc [96] Relaxation Summary: [10410]--->[10410] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.519 Mb, Max= 30.918 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C2 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C3 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C4 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C5 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR C6 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR ************************************************** C1 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C2 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C3 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C4 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C5 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN C6 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ************************************************** C1 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C2 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C3 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C4 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C5 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE C6 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE ************************************************** C1 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C2 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C3 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C4 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C5 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI C6 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ************************************************** C1 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C2 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C3 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C4 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C5 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL C6 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL ************************************************** C1 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C2 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C3 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C4 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C5 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS C6 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS ************************************************** C1 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C2 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C3 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C4 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C5 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER C6 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER *********************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT C2 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT C3 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT C4 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT C5 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT C6 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT ************************************************** C1 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT C2 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT C3 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT C4 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT C5 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT C6 CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ************************************************** C1 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC C2 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC C3 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC C4 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC C5 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC C6 ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC ************************************************** C1 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA C2 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA C3 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA C4 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA C5 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA C6 AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA ************************************************** C1 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG C2 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG C3 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG C4 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG C5 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG C6 TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG ************************************************** C1 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT C2 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT C3 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT C4 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT C5 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT C6 CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT ************************************************** C1 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG C2 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG C3 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG C4 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG C5 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG C6 GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG ************************************************** C1 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC C2 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC C3 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC C4 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC C5 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC C6 TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC ************************************************** C1 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA C2 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA C3 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA C4 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA C5 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA C6 GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA ************************************************** C1 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT C2 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT C3 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT C4 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT C5 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT C6 CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT ************************************************** C1 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA C2 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA C3 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA C4 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA C5 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA C6 GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA ************************************************** C1 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC C2 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC C3 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC C4 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC C5 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC C6 CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC ************************************************** C1 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG C2 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG C3 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG C4 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG C5 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG C6 GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG ************************************************** C1 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG C2 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG C3 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG C4 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG C5 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG C6 TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG ************************************************** C1 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT C2 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT C3 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT C4 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT C5 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT C6 CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT ************************************************** C1 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT C2 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT C3 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT C4 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT C5 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT C6 TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT ************************************************** C1 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG C2 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG C3 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG C4 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG C5 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG C6 CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ************************************************** C1 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT C2 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT C3 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT C4 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT C5 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT C6 ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT ************************************************** C1 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC C2 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC C3 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC C4 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC C5 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC C6 CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC ************************************************** C1 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC C2 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC C3 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC C4 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC C5 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC C6 CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC ************************************************** C1 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC C2 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC C3 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC C4 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC C5 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC C6 AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC ***************************************** >C1 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C2 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C3 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C4 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C5 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C6 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >C1 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C2 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C3 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C4 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C5 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >C6 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1041 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579784534 Setting output file names to "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 515795790 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9389811390 Seed = 1527154396 Swapseed = 1579784534 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2329.807549 -- -24.965149 Chain 2 -- -2329.807904 -- -24.965149 Chain 3 -- -2329.807904 -- -24.965149 Chain 4 -- -2329.807769 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2329.807769 -- -24.965149 Chain 2 -- -2329.807549 -- -24.965149 Chain 3 -- -2329.807769 -- -24.965149 Chain 4 -- -2329.807904 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2329.808] (-2329.808) (-2329.808) (-2329.808) * [-2329.808] (-2329.808) (-2329.808) (-2329.808) 500 -- (-1445.344) (-1436.049) [-1434.488] (-1443.685) * (-1462.741) (-1441.166) [-1435.163] (-1433.289) -- 0:00:00 1000 -- (-1443.893) (-1429.554) [-1427.783] (-1436.870) * (-1436.491) (-1438.404) (-1436.931) [-1427.163] -- 0:00:00 1500 -- [-1431.698] (-1430.861) (-1429.680) (-1435.410) * (-1429.444) [-1425.653] (-1433.805) (-1426.009) -- 0:11:05 2000 -- [-1433.057] (-1431.899) (-1427.630) (-1430.412) * (-1429.305) [-1428.036] (-1433.892) (-1433.227) -- 0:08:19 2500 -- [-1429.240] (-1431.727) (-1425.009) (-1426.870) * [-1426.102] (-1430.491) (-1428.904) (-1425.764) -- 0:06:39 3000 -- [-1427.190] (-1428.074) (-1428.126) (-1429.301) * (-1429.437) (-1430.011) [-1426.316] (-1431.732) -- 0:05:32 3500 -- (-1433.302) (-1426.423) [-1427.177] (-1429.205) * [-1428.130] (-1438.241) (-1429.058) (-1429.326) -- 0:04:44 4000 -- (-1434.375) (-1435.528) (-1428.588) [-1432.628] * (-1427.740) [-1431.270] (-1440.854) (-1430.281) -- 0:04:09 4500 -- (-1426.807) [-1428.928] (-1430.024) (-1434.655) * (-1429.704) [-1430.465] (-1429.718) (-1430.654) -- 0:03:41 5000 -- (-1428.472) [-1428.680] (-1432.218) (-1433.998) * (-1434.638) [-1427.504] (-1428.561) (-1427.911) -- 0:03:19 Average standard deviation of split frequencies: 0.092852 5500 -- (-1431.497) (-1424.518) (-1426.952) [-1430.094] * (-1437.246) (-1429.810) [-1426.777] (-1428.117) -- 0:03:00 6000 -- (-1437.161) (-1434.676) [-1429.487] (-1426.102) * [-1426.066] (-1438.574) (-1433.989) (-1426.007) -- 0:02:45 6500 -- (-1426.997) [-1431.378] (-1428.349) (-1428.735) * (-1430.416) [-1428.348] (-1436.101) (-1431.298) -- 0:02:32 7000 -- (-1432.542) [-1434.934] (-1429.202) (-1429.932) * (-1429.463) (-1434.659) (-1437.990) [-1427.903] -- 0:02:21 7500 -- [-1426.957] (-1433.255) (-1427.250) (-1422.380) * (-1430.067) (-1428.646) (-1437.129) [-1427.235] -- 0:02:12 8000 -- (-1428.715) (-1437.814) [-1424.169] (-1430.379) * [-1430.687] (-1427.640) (-1426.150) (-1436.551) -- 0:02:04 8500 -- (-1428.960) (-1435.741) (-1434.641) [-1430.040] * (-1430.553) (-1435.239) (-1430.433) [-1426.959] -- 0:01:56 9000 -- [-1430.620] (-1434.645) (-1432.450) (-1441.117) * [-1425.347] (-1432.424) (-1432.674) (-1430.699) -- 0:01:50 9500 -- (-1431.462) [-1435.088] (-1434.059) (-1434.586) * [-1428.371] (-1431.426) (-1431.501) (-1427.952) -- 0:01:44 10000 -- (-1432.194) (-1435.710) (-1433.166) [-1427.711] * (-1434.088) (-1430.401) [-1436.979] (-1438.954) -- 0:01:39 Average standard deviation of split frequencies: 0.071202 10500 -- (-1426.398) (-1426.893) [-1425.890] (-1436.148) * [-1433.937] (-1429.323) (-1430.232) (-1430.703) -- 0:01:34 11000 -- (-1429.114) (-1426.228) (-1429.890) [-1431.304] * (-1436.409) (-1429.014) (-1426.409) [-1430.985] -- 0:01:29 11500 -- (-1426.041) (-1429.286) [-1431.219] (-1429.966) * (-1421.337) (-1434.175) (-1432.005) [-1433.049] -- 0:01:25 12000 -- [-1426.297] (-1428.441) (-1435.057) (-1437.441) * (-1420.256) (-1429.379) (-1433.445) [-1432.570] -- 0:01:22 12500 -- [-1432.953] (-1437.016) (-1429.431) (-1428.789) * (-1419.801) (-1430.040) [-1433.059] (-1432.454) -- 0:01:19 13000 -- (-1432.697) (-1424.840) (-1423.818) [-1434.931] * (-1420.342) [-1424.614] (-1440.925) (-1431.613) -- 0:01:15 13500 -- (-1431.099) [-1427.033] (-1422.773) (-1430.863) * (-1426.793) (-1437.054) [-1420.722] (-1441.026) -- 0:01:13 14000 -- (-1430.731) (-1425.861) [-1420.013] (-1438.110) * [-1423.613] (-1428.797) (-1420.891) (-1424.801) -- 0:01:10 14500 -- (-1432.755) (-1428.760) (-1420.374) [-1426.826] * (-1423.387) [-1432.341] (-1423.171) (-1430.366) -- 0:01:07 15000 -- (-1437.390) (-1434.725) [-1420.599] (-1429.945) * (-1422.784) (-1432.621) [-1420.745] (-1435.348) -- 0:01:05 Average standard deviation of split frequencies: 0.040511 15500 -- (-1433.991) (-1428.065) (-1421.026) [-1429.082] * (-1419.484) (-1423.577) [-1421.470] (-1428.865) -- 0:01:03 16000 -- [-1427.859] (-1431.645) (-1422.890) (-1428.786) * [-1420.338] (-1423.851) (-1420.014) (-1430.653) -- 0:01:01 16500 -- (-1429.251) (-1428.086) (-1422.053) [-1425.763] * (-1421.047) [-1422.253] (-1420.618) (-1431.948) -- 0:01:59 17000 -- (-1434.532) [-1432.300] (-1424.978) (-1432.046) * (-1423.292) [-1422.095] (-1422.898) (-1426.762) -- 0:01:55 17500 -- (-1429.218) (-1435.024) [-1424.049] (-1433.704) * [-1419.358] (-1422.831) (-1421.886) (-1433.267) -- 0:01:52 18000 -- (-1437.005) [-1426.573] (-1423.772) (-1432.173) * [-1419.990] (-1421.395) (-1422.489) (-1429.842) -- 0:01:49 18500 -- (-1431.589) (-1432.004) [-1420.737] (-1432.276) * (-1420.167) [-1423.060] (-1424.831) (-1432.730) -- 0:01:46 19000 -- (-1429.265) [-1430.293] (-1421.601) (-1429.745) * [-1423.431] (-1420.352) (-1425.449) (-1427.881) -- 0:01:43 19500 -- [-1433.599] (-1432.449) (-1422.477) (-1426.041) * (-1421.255) (-1421.325) [-1422.621] (-1433.676) -- 0:01:40 20000 -- (-1430.148) (-1434.460) (-1423.269) [-1429.088] * (-1421.064) (-1422.544) (-1420.975) [-1431.169] -- 0:01:38 Average standard deviation of split frequencies: 0.034215 20500 -- [-1431.575] (-1427.812) (-1423.467) (-1429.782) * [-1421.155] (-1422.250) (-1420.776) (-1436.202) -- 0:01:35 21000 -- (-1438.445) [-1432.262] (-1424.916) (-1430.871) * [-1420.108] (-1420.485) (-1420.820) (-1428.081) -- 0:01:33 21500 -- (-1441.476) (-1430.976) [-1423.466] (-1429.202) * (-1420.292) (-1420.233) [-1420.733] (-1434.470) -- 0:01:31 22000 -- (-1427.007) (-1435.284) [-1424.209] (-1428.775) * (-1421.066) (-1420.268) [-1419.532] (-1428.318) -- 0:01:28 22500 -- (-1433.948) [-1435.451] (-1424.660) (-1429.506) * (-1423.260) (-1419.551) [-1419.916] (-1432.421) -- 0:01:26 23000 -- (-1426.849) (-1429.110) [-1423.260] (-1430.685) * (-1428.482) [-1419.145] (-1422.225) (-1442.165) -- 0:01:24 23500 -- (-1426.325) (-1426.533) [-1420.490] (-1431.996) * (-1426.303) [-1420.295] (-1422.212) (-1427.267) -- 0:01:23 24000 -- (-1428.823) (-1426.086) (-1420.782) [-1427.322] * (-1422.968) [-1422.032] (-1421.742) (-1430.833) -- 0:01:21 24500 -- (-1427.417) [-1433.882] (-1421.233) (-1438.316) * [-1423.294] (-1419.967) (-1424.146) (-1425.794) -- 0:01:19 25000 -- [-1425.429] (-1430.891) (-1422.269) (-1428.686) * (-1421.915) [-1419.525] (-1422.107) (-1439.566) -- 0:01:18 Average standard deviation of split frequencies: 0.038982 25500 -- (-1430.620) (-1432.709) (-1420.767) [-1438.063] * (-1421.972) (-1420.106) (-1422.516) [-1429.005] -- 0:01:16 26000 -- (-1430.966) (-1424.740) [-1419.600] (-1426.805) * (-1421.165) (-1420.113) (-1422.150) [-1430.162] -- 0:01:14 26500 -- (-1431.688) (-1424.123) [-1420.567] (-1432.024) * (-1421.252) (-1423.344) (-1420.967) [-1431.021] -- 0:01:13 27000 -- (-1429.529) [-1424.212] (-1420.775) (-1429.992) * [-1421.527] (-1421.238) (-1420.925) (-1434.415) -- 0:01:12 27500 -- (-1432.474) (-1423.802) (-1420.399) [-1433.308] * (-1422.749) [-1425.841] (-1420.995) (-1432.467) -- 0:01:10 28000 -- [-1439.489] (-1419.597) (-1419.871) (-1431.689) * (-1422.826) (-1421.303) [-1423.079] (-1435.753) -- 0:01:09 28500 -- (-1429.674) (-1420.454) (-1420.251) [-1425.655] * (-1422.781) [-1420.374] (-1423.750) (-1430.930) -- 0:01:08 29000 -- (-1439.792) (-1421.552) [-1420.071] (-1432.859) * (-1422.895) (-1422.058) [-1422.861] (-1431.477) -- 0:01:06 29500 -- (-1429.417) (-1420.892) [-1421.184] (-1428.699) * (-1420.389) [-1419.811] (-1422.231) (-1433.197) -- 0:01:05 30000 -- (-1428.655) (-1419.828) (-1420.545) [-1428.997] * [-1421.440] (-1420.423) (-1419.916) (-1428.772) -- 0:01:04 Average standard deviation of split frequencies: 0.037332 30500 -- [-1428.474] (-1422.306) (-1425.259) (-1424.797) * (-1420.644) [-1420.659] (-1419.558) (-1428.094) -- 0:01:03 31000 -- (-1428.801) (-1420.352) (-1422.303) [-1430.273] * (-1423.854) (-1422.682) (-1421.043) [-1426.247] -- 0:01:02 31500 -- (-1428.792) [-1421.620] (-1423.179) (-1426.481) * (-1421.548) (-1420.434) (-1421.667) [-1430.365] -- 0:01:01 32000 -- (-1435.237) (-1420.794) (-1423.065) [-1429.089] * [-1423.229] (-1421.016) (-1424.666) (-1435.524) -- 0:01:00 32500 -- (-1429.304) (-1422.390) (-1421.738) [-1431.766] * (-1421.745) [-1421.958] (-1422.189) (-1433.789) -- 0:01:29 33000 -- (-1431.426) (-1422.232) [-1421.548] (-1430.207) * (-1421.645) [-1419.916] (-1420.228) (-1428.623) -- 0:01:27 33500 -- (-1438.043) (-1422.235) (-1422.644) [-1428.368] * (-1421.324) [-1420.567] (-1420.406) (-1434.785) -- 0:01:26 34000 -- (-1431.196) [-1424.017] (-1423.611) (-1437.199) * (-1423.362) [-1421.825] (-1420.380) (-1428.119) -- 0:01:25 34500 -- (-1430.763) [-1423.313] (-1426.073) (-1430.428) * [-1420.332] (-1423.464) (-1420.317) (-1438.206) -- 0:01:23 35000 -- [-1427.129] (-1422.184) (-1420.494) (-1433.182) * (-1422.564) (-1421.014) [-1420.515] (-1427.608) -- 0:01:22 Average standard deviation of split frequencies: 0.036166 35500 -- [-1427.258] (-1423.191) (-1421.976) (-1435.255) * (-1421.466) (-1422.205) [-1420.919] (-1427.569) -- 0:01:21 36000 -- (-1434.386) (-1425.385) (-1420.210) [-1431.345] * (-1423.404) (-1419.969) [-1420.042] (-1430.285) -- 0:01:20 36500 -- (-1422.741) [-1423.131] (-1420.925) (-1444.000) * (-1423.205) (-1421.227) (-1419.730) [-1432.774] -- 0:01:19 37000 -- (-1431.747) (-1423.069) (-1424.059) [-1428.902] * (-1421.540) (-1421.533) [-1422.016] (-1429.061) -- 0:01:18 37500 -- (-1434.085) (-1420.053) (-1421.066) [-1429.075] * [-1422.050] (-1422.058) (-1424.892) (-1438.195) -- 0:01:17 38000 -- [-1428.898] (-1419.677) (-1421.416) (-1442.948) * [-1423.396] (-1423.259) (-1420.309) (-1431.430) -- 0:01:15 38500 -- (-1434.495) (-1420.448) (-1421.507) [-1426.966] * (-1420.846) (-1423.592) [-1420.833] (-1429.467) -- 0:01:14 39000 -- (-1423.774) (-1420.946) [-1421.555] (-1436.125) * (-1425.293) [-1421.371] (-1421.161) (-1427.522) -- 0:01:13 39500 -- (-1420.194) (-1420.609) (-1419.671) [-1428.671] * [-1421.320] (-1421.822) (-1420.142) (-1437.271) -- 0:01:12 40000 -- (-1421.766) (-1425.269) [-1422.316] (-1438.823) * (-1421.582) [-1421.324] (-1419.331) (-1428.375) -- 0:01:12 Average standard deviation of split frequencies: 0.032335 40500 -- (-1421.402) (-1422.905) (-1421.209) [-1424.274] * [-1421.728] (-1422.442) (-1421.145) (-1428.584) -- 0:01:11 41000 -- (-1422.224) (-1421.436) [-1422.041] (-1428.139) * (-1424.777) (-1422.842) (-1420.942) [-1429.592] -- 0:01:10 41500 -- (-1420.589) (-1421.664) [-1421.725] (-1432.970) * (-1427.827) (-1424.931) (-1421.276) [-1429.690] -- 0:01:09 42000 -- (-1419.509) [-1421.664] (-1422.132) (-1435.008) * (-1423.984) [-1420.489] (-1419.879) (-1430.461) -- 0:01:08 42500 -- [-1421.006] (-1421.677) (-1423.608) (-1433.388) * (-1425.479) (-1419.956) (-1419.815) [-1426.325] -- 0:01:07 43000 -- (-1421.175) (-1420.941) (-1422.538) [-1440.043] * [-1420.186] (-1423.417) (-1420.344) (-1436.819) -- 0:01:06 43500 -- (-1421.296) (-1420.224) (-1421.954) [-1428.508] * (-1422.599) (-1425.020) [-1419.873] (-1441.927) -- 0:01:05 44000 -- (-1420.610) (-1421.257) [-1423.100] (-1425.910) * (-1422.616) [-1419.883] (-1421.327) (-1430.651) -- 0:01:05 44500 -- (-1421.286) [-1424.108] (-1423.033) (-1430.676) * (-1423.948) [-1419.820] (-1421.856) (-1431.736) -- 0:01:04 45000 -- (-1421.163) (-1424.072) [-1422.053] (-1438.196) * (-1420.467) (-1422.260) (-1420.749) [-1425.096] -- 0:01:03 Average standard deviation of split frequencies: 0.030744 45500 -- (-1421.807) [-1427.927] (-1421.860) (-1428.449) * (-1420.747) (-1420.817) (-1420.958) [-1427.555] -- 0:01:02 46000 -- (-1420.744) (-1422.678) (-1420.241) [-1430.694] * (-1421.714) (-1421.697) (-1422.152) [-1427.830] -- 0:01:02 46500 -- (-1419.950) (-1422.595) [-1420.188] (-1427.797) * (-1421.134) [-1422.758] (-1424.659) (-1428.657) -- 0:01:01 47000 -- (-1419.940) (-1422.506) (-1420.856) [-1427.332] * [-1420.153] (-1422.262) (-1421.674) (-1437.998) -- 0:01:21 47500 -- (-1419.900) (-1422.342) [-1421.191] (-1429.741) * (-1420.219) [-1423.840] (-1420.498) (-1433.264) -- 0:01:20 48000 -- [-1421.859] (-1421.302) (-1421.907) (-1436.473) * (-1425.812) (-1423.438) (-1420.931) [-1427.296] -- 0:01:19 48500 -- [-1421.748] (-1422.285) (-1419.608) (-1433.188) * (-1428.828) (-1424.990) (-1422.262) [-1435.576] -- 0:01:18 49000 -- (-1421.858) (-1420.174) [-1420.084] (-1429.293) * (-1424.441) (-1422.831) [-1424.827] (-1429.013) -- 0:01:17 49500 -- (-1419.781) (-1421.490) (-1420.457) [-1426.251] * (-1422.773) (-1420.222) [-1423.615] (-1429.628) -- 0:01:16 50000 -- [-1420.110] (-1419.813) (-1422.792) (-1438.327) * (-1425.224) (-1421.630) (-1425.537) [-1430.467] -- 0:01:16 Average standard deviation of split frequencies: 0.028335 50500 -- (-1421.260) (-1419.656) [-1420.396] (-1437.230) * (-1422.805) (-1421.628) (-1420.934) [-1428.975] -- 0:01:15 51000 -- (-1423.795) (-1419.988) (-1420.594) [-1432.188] * [-1427.457] (-1421.154) (-1420.095) (-1426.489) -- 0:01:14 51500 -- [-1425.314] (-1421.067) (-1426.260) (-1427.204) * [-1423.926] (-1421.218) (-1420.141) (-1434.096) -- 0:01:13 52000 -- (-1424.088) (-1421.417) [-1422.450] (-1432.423) * (-1420.099) [-1420.960] (-1420.598) (-1437.276) -- 0:01:12 52500 -- (-1424.091) (-1422.278) [-1423.703] (-1428.783) * [-1422.451] (-1423.191) (-1421.221) (-1432.446) -- 0:01:12 53000 -- (-1426.174) (-1421.650) [-1421.810] (-1425.780) * (-1422.974) [-1423.799] (-1423.345) (-1427.974) -- 0:01:11 53500 -- (-1425.181) [-1422.487] (-1424.207) (-1430.280) * [-1424.342] (-1422.579) (-1422.924) (-1437.458) -- 0:01:10 54000 -- [-1420.902] (-1420.749) (-1421.436) (-1429.219) * [-1421.318] (-1421.808) (-1422.209) (-1434.455) -- 0:01:10 54500 -- (-1420.880) [-1422.339] (-1425.194) (-1434.271) * (-1419.738) (-1420.584) [-1423.656] (-1437.054) -- 0:01:09 55000 -- [-1422.162] (-1422.982) (-1424.187) (-1434.104) * (-1419.496) [-1420.610] (-1422.079) (-1431.568) -- 0:01:08 Average standard deviation of split frequencies: 0.029262 55500 -- (-1423.489) (-1421.342) (-1419.980) [-1429.555] * (-1419.612) [-1419.466] (-1420.082) (-1431.584) -- 0:01:08 56000 -- (-1422.086) (-1421.860) (-1423.257) [-1436.629] * (-1419.961) [-1420.004] (-1426.082) (-1427.249) -- 0:01:07 56500 -- [-1422.474] (-1424.927) (-1419.322) (-1433.737) * (-1421.242) (-1421.581) [-1427.985] (-1432.261) -- 0:01:06 57000 -- [-1421.113] (-1420.410) (-1419.868) (-1432.657) * (-1421.350) (-1421.292) [-1422.513] (-1442.215) -- 0:01:06 57500 -- (-1421.473) [-1421.770] (-1419.974) (-1427.835) * (-1420.649) (-1426.385) [-1420.696] (-1425.645) -- 0:01:05 58000 -- [-1422.830] (-1420.468) (-1421.407) (-1430.884) * (-1420.880) (-1423.030) (-1419.934) [-1430.601] -- 0:01:04 58500 -- (-1424.786) (-1420.208) (-1420.835) [-1426.305] * [-1422.573] (-1420.823) (-1424.163) (-1436.508) -- 0:01:04 59000 -- (-1428.985) (-1420.575) (-1420.451) [-1433.844] * (-1421.714) [-1423.862] (-1420.463) (-1435.148) -- 0:01:03 59500 -- (-1425.099) [-1422.982] (-1419.843) (-1429.620) * (-1421.147) (-1424.627) [-1419.839] (-1432.691) -- 0:01:03 60000 -- (-1422.733) (-1420.898) [-1421.384] (-1434.333) * (-1428.869) (-1425.266) (-1419.874) [-1428.016] -- 0:01:02 Average standard deviation of split frequencies: 0.027011 60500 -- (-1421.526) (-1422.860) (-1421.687) [-1429.985] * [-1421.828] (-1424.022) (-1420.382) (-1431.954) -- 0:01:02 61000 -- (-1421.013) [-1426.228] (-1420.806) (-1426.908) * (-1421.333) [-1422.238] (-1425.984) (-1430.088) -- 0:01:01 61500 -- (-1420.863) (-1422.238) (-1423.345) [-1428.750] * (-1421.486) (-1421.285) [-1425.157] (-1437.269) -- 0:01:01 62000 -- (-1420.409) (-1422.832) (-1423.180) [-1428.545] * (-1421.505) [-1421.938] (-1425.507) (-1427.999) -- 0:01:00 62500 -- [-1420.501] (-1422.906) (-1420.880) (-1430.000) * (-1421.439) (-1420.777) (-1421.401) [-1428.923] -- 0:01:00 63000 -- (-1420.934) (-1423.885) [-1425.700] (-1427.324) * (-1420.702) [-1420.033] (-1425.682) (-1428.568) -- 0:01:14 63500 -- (-1421.597) [-1423.757] (-1419.874) (-1427.911) * (-1421.340) (-1419.893) [-1421.917] (-1429.173) -- 0:01:13 64000 -- [-1422.903] (-1426.008) (-1422.441) (-1432.722) * (-1422.029) (-1419.523) [-1420.395] (-1439.287) -- 0:01:13 64500 -- (-1422.507) [-1420.818] (-1425.739) (-1430.550) * (-1420.680) (-1420.611) [-1420.391] (-1439.117) -- 0:01:12 65000 -- (-1425.274) (-1421.531) (-1424.549) [-1428.485] * (-1421.348) [-1423.109] (-1420.879) (-1434.467) -- 0:01:11 Average standard deviation of split frequencies: 0.024148 65500 -- (-1423.831) [-1421.188] (-1421.366) (-1434.714) * (-1421.242) (-1420.982) [-1420.846] (-1440.247) -- 0:01:11 66000 -- (-1423.197) [-1421.977] (-1420.792) (-1435.846) * (-1424.745) [-1422.255] (-1421.746) (-1421.079) -- 0:01:10 66500 -- [-1420.032] (-1421.193) (-1421.946) (-1426.798) * [-1426.313] (-1420.574) (-1424.159) (-1419.409) -- 0:01:10 67000 -- [-1421.421] (-1421.333) (-1420.940) (-1426.654) * [-1422.836] (-1427.281) (-1424.432) (-1422.468) -- 0:01:09 67500 -- (-1419.543) (-1421.546) [-1420.652] (-1428.854) * [-1420.276] (-1423.146) (-1420.165) (-1423.415) -- 0:01:09 68000 -- [-1419.545] (-1420.766) (-1420.561) (-1431.748) * [-1420.686] (-1420.287) (-1421.254) (-1426.083) -- 0:01:08 68500 -- [-1419.199] (-1424.835) (-1419.592) (-1433.382) * [-1420.638] (-1420.012) (-1423.225) (-1428.749) -- 0:01:07 69000 -- (-1419.903) [-1423.865] (-1424.046) (-1431.781) * [-1420.707] (-1420.764) (-1423.498) (-1424.126) -- 0:01:07 69500 -- [-1421.465] (-1422.487) (-1424.891) (-1429.248) * [-1424.485] (-1420.385) (-1424.773) (-1422.400) -- 0:01:06 70000 -- (-1419.670) (-1421.544) (-1425.435) [-1428.585] * [-1421.879] (-1423.134) (-1422.218) (-1420.447) -- 0:01:06 Average standard deviation of split frequencies: 0.018959 70500 -- (-1420.738) [-1422.763] (-1422.562) (-1433.693) * [-1421.123] (-1431.877) (-1420.852) (-1421.754) -- 0:01:05 71000 -- (-1419.609) (-1423.088) (-1423.551) [-1435.616] * [-1421.362] (-1424.903) (-1423.724) (-1420.235) -- 0:01:05 71500 -- (-1419.746) (-1422.435) [-1422.331] (-1437.073) * (-1420.948) [-1430.564] (-1421.706) (-1420.900) -- 0:01:04 72000 -- (-1419.493) [-1422.201] (-1420.808) (-1435.341) * (-1419.395) (-1421.203) [-1424.684] (-1420.894) -- 0:01:04 72500 -- (-1422.575) (-1421.295) (-1420.315) [-1426.502] * (-1419.701) [-1422.272] (-1420.747) (-1424.390) -- 0:01:03 73000 -- [-1420.033] (-1421.485) (-1421.644) (-1434.927) * (-1419.787) (-1420.158) (-1421.118) [-1424.795] -- 0:01:03 73500 -- (-1420.428) (-1421.606) [-1419.841] (-1433.255) * (-1419.738) [-1420.933] (-1421.118) (-1421.401) -- 0:01:03 74000 -- (-1419.640) (-1421.252) [-1421.690] (-1434.997) * [-1419.965] (-1423.197) (-1420.876) (-1421.965) -- 0:01:02 74500 -- (-1421.307) (-1420.017) (-1423.625) [-1427.241] * (-1419.500) (-1423.327) [-1422.546] (-1420.991) -- 0:01:02 75000 -- (-1426.197) (-1423.712) (-1426.715) [-1430.923] * (-1420.834) (-1424.195) (-1419.890) [-1420.702] -- 0:01:01 Average standard deviation of split frequencies: 0.019261 75500 -- (-1428.580) [-1420.535] (-1422.580) (-1428.142) * (-1422.049) (-1423.842) [-1420.064] (-1423.516) -- 0:01:01 76000 -- (-1422.214) [-1419.990] (-1421.057) (-1426.856) * (-1420.853) (-1423.189) (-1419.412) [-1421.521] -- 0:01:00 76500 -- [-1421.746] (-1419.226) (-1421.941) (-1429.050) * (-1422.577) [-1421.901] (-1419.751) (-1420.046) -- 0:01:00 77000 -- [-1423.111] (-1419.518) (-1425.210) (-1443.310) * [-1421.935] (-1422.613) (-1420.508) (-1419.794) -- 0:00:59 77500 -- (-1424.895) [-1419.905] (-1424.796) (-1427.993) * (-1421.789) (-1421.411) [-1420.178] (-1421.330) -- 0:00:59 78000 -- [-1423.081] (-1420.185) (-1420.878) (-1430.344) * (-1424.227) [-1420.871] (-1420.187) (-1421.178) -- 0:00:59 78500 -- (-1422.904) (-1420.234) [-1421.804] (-1430.884) * (-1421.904) (-1420.890) [-1420.183] (-1420.783) -- 0:01:10 79000 -- [-1421.442] (-1423.073) (-1421.477) (-1436.630) * (-1420.410) (-1425.661) [-1420.763] (-1420.857) -- 0:01:09 79500 -- (-1420.706) (-1423.559) [-1421.049] (-1433.527) * (-1421.225) (-1419.902) [-1419.528] (-1422.863) -- 0:01:09 80000 -- (-1423.480) (-1422.253) (-1420.881) [-1427.309] * (-1422.965) (-1422.001) (-1419.679) [-1421.041] -- 0:01:09 Average standard deviation of split frequencies: 0.017207 80500 -- (-1421.370) (-1422.847) (-1420.722) [-1434.053] * [-1420.238] (-1421.675) (-1419.278) (-1420.831) -- 0:01:08 81000 -- (-1421.246) (-1422.576) (-1420.641) [-1431.430] * (-1423.400) [-1420.374] (-1419.850) (-1421.627) -- 0:01:08 81500 -- (-1419.640) [-1421.783] (-1420.804) (-1431.965) * (-1420.963) [-1422.973] (-1419.895) (-1419.646) -- 0:01:07 82000 -- (-1420.778) (-1421.432) (-1419.660) [-1425.804] * [-1421.213] (-1421.752) (-1420.111) (-1422.582) -- 0:01:07 82500 -- (-1421.672) (-1421.432) (-1420.295) [-1428.870] * [-1419.757] (-1422.264) (-1420.876) (-1422.623) -- 0:01:06 83000 -- (-1423.300) (-1423.330) (-1421.547) [-1431.424] * [-1419.522] (-1422.649) (-1419.369) (-1422.955) -- 0:01:06 83500 -- (-1425.740) (-1423.324) (-1420.595) [-1428.055] * (-1419.142) (-1422.201) (-1419.858) [-1421.248] -- 0:01:05 84000 -- [-1420.827] (-1424.146) (-1420.938) (-1434.582) * (-1419.142) (-1421.324) (-1423.742) [-1420.563] -- 0:01:05 84500 -- [-1422.514] (-1423.625) (-1420.134) (-1430.021) * (-1420.176) [-1425.400] (-1420.443) (-1421.615) -- 0:01:05 85000 -- (-1422.625) (-1424.406) (-1421.205) [-1429.120] * (-1421.604) [-1421.849] (-1423.028) (-1423.852) -- 0:01:04 Average standard deviation of split frequencies: 0.018363 85500 -- (-1424.665) (-1422.252) [-1421.801] (-1430.891) * (-1420.118) (-1421.755) [-1421.745] (-1422.920) -- 0:01:04 86000 -- [-1424.991] (-1420.146) (-1420.207) (-1433.397) * (-1420.073) (-1424.594) [-1419.278] (-1421.670) -- 0:01:03 86500 -- (-1425.830) (-1420.996) [-1424.185] (-1429.852) * [-1420.064] (-1420.880) (-1419.650) (-1421.619) -- 0:01:03 87000 -- (-1420.882) [-1421.287] (-1424.049) (-1428.390) * (-1420.224) (-1424.765) [-1422.978] (-1421.308) -- 0:01:02 87500 -- (-1421.098) (-1423.190) (-1422.545) [-1427.276] * (-1423.994) (-1425.371) [-1423.165] (-1421.875) -- 0:01:02 88000 -- (-1420.295) (-1420.220) (-1421.937) [-1428.591] * [-1422.778] (-1422.139) (-1422.517) (-1420.818) -- 0:01:02 88500 -- (-1420.882) (-1423.627) [-1422.676] (-1426.822) * (-1424.746) (-1423.580) [-1420.829] (-1423.588) -- 0:01:01 89000 -- (-1423.045) (-1423.939) (-1423.888) [-1433.194] * (-1422.311) [-1424.261] (-1427.740) (-1422.246) -- 0:01:01 89500 -- (-1421.394) (-1422.492) [-1420.602] (-1434.480) * (-1423.359) [-1425.324] (-1427.372) (-1422.036) -- 0:01:01 90000 -- (-1423.322) (-1425.047) (-1422.461) [-1425.023] * (-1422.291) (-1420.934) [-1421.516] (-1422.091) -- 0:01:00 Average standard deviation of split frequencies: 0.018882 90500 -- (-1419.966) (-1422.760) [-1419.720] (-1430.597) * [-1421.988] (-1421.389) (-1421.424) (-1426.166) -- 0:01:00 91000 -- (-1419.779) [-1422.915] (-1420.530) (-1426.721) * (-1422.478) [-1421.476] (-1421.381) (-1422.786) -- 0:00:59 91500 -- (-1420.763) (-1426.681) (-1421.261) [-1433.237] * [-1423.042] (-1421.643) (-1420.735) (-1420.326) -- 0:00:59 92000 -- [-1421.132] (-1425.495) (-1420.391) (-1430.403) * [-1422.518] (-1420.444) (-1419.887) (-1420.696) -- 0:00:59 92500 -- (-1421.574) (-1423.219) [-1419.824] (-1430.308) * (-1423.332) (-1420.088) (-1422.884) [-1421.533] -- 0:00:58 93000 -- (-1422.230) (-1421.644) (-1420.319) [-1429.937] * (-1424.196) (-1420.315) [-1425.758] (-1424.245) -- 0:00:58 93500 -- (-1421.097) [-1422.214] (-1421.395) (-1427.550) * (-1423.106) (-1422.887) [-1421.929] (-1421.789) -- 0:00:58 94000 -- (-1421.649) [-1422.365] (-1421.149) (-1425.004) * (-1423.261) [-1427.622] (-1420.009) (-1421.169) -- 0:00:57 94500 -- (-1422.397) (-1420.149) [-1420.442] (-1436.660) * (-1421.589) (-1420.662) (-1421.491) [-1420.915] -- 0:01:07 95000 -- (-1423.181) (-1420.984) [-1420.236] (-1431.954) * (-1421.941) [-1420.246] (-1421.221) (-1421.375) -- 0:01:06 Average standard deviation of split frequencies: 0.020417 95500 -- (-1421.716) (-1422.173) [-1419.435] (-1428.472) * (-1420.379) (-1422.500) (-1420.656) [-1421.249] -- 0:01:06 96000 -- (-1420.264) (-1420.671) [-1422.586] (-1440.334) * (-1422.843) [-1419.336] (-1420.581) (-1420.002) -- 0:01:05 96500 -- (-1420.595) (-1420.982) [-1423.357] (-1434.926) * (-1420.531) (-1420.463) [-1419.780] (-1419.992) -- 0:01:05 97000 -- (-1420.595) (-1420.106) [-1421.519] (-1434.090) * (-1423.142) [-1420.854] (-1422.633) (-1420.906) -- 0:01:05 97500 -- (-1419.957) (-1420.449) [-1420.543] (-1429.464) * (-1421.256) [-1419.592] (-1425.235) (-1419.980) -- 0:01:04 98000 -- (-1420.561) (-1421.279) [-1420.517] (-1426.505) * (-1424.039) (-1420.588) (-1423.334) [-1421.778] -- 0:01:04 98500 -- (-1421.800) (-1424.102) [-1420.017] (-1432.458) * (-1424.099) (-1421.728) (-1421.134) [-1420.512] -- 0:01:04 99000 -- (-1420.993) [-1423.404] (-1420.255) (-1426.959) * (-1420.454) [-1419.931] (-1420.800) (-1420.691) -- 0:01:03 99500 -- (-1420.519) [-1420.477] (-1420.388) (-1428.456) * (-1422.242) (-1421.834) (-1422.843) [-1425.602] -- 0:01:03 100000 -- (-1421.841) (-1421.281) (-1424.912) [-1426.512] * [-1420.809] (-1421.619) (-1422.112) (-1424.131) -- 0:01:02 Average standard deviation of split frequencies: 0.020813 100500 -- (-1422.781) (-1424.084) [-1423.354] (-1427.475) * [-1420.912] (-1420.911) (-1425.079) (-1427.294) -- 0:01:02 101000 -- (-1421.667) (-1426.742) (-1422.499) [-1425.048] * (-1421.031) [-1420.687] (-1422.559) (-1424.068) -- 0:01:02 101500 -- [-1422.361] (-1425.063) (-1423.494) (-1431.688) * (-1422.692) (-1421.189) [-1423.294] (-1422.864) -- 0:01:01 102000 -- (-1420.264) (-1422.199) (-1421.998) [-1427.383] * (-1420.344) (-1421.318) [-1422.925] (-1420.850) -- 0:01:01 102500 -- (-1422.481) (-1419.386) [-1420.631] (-1428.362) * (-1424.727) (-1423.679) [-1420.052] (-1421.171) -- 0:01:01 103000 -- (-1424.398) (-1419.384) [-1424.539] (-1427.368) * (-1419.793) (-1425.102) (-1422.406) [-1422.061] -- 0:01:00 103500 -- (-1424.275) (-1419.885) (-1425.112) [-1431.703] * (-1420.132) [-1423.432] (-1421.591) (-1422.545) -- 0:01:00 104000 -- (-1421.840) (-1422.402) (-1422.470) [-1428.731] * (-1420.376) [-1421.955] (-1420.986) (-1426.767) -- 0:01:00 104500 -- (-1425.952) [-1420.210] (-1422.997) (-1431.329) * [-1421.441] (-1422.701) (-1422.557) (-1424.901) -- 0:00:59 105000 -- (-1420.554) [-1420.476] (-1420.224) (-1432.603) * (-1419.899) (-1425.406) [-1420.087] (-1420.114) -- 0:00:59 Average standard deviation of split frequencies: 0.017789 105500 -- [-1421.207] (-1421.422) (-1421.996) (-1431.948) * (-1419.858) (-1422.133) [-1419.884] (-1419.450) -- 0:00:59 106000 -- (-1420.552) (-1422.440) (-1423.444) [-1439.582] * (-1420.982) (-1423.464) [-1421.548] (-1421.564) -- 0:00:59 106500 -- (-1420.163) (-1422.974) (-1423.133) [-1426.202] * (-1422.175) (-1426.094) [-1422.886] (-1421.463) -- 0:00:58 107000 -- (-1421.687) [-1419.672] (-1422.387) (-1430.510) * (-1421.979) (-1424.978) (-1420.528) [-1421.718] -- 0:00:58 107500 -- (-1420.762) (-1419.672) (-1427.719) [-1425.115] * (-1420.394) [-1421.496] (-1426.455) (-1421.532) -- 0:00:58 108000 -- (-1421.363) (-1420.888) (-1425.766) [-1430.108] * [-1420.770] (-1423.976) (-1423.909) (-1421.549) -- 0:00:57 108500 -- (-1423.481) [-1420.699] (-1425.289) (-1429.055) * (-1421.222) [-1423.919] (-1420.551) (-1420.887) -- 0:00:57 109000 -- (-1419.892) (-1420.197) [-1425.943] (-1428.149) * (-1421.607) (-1422.432) (-1420.590) [-1421.549] -- 0:00:57 109500 -- (-1421.442) [-1420.544] (-1426.624) (-1433.930) * [-1422.549] (-1422.254) (-1422.896) (-1420.525) -- 0:00:56 110000 -- (-1420.903) (-1423.714) (-1427.738) [-1431.242] * (-1423.379) (-1423.543) (-1424.871) [-1421.321] -- 0:00:56 Average standard deviation of split frequencies: 0.017512 110500 -- (-1422.769) (-1422.616) (-1422.786) [-1424.727] * (-1422.778) (-1420.825) (-1422.708) [-1420.717] -- 0:01:04 111000 -- [-1420.873] (-1423.053) (-1422.163) (-1429.966) * (-1424.523) (-1422.090) [-1422.815] (-1419.616) -- 0:01:04 111500 -- (-1422.384) (-1425.131) [-1422.218] (-1432.328) * (-1419.993) [-1421.511] (-1423.833) (-1420.387) -- 0:01:03 112000 -- (-1423.958) (-1430.463) (-1419.947) [-1432.938] * [-1419.952] (-1421.097) (-1423.089) (-1420.366) -- 0:01:03 112500 -- (-1420.102) (-1428.885) (-1422.387) [-1430.540] * (-1422.066) (-1423.665) [-1423.869] (-1419.732) -- 0:01:03 113000 -- [-1420.419] (-1420.173) (-1424.314) (-1428.389) * [-1422.066] (-1424.258) (-1420.054) (-1420.998) -- 0:01:02 113500 -- [-1422.737] (-1420.004) (-1421.081) (-1424.894) * (-1420.311) [-1424.789] (-1420.273) (-1419.703) -- 0:01:02 114000 -- (-1425.129) (-1422.495) [-1421.633] (-1435.034) * (-1419.257) [-1421.945] (-1420.646) (-1419.781) -- 0:01:02 114500 -- (-1423.142) (-1423.203) [-1420.613] (-1428.717) * (-1420.036) [-1421.286] (-1421.199) (-1419.991) -- 0:01:01 115000 -- [-1420.076] (-1421.887) (-1419.845) (-1433.215) * (-1419.769) (-1422.003) (-1422.653) [-1423.185] -- 0:01:01 Average standard deviation of split frequencies: 0.018287 115500 -- (-1420.766) [-1424.709] (-1423.060) (-1441.202) * [-1419.769] (-1421.548) (-1421.841) (-1423.121) -- 0:01:01 116000 -- (-1421.486) (-1424.114) [-1423.656] (-1431.263) * [-1421.199] (-1421.409) (-1424.278) (-1421.588) -- 0:01:00 116500 -- (-1425.445) (-1422.724) (-1424.618) [-1431.811] * (-1419.821) [-1419.840] (-1421.031) (-1422.705) -- 0:01:00 117000 -- (-1420.329) [-1421.574] (-1426.270) (-1434.098) * (-1422.088) (-1419.743) (-1420.404) [-1423.143] -- 0:01:00 117500 -- (-1420.196) (-1421.675) (-1429.873) [-1432.434] * [-1420.263] (-1420.526) (-1420.556) (-1423.073) -- 0:01:00 118000 -- [-1420.038] (-1423.157) (-1423.584) (-1431.882) * [-1421.509] (-1421.990) (-1423.556) (-1420.514) -- 0:00:59 118500 -- (-1420.939) (-1421.683) (-1422.761) [-1429.294] * [-1420.201] (-1424.393) (-1420.811) (-1420.793) -- 0:00:59 119000 -- (-1421.009) [-1420.714] (-1421.655) (-1428.789) * (-1420.600) (-1423.979) (-1428.167) [-1420.848] -- 0:00:59 119500 -- [-1422.769] (-1421.260) (-1419.967) (-1431.495) * (-1420.199) (-1421.410) (-1421.890) [-1419.926] -- 0:00:58 120000 -- [-1427.577] (-1421.368) (-1420.134) (-1438.093) * (-1421.992) (-1423.003) (-1421.110) [-1422.072] -- 0:00:58 Average standard deviation of split frequencies: 0.017066 120500 -- (-1424.899) (-1421.259) [-1420.263] (-1434.087) * [-1421.154] (-1423.281) (-1421.989) (-1422.431) -- 0:00:58 121000 -- (-1419.316) [-1421.164] (-1419.367) (-1431.702) * (-1424.988) (-1422.199) (-1423.528) [-1421.864] -- 0:00:58 121500 -- (-1420.014) (-1422.046) (-1420.918) [-1432.267] * (-1423.383) [-1422.095] (-1421.402) (-1419.879) -- 0:00:57 122000 -- (-1419.351) [-1420.486] (-1420.876) (-1434.546) * (-1422.121) (-1424.530) (-1420.689) [-1419.860] -- 0:00:57 122500 -- [-1420.124] (-1420.983) (-1422.087) (-1426.783) * (-1421.060) (-1424.036) (-1420.386) [-1419.320] -- 0:00:57 123000 -- [-1421.073] (-1421.633) (-1419.395) (-1431.648) * (-1421.336) (-1421.892) (-1421.413) [-1420.114] -- 0:00:57 123500 -- (-1421.063) (-1421.839) [-1419.392] (-1431.821) * [-1423.125] (-1422.933) (-1423.118) (-1420.487) -- 0:00:56 124000 -- (-1421.049) (-1422.558) (-1420.057) [-1437.262] * [-1421.053] (-1424.080) (-1420.935) (-1423.392) -- 0:00:56 124500 -- [-1421.073] (-1422.657) (-1421.115) (-1431.601) * (-1421.188) (-1423.709) (-1422.686) [-1422.161] -- 0:00:56 125000 -- [-1423.413] (-1419.705) (-1422.280) (-1431.974) * (-1420.883) (-1425.119) (-1424.981) [-1421.808] -- 0:00:56 Average standard deviation of split frequencies: 0.019047 125500 -- (-1423.323) [-1421.786] (-1420.006) (-1434.946) * (-1424.423) (-1423.346) [-1421.928] (-1421.024) -- 0:00:55 126000 -- (-1420.969) [-1420.454] (-1421.118) (-1430.176) * (-1421.153) [-1424.321] (-1420.976) (-1420.554) -- 0:00:55 126500 -- [-1421.918] (-1420.537) (-1419.938) (-1425.543) * (-1421.703) (-1422.030) (-1426.101) [-1420.177] -- 0:01:02 127000 -- [-1421.532] (-1420.238) (-1420.096) (-1421.923) * (-1422.690) [-1422.881] (-1429.663) (-1421.252) -- 0:01:01 127500 -- (-1421.219) [-1423.395] (-1420.828) (-1422.594) * (-1423.643) (-1421.600) (-1425.164) [-1422.428] -- 0:01:01 128000 -- (-1419.980) (-1424.437) (-1424.844) [-1422.495] * (-1423.741) [-1422.551] (-1424.782) (-1422.401) -- 0:01:01 128500 -- (-1422.370) [-1421.078] (-1420.945) (-1422.042) * [-1425.264] (-1420.802) (-1423.006) (-1425.015) -- 0:01:01 129000 -- [-1430.338] (-1421.517) (-1421.250) (-1420.707) * (-1421.880) (-1422.233) (-1423.853) [-1424.013] -- 0:01:00 129500 -- (-1424.749) (-1423.586) [-1420.975] (-1420.886) * (-1424.686) (-1420.121) [-1423.963] (-1424.079) -- 0:01:00 130000 -- (-1424.421) [-1423.273] (-1422.985) (-1420.682) * [-1423.838] (-1422.034) (-1424.347) (-1422.640) -- 0:01:00 Average standard deviation of split frequencies: 0.019842 130500 -- (-1421.451) [-1420.577] (-1422.808) (-1421.387) * (-1423.008) [-1422.073] (-1421.077) (-1424.350) -- 0:00:59 131000 -- (-1420.931) (-1419.541) [-1420.423] (-1422.298) * (-1425.087) [-1419.878] (-1423.502) (-1423.776) -- 0:00:59 131500 -- (-1421.385) (-1419.800) [-1429.521] (-1422.511) * (-1424.174) (-1420.232) [-1419.872] (-1424.739) -- 0:00:59 132000 -- (-1420.314) [-1420.101] (-1425.516) (-1421.777) * (-1426.169) (-1425.826) [-1420.348] (-1421.856) -- 0:00:59 132500 -- (-1425.278) [-1421.386] (-1422.931) (-1423.520) * (-1422.632) (-1427.178) [-1420.050] (-1420.360) -- 0:00:58 133000 -- (-1421.127) [-1420.561] (-1423.352) (-1423.715) * (-1424.370) (-1423.533) (-1420.550) [-1420.241] -- 0:00:58 133500 -- (-1420.435) [-1421.536] (-1425.247) (-1423.734) * [-1426.756] (-1420.066) (-1419.864) (-1422.175) -- 0:00:58 134000 -- (-1420.010) (-1421.590) [-1428.950] (-1421.804) * (-1424.816) (-1423.529) [-1420.177] (-1421.443) -- 0:00:58 134500 -- [-1419.948] (-1421.432) (-1422.083) (-1422.354) * [-1423.503] (-1424.949) (-1423.588) (-1420.173) -- 0:00:57 135000 -- (-1423.609) [-1422.743] (-1423.185) (-1421.649) * [-1420.292] (-1422.766) (-1422.507) (-1419.709) -- 0:00:57 Average standard deviation of split frequencies: 0.015507 135500 -- (-1420.113) (-1422.473) (-1424.463) [-1425.845] * [-1420.342] (-1423.240) (-1421.294) (-1421.430) -- 0:00:57 136000 -- (-1420.151) [-1422.386] (-1425.990) (-1423.190) * (-1420.764) (-1423.543) [-1421.746] (-1425.234) -- 0:00:57 136500 -- [-1420.275] (-1423.761) (-1424.170) (-1421.581) * (-1421.158) [-1419.826] (-1420.922) (-1426.459) -- 0:00:56 137000 -- (-1420.343) [-1422.780] (-1424.756) (-1421.572) * (-1421.855) (-1423.900) [-1420.929] (-1421.313) -- 0:00:56 137500 -- (-1422.876) (-1425.588) [-1420.406] (-1423.489) * (-1422.384) [-1421.757] (-1421.650) (-1423.229) -- 0:00:56 138000 -- [-1420.960] (-1421.117) (-1421.468) (-1421.681) * (-1421.265) [-1422.202] (-1422.173) (-1422.035) -- 0:00:56 138500 -- (-1420.265) (-1421.779) (-1419.870) [-1423.623] * (-1420.932) (-1419.927) (-1421.577) [-1419.549] -- 0:00:55 139000 -- (-1420.604) [-1422.762] (-1420.098) (-1422.473) * (-1423.495) (-1420.631) (-1420.859) [-1420.350] -- 0:00:55 139500 -- (-1420.598) (-1420.194) [-1419.786] (-1420.008) * (-1425.337) (-1424.554) [-1421.904] (-1419.351) -- 0:00:55 140000 -- (-1420.598) [-1420.774] (-1420.875) (-1421.421) * (-1423.209) (-1422.507) (-1420.023) [-1422.031] -- 0:00:55 Average standard deviation of split frequencies: 0.014110 140500 -- (-1421.830) (-1421.689) [-1422.099] (-1419.746) * (-1422.267) (-1422.284) (-1424.926) [-1420.772] -- 0:00:55 141000 -- (-1419.902) [-1419.885] (-1422.871) (-1420.896) * (-1420.709) (-1422.422) (-1423.846) [-1421.321] -- 0:00:54 141500 -- (-1422.618) (-1420.598) [-1424.806] (-1424.524) * (-1424.179) (-1426.553) [-1424.959] (-1423.148) -- 0:00:54 142000 -- [-1419.733] (-1422.024) (-1421.094) (-1422.346) * [-1424.168] (-1420.603) (-1423.043) (-1421.535) -- 0:00:54 142500 -- (-1420.302) (-1422.065) (-1423.914) [-1420.802] * [-1422.510] (-1422.345) (-1423.508) (-1420.019) -- 0:01:00 143000 -- (-1421.100) (-1421.152) (-1423.849) [-1419.825] * [-1420.518] (-1421.733) (-1421.296) (-1419.268) -- 0:00:59 143500 -- [-1420.508] (-1423.894) (-1425.555) (-1421.596) * [-1420.490] (-1424.008) (-1422.285) (-1422.060) -- 0:00:59 144000 -- [-1421.359] (-1421.150) (-1425.052) (-1425.132) * (-1419.520) [-1425.274] (-1420.774) (-1421.186) -- 0:00:59 144500 -- [-1420.252] (-1420.082) (-1424.819) (-1422.857) * (-1419.668) (-1427.648) [-1420.649] (-1419.921) -- 0:00:59 145000 -- (-1421.280) (-1419.356) (-1420.281) [-1425.613] * (-1421.962) (-1423.859) (-1423.214) [-1420.440] -- 0:00:58 Average standard deviation of split frequencies: 0.016144 145500 -- (-1420.977) (-1420.757) (-1420.579) [-1424.986] * (-1420.786) (-1424.051) (-1425.618) [-1420.377] -- 0:00:58 146000 -- (-1421.072) (-1424.723) (-1422.925) [-1420.793] * (-1426.067) (-1424.069) (-1425.488) [-1424.432] -- 0:00:58 146500 -- [-1420.726] (-1424.733) (-1420.323) (-1421.565) * (-1423.022) (-1423.263) (-1425.247) [-1421.167] -- 0:00:58 147000 -- (-1420.904) (-1422.501) (-1421.268) [-1424.226] * (-1422.532) [-1420.185] (-1423.035) (-1421.317) -- 0:00:58 147500 -- (-1420.056) (-1421.715) [-1419.252] (-1428.093) * (-1419.309) (-1423.434) (-1423.070) [-1421.019] -- 0:00:57 148000 -- (-1424.250) (-1422.665) (-1419.252) [-1427.335] * [-1419.588] (-1420.860) (-1420.942) (-1420.847) -- 0:00:57 148500 -- (-1420.678) (-1420.424) [-1419.461] (-1423.318) * [-1420.718] (-1420.331) (-1420.119) (-1420.255) -- 0:00:57 149000 -- (-1419.336) (-1424.482) [-1419.448] (-1421.787) * (-1421.233) [-1425.461] (-1420.108) (-1422.164) -- 0:00:57 149500 -- (-1421.770) (-1424.391) [-1420.350] (-1420.217) * (-1420.379) (-1422.121) (-1420.207) [-1420.448] -- 0:00:56 150000 -- (-1424.092) (-1422.176) [-1419.966] (-1425.195) * (-1420.456) (-1420.782) [-1420.348] (-1421.596) -- 0:00:56 Average standard deviation of split frequencies: 0.015150 150500 -- (-1420.051) [-1421.690] (-1419.451) (-1425.238) * [-1425.497] (-1422.034) (-1419.521) (-1422.607) -- 0:00:56 151000 -- (-1422.221) (-1422.790) [-1420.999] (-1425.012) * (-1422.993) (-1423.331) (-1419.901) [-1421.106] -- 0:00:56 151500 -- (-1421.927) [-1422.766] (-1421.665) (-1421.128) * (-1420.636) [-1424.067] (-1421.077) (-1420.478) -- 0:00:56 152000 -- [-1427.002] (-1419.694) (-1421.660) (-1420.969) * (-1421.060) (-1421.864) (-1421.842) [-1419.929] -- 0:00:55 152500 -- (-1424.430) [-1419.710] (-1427.479) (-1421.704) * (-1421.040) (-1423.590) [-1420.251] (-1419.361) -- 0:00:55 153000 -- (-1422.688) [-1420.120] (-1423.364) (-1421.508) * (-1422.824) [-1419.454] (-1420.677) (-1420.575) -- 0:00:55 153500 -- (-1423.008) (-1422.569) [-1421.054] (-1420.871) * (-1420.771) (-1421.496) (-1421.966) [-1421.697] -- 0:00:55 154000 -- (-1422.159) (-1420.236) [-1421.754] (-1421.466) * [-1419.958] (-1427.940) (-1424.128) (-1422.507) -- 0:00:54 154500 -- (-1420.200) [-1420.539] (-1427.540) (-1421.700) * [-1421.450] (-1422.177) (-1426.007) (-1420.811) -- 0:00:54 155000 -- (-1420.380) (-1420.971) [-1423.824] (-1421.494) * (-1422.959) (-1424.145) (-1423.445) [-1422.090] -- 0:00:54 Average standard deviation of split frequencies: 0.014314 155500 -- (-1422.825) (-1428.826) (-1421.138) [-1421.552] * (-1423.662) (-1423.059) (-1421.187) [-1421.593] -- 0:00:54 156000 -- (-1420.841) (-1423.756) (-1425.288) [-1422.409] * (-1420.418) (-1420.753) [-1420.412] (-1421.695) -- 0:00:54 156500 -- [-1422.974] (-1425.483) (-1423.549) (-1422.278) * (-1420.304) (-1421.209) (-1420.179) [-1424.703] -- 0:00:53 157000 -- (-1421.396) (-1423.474) [-1425.828] (-1423.215) * (-1421.427) (-1423.499) [-1419.939] (-1421.132) -- 0:00:53 157500 -- (-1422.818) [-1422.651] (-1429.846) (-1420.732) * (-1423.161) (-1423.422) (-1420.867) [-1422.789] -- 0:00:53 158000 -- (-1428.334) (-1421.283) [-1420.265] (-1420.690) * (-1425.468) (-1424.132) [-1420.504] (-1426.261) -- 0:00:53 158500 -- [-1421.570] (-1420.136) (-1420.635) (-1422.241) * (-1427.320) [-1421.192] (-1420.609) (-1424.899) -- 0:00:58 159000 -- (-1421.626) (-1421.742) [-1422.796] (-1423.686) * [-1434.164] (-1422.963) (-1419.660) (-1424.477) -- 0:00:58 159500 -- (-1424.303) [-1419.901] (-1423.438) (-1425.922) * [-1424.579] (-1420.502) (-1420.573) (-1420.558) -- 0:00:57 160000 -- [-1423.028] (-1421.022) (-1421.239) (-1424.787) * (-1420.339) (-1421.258) (-1420.388) [-1420.033] -- 0:00:57 Average standard deviation of split frequencies: 0.014344 160500 -- [-1420.686] (-1420.318) (-1421.814) (-1422.099) * [-1421.008] (-1419.736) (-1420.835) (-1421.809) -- 0:00:57 161000 -- (-1421.047) [-1420.608] (-1424.285) (-1421.967) * (-1420.767) (-1420.849) (-1422.016) [-1420.479] -- 0:00:57 161500 -- (-1421.565) [-1420.608] (-1420.946) (-1421.617) * [-1420.432] (-1420.644) (-1421.381) (-1421.395) -- 0:00:57 162000 -- (-1422.166) (-1421.296) (-1419.313) [-1424.583] * (-1425.149) [-1423.123] (-1420.967) (-1422.629) -- 0:00:56 162500 -- (-1420.671) (-1422.804) (-1420.244) [-1421.771] * (-1420.371) (-1421.082) (-1421.979) [-1421.100] -- 0:00:56 163000 -- (-1420.554) [-1422.967] (-1420.566) (-1424.098) * [-1421.027] (-1420.392) (-1421.236) (-1420.061) -- 0:00:56 163500 -- (-1419.895) (-1424.267) [-1420.295] (-1426.592) * (-1421.425) [-1420.289] (-1421.204) (-1425.029) -- 0:00:56 164000 -- [-1421.052] (-1422.752) (-1421.026) (-1423.066) * (-1425.375) (-1422.927) (-1422.490) [-1425.473] -- 0:00:56 164500 -- (-1420.237) (-1421.666) (-1421.896) [-1422.216] * (-1421.740) (-1421.433) (-1421.543) [-1421.134] -- 0:00:55 165000 -- [-1419.618] (-1422.117) (-1420.551) (-1423.096) * (-1419.849) [-1422.521] (-1420.721) (-1422.457) -- 0:00:55 Average standard deviation of split frequencies: 0.015368 165500 -- (-1419.736) (-1421.534) [-1421.374] (-1420.155) * (-1420.206) [-1420.598] (-1421.321) (-1422.135) -- 0:00:55 166000 -- (-1420.164) [-1419.666] (-1421.310) (-1420.163) * [-1420.486] (-1423.274) (-1422.602) (-1421.506) -- 0:00:55 166500 -- (-1420.663) (-1419.673) (-1422.393) [-1419.950] * (-1421.539) (-1422.927) (-1424.745) [-1420.490] -- 0:00:55 167000 -- (-1420.726) (-1420.416) (-1421.083) [-1419.905] * (-1420.282) (-1425.925) (-1425.211) [-1420.227] -- 0:00:54 167500 -- (-1420.856) (-1424.218) (-1420.227) [-1419.862] * [-1420.318] (-1421.978) (-1424.924) (-1422.146) -- 0:00:54 168000 -- (-1420.702) (-1422.789) [-1420.653] (-1424.054) * (-1420.362) [-1420.909] (-1431.856) (-1421.799) -- 0:00:54 168500 -- [-1422.296] (-1424.702) (-1419.550) (-1420.379) * (-1421.048) (-1421.958) [-1422.121] (-1421.029) -- 0:00:54 169000 -- [-1420.092] (-1420.190) (-1420.130) (-1422.060) * (-1421.048) (-1422.291) (-1422.492) [-1423.104] -- 0:00:54 169500 -- [-1419.982] (-1420.088) (-1421.366) (-1421.044) * (-1427.924) (-1419.627) (-1423.299) [-1420.895] -- 0:00:53 170000 -- (-1420.041) (-1420.572) (-1432.678) [-1420.217] * (-1422.136) [-1420.913] (-1422.280) (-1420.571) -- 0:00:53 Average standard deviation of split frequencies: 0.017862 170500 -- (-1424.637) [-1421.075] (-1424.784) (-1419.937) * (-1423.203) [-1420.285] (-1421.945) (-1424.876) -- 0:00:53 171000 -- [-1423.106] (-1420.261) (-1425.158) (-1420.397) * [-1424.528] (-1421.900) (-1421.432) (-1423.613) -- 0:00:53 171500 -- (-1422.082) [-1419.945] (-1421.108) (-1420.257) * [-1419.727] (-1426.023) (-1420.974) (-1424.768) -- 0:00:53 172000 -- (-1423.739) (-1419.450) [-1421.466] (-1419.666) * (-1420.364) (-1423.193) [-1420.668] (-1423.911) -- 0:00:52 172500 -- (-1422.152) (-1423.184) [-1421.543] (-1419.666) * [-1420.634] (-1428.634) (-1421.376) (-1420.270) -- 0:00:52 173000 -- (-1425.702) (-1423.014) (-1425.931) [-1419.534] * (-1421.551) (-1425.202) [-1422.084] (-1420.469) -- 0:00:52 173500 -- (-1420.589) (-1420.905) (-1426.455) [-1420.535] * (-1422.710) [-1422.687] (-1423.122) (-1420.526) -- 0:00:52 174000 -- (-1420.512) (-1420.567) (-1425.371) [-1420.234] * (-1421.131) (-1424.351) (-1423.006) [-1423.871] -- 0:00:52 174500 -- (-1420.543) [-1419.427] (-1423.721) (-1421.367) * (-1420.839) [-1428.804] (-1424.586) (-1425.381) -- 0:00:56 175000 -- (-1421.858) (-1420.891) [-1421.494] (-1422.646) * (-1420.507) (-1423.792) (-1424.565) [-1422.019] -- 0:00:56 Average standard deviation of split frequencies: 0.015598 175500 -- (-1420.474) [-1420.218] (-1423.511) (-1420.629) * [-1420.379] (-1421.346) (-1430.492) (-1424.144) -- 0:00:56 176000 -- (-1420.499) [-1421.321] (-1423.704) (-1420.921) * (-1420.991) (-1421.708) [-1421.690] (-1420.319) -- 0:00:56 176500 -- (-1419.600) (-1421.468) [-1420.193] (-1423.974) * (-1421.681) [-1421.719] (-1423.548) (-1421.364) -- 0:00:55 177000 -- (-1421.238) [-1420.363] (-1419.987) (-1424.217) * (-1423.529) [-1422.917] (-1423.638) (-1421.626) -- 0:00:55 177500 -- (-1422.551) (-1421.238) [-1419.964] (-1425.458) * (-1423.483) [-1422.306] (-1423.779) (-1422.872) -- 0:00:55 178000 -- (-1420.962) (-1421.353) (-1421.323) [-1425.476] * [-1422.472] (-1421.406) (-1420.564) (-1425.296) -- 0:00:55 178500 -- (-1420.162) (-1419.936) (-1420.797) [-1422.822] * [-1423.062] (-1421.631) (-1421.357) (-1424.051) -- 0:00:55 179000 -- [-1419.180] (-1421.588) (-1420.535) (-1423.435) * (-1421.375) [-1421.540] (-1422.167) (-1421.244) -- 0:00:55 179500 -- (-1420.147) [-1422.067] (-1420.569) (-1421.801) * [-1421.500] (-1420.579) (-1422.534) (-1422.303) -- 0:00:54 180000 -- (-1419.840) [-1422.170] (-1423.023) (-1420.257) * (-1420.304) [-1421.733] (-1427.733) (-1420.592) -- 0:00:54 Average standard deviation of split frequencies: 0.016471 180500 -- (-1419.970) (-1420.709) (-1425.168) [-1428.437] * (-1419.372) (-1422.187) [-1422.477] (-1422.857) -- 0:00:54 181000 -- [-1420.666] (-1422.030) (-1424.520) (-1424.217) * (-1419.610) (-1419.971) [-1419.870] (-1421.529) -- 0:00:54 181500 -- (-1420.317) (-1420.316) [-1422.954] (-1424.385) * (-1422.010) (-1419.640) [-1419.612] (-1421.656) -- 0:00:54 182000 -- (-1420.377) [-1420.928] (-1425.100) (-1422.225) * (-1422.649) (-1419.626) [-1424.015] (-1420.766) -- 0:00:53 182500 -- (-1420.390) [-1422.429] (-1422.082) (-1420.396) * (-1421.021) (-1420.246) [-1427.173] (-1422.506) -- 0:00:53 183000 -- (-1419.733) [-1422.267] (-1420.129) (-1420.402) * (-1421.790) [-1422.538] (-1430.613) (-1420.810) -- 0:00:53 183500 -- [-1421.375] (-1420.805) (-1421.751) (-1424.588) * (-1422.983) [-1422.655] (-1420.869) (-1421.697) -- 0:00:53 184000 -- (-1421.402) (-1421.285) [-1421.071] (-1422.237) * [-1422.436] (-1419.554) (-1421.269) (-1420.658) -- 0:00:53 184500 -- (-1422.274) [-1420.325] (-1420.837) (-1422.133) * (-1422.645) [-1421.105] (-1420.341) (-1421.755) -- 0:00:53 185000 -- (-1422.378) (-1421.831) (-1420.780) [-1423.509] * (-1422.193) (-1423.122) [-1422.281] (-1424.105) -- 0:00:52 Average standard deviation of split frequencies: 0.013716 185500 -- (-1422.286) [-1424.049] (-1422.983) (-1422.182) * (-1422.152) [-1422.653] (-1422.583) (-1421.577) -- 0:00:52 186000 -- [-1423.124] (-1420.010) (-1422.890) (-1422.177) * (-1420.755) [-1421.213] (-1423.857) (-1424.328) -- 0:00:52 186500 -- (-1422.920) (-1421.867) [-1422.324] (-1423.638) * [-1421.567] (-1422.410) (-1422.708) (-1426.466) -- 0:00:52 187000 -- [-1420.471] (-1420.955) (-1421.929) (-1425.919) * (-1420.984) (-1421.026) [-1424.752] (-1421.030) -- 0:00:52 187500 -- (-1420.949) (-1419.660) (-1423.128) [-1420.330] * (-1420.479) [-1422.651] (-1421.184) (-1420.278) -- 0:00:52 188000 -- (-1421.056) (-1419.758) (-1422.485) [-1420.717] * [-1420.867] (-1420.296) (-1421.610) (-1421.777) -- 0:00:51 188500 -- [-1419.822] (-1419.701) (-1423.484) (-1420.506) * (-1421.858) [-1421.161] (-1420.636) (-1422.138) -- 0:00:51 189000 -- (-1420.721) [-1421.400] (-1420.670) (-1420.484) * (-1422.438) (-1420.974) [-1419.810] (-1420.971) -- 0:00:51 189500 -- (-1420.720) [-1420.283] (-1419.363) (-1419.516) * [-1423.708] (-1421.502) (-1419.429) (-1421.245) -- 0:00:51 190000 -- (-1421.384) [-1421.568] (-1423.233) (-1422.932) * (-1421.618) (-1421.271) (-1419.486) [-1421.331] -- 0:00:51 Average standard deviation of split frequencies: 0.011813 190500 -- (-1419.997) (-1422.940) [-1422.874] (-1423.344) * [-1424.819] (-1421.191) (-1419.465) (-1419.558) -- 0:00:55 191000 -- (-1420.124) (-1420.266) [-1422.602] (-1424.312) * (-1421.880) (-1422.264) [-1419.863] (-1423.276) -- 0:00:55 191500 -- (-1421.622) (-1422.954) (-1425.458) [-1420.608] * (-1421.594) (-1422.307) (-1421.304) [-1421.655] -- 0:00:54 192000 -- (-1422.916) (-1424.606) [-1421.498] (-1420.621) * (-1422.999) (-1423.115) (-1426.586) [-1421.598] -- 0:00:54 192500 -- (-1421.102) (-1421.351) (-1419.628) [-1422.178] * (-1424.346) [-1421.257] (-1423.593) (-1421.210) -- 0:00:54 193000 -- (-1423.100) [-1419.499] (-1419.931) (-1424.907) * [-1421.695] (-1422.165) (-1426.276) (-1422.383) -- 0:00:54 193500 -- [-1422.318] (-1419.443) (-1420.347) (-1428.947) * [-1419.908] (-1420.941) (-1423.154) (-1421.368) -- 0:00:54 194000 -- (-1422.152) (-1420.328) (-1420.649) [-1420.703] * (-1420.643) [-1420.543] (-1422.044) (-1422.757) -- 0:00:54 194500 -- (-1420.469) (-1419.954) [-1422.667] (-1422.345) * (-1420.231) (-1420.449) [-1422.077] (-1422.757) -- 0:00:53 195000 -- (-1422.494) [-1419.841] (-1423.907) (-1426.425) * (-1421.788) [-1420.644] (-1420.155) (-1421.585) -- 0:00:53 Average standard deviation of split frequencies: 0.011884 195500 -- (-1422.109) (-1419.250) [-1420.222] (-1420.118) * (-1421.064) [-1422.283] (-1420.096) (-1421.839) -- 0:00:53 196000 -- [-1422.130] (-1422.860) (-1422.395) (-1421.242) * (-1422.120) (-1422.417) (-1422.855) [-1421.932] -- 0:00:53 196500 -- (-1422.214) (-1419.791) (-1421.516) [-1422.498] * (-1421.869) (-1420.949) [-1419.629] (-1420.481) -- 0:00:53 197000 -- (-1424.605) [-1419.906] (-1421.072) (-1421.233) * (-1424.991) (-1421.595) [-1420.310] (-1424.831) -- 0:00:52 197500 -- (-1423.093) (-1421.227) (-1421.736) [-1420.333] * (-1423.137) [-1423.734] (-1426.882) (-1425.254) -- 0:00:52 198000 -- (-1423.631) (-1424.008) [-1422.676] (-1423.668) * (-1420.950) (-1423.513) [-1422.329] (-1426.025) -- 0:00:52 198500 -- (-1421.030) [-1420.099] (-1421.148) (-1420.384) * (-1423.075) [-1423.296] (-1421.318) (-1424.330) -- 0:00:52 199000 -- (-1425.755) (-1419.771) [-1421.260] (-1425.675) * (-1422.632) (-1421.258) (-1421.450) [-1421.538] -- 0:00:52 199500 -- (-1420.808) (-1421.910) (-1421.952) [-1422.127] * [-1422.677] (-1421.347) (-1420.496) (-1421.308) -- 0:00:52 200000 -- (-1420.561) (-1422.096) (-1421.542) [-1422.418] * [-1421.645] (-1421.765) (-1421.078) (-1421.729) -- 0:00:51 Average standard deviation of split frequencies: 0.012161 200500 -- (-1420.243) (-1422.048) (-1425.467) [-1421.857] * [-1426.513] (-1424.033) (-1419.543) (-1421.047) -- 0:00:51 201000 -- (-1420.175) [-1423.051] (-1421.017) (-1420.840) * (-1424.793) (-1423.156) [-1419.543] (-1420.780) -- 0:00:51 201500 -- (-1420.431) (-1421.680) [-1421.722] (-1421.244) * [-1421.822] (-1425.417) (-1419.966) (-1420.412) -- 0:00:51 202000 -- (-1422.413) (-1420.290) (-1422.280) [-1420.058] * (-1421.651) [-1427.218] (-1422.068) (-1421.695) -- 0:00:51 202500 -- [-1421.779] (-1421.054) (-1421.810) (-1420.855) * (-1422.286) [-1423.415] (-1420.497) (-1421.120) -- 0:00:51 203000 -- (-1420.605) [-1420.180] (-1420.534) (-1420.861) * (-1425.622) (-1420.833) (-1420.734) [-1424.428] -- 0:00:51 203500 -- (-1420.289) (-1420.175) [-1420.715] (-1420.528) * (-1421.245) (-1421.534) [-1419.497] (-1420.550) -- 0:00:50 204000 -- [-1423.316] (-1421.702) (-1419.818) (-1420.528) * (-1423.501) (-1420.099) [-1421.082] (-1422.238) -- 0:00:50 204500 -- (-1420.706) (-1421.068) (-1420.405) [-1420.406] * (-1419.455) (-1419.938) [-1421.901] (-1419.851) -- 0:00:50 205000 -- (-1420.881) (-1420.533) (-1422.399) [-1425.594] * (-1421.036) [-1420.569] (-1420.616) (-1419.749) -- 0:00:50 Average standard deviation of split frequencies: 0.009423 205500 -- [-1423.752] (-1423.724) (-1421.534) (-1420.138) * [-1421.293] (-1421.070) (-1420.661) (-1419.311) -- 0:00:50 206000 -- [-1420.993] (-1420.493) (-1420.679) (-1420.765) * (-1423.094) [-1420.140] (-1420.661) (-1420.195) -- 0:00:53 206500 -- (-1421.651) [-1420.337] (-1420.975) (-1421.417) * (-1421.258) (-1419.849) (-1420.458) [-1420.577] -- 0:00:53 207000 -- (-1420.044) [-1421.129] (-1424.243) (-1423.021) * [-1421.266] (-1422.709) (-1421.400) (-1420.123) -- 0:00:53 207500 -- [-1421.723] (-1420.211) (-1422.426) (-1419.957) * (-1424.099) [-1420.915] (-1427.332) (-1421.430) -- 0:00:53 208000 -- (-1420.866) (-1419.758) (-1425.030) [-1420.928] * (-1424.751) [-1423.836] (-1423.802) (-1423.028) -- 0:00:53 208500 -- (-1422.084) (-1422.937) [-1422.419] (-1422.409) * [-1423.648] (-1425.703) (-1423.027) (-1420.743) -- 0:00:53 209000 -- (-1422.676) (-1421.184) [-1422.408] (-1421.549) * (-1421.078) (-1426.175) (-1420.640) [-1422.491] -- 0:00:52 209500 -- [-1422.776] (-1422.896) (-1423.082) (-1420.923) * (-1422.646) (-1422.625) (-1423.753) [-1423.028] -- 0:00:52 210000 -- (-1421.483) [-1421.201] (-1420.570) (-1421.537) * (-1422.167) [-1421.800] (-1425.595) (-1421.522) -- 0:00:52 Average standard deviation of split frequencies: 0.007766 210500 -- (-1422.613) (-1419.835) [-1421.845] (-1430.229) * (-1421.342) (-1420.858) [-1423.295] (-1422.448) -- 0:00:52 211000 -- [-1424.333] (-1420.196) (-1421.486) (-1423.440) * (-1421.982) (-1422.965) [-1423.584] (-1423.411) -- 0:00:52 211500 -- (-1422.174) (-1423.432) (-1422.760) [-1423.273] * [-1419.759] (-1422.714) (-1424.997) (-1423.868) -- 0:00:52 212000 -- (-1421.782) (-1422.776) (-1421.169) [-1419.607] * (-1421.409) [-1421.590] (-1425.389) (-1421.272) -- 0:00:52 212500 -- (-1421.644) (-1423.271) [-1420.912] (-1419.606) * [-1423.289] (-1422.838) (-1426.610) (-1421.807) -- 0:00:51 213000 -- (-1423.471) (-1426.424) (-1421.577) [-1420.402] * [-1420.407] (-1420.527) (-1425.325) (-1425.511) -- 0:00:51 213500 -- (-1423.156) (-1422.557) (-1422.282) [-1420.864] * [-1420.957] (-1420.862) (-1423.765) (-1424.534) -- 0:00:51 214000 -- [-1419.999] (-1421.868) (-1421.867) (-1419.716) * (-1421.615) [-1419.790] (-1421.712) (-1422.662) -- 0:00:51 214500 -- (-1420.036) [-1421.618] (-1420.807) (-1419.351) * (-1422.095) (-1421.541) (-1422.754) [-1423.341] -- 0:00:51 215000 -- (-1419.850) [-1422.723] (-1421.695) (-1419.498) * [-1420.732] (-1423.782) (-1425.740) (-1422.673) -- 0:00:51 Average standard deviation of split frequencies: 0.010912 215500 -- (-1421.004) [-1423.603] (-1424.762) (-1419.371) * (-1421.125) (-1424.118) (-1424.168) [-1424.039] -- 0:00:50 216000 -- (-1422.317) (-1422.032) (-1420.627) [-1421.693] * (-1420.819) (-1423.997) [-1423.696] (-1426.894) -- 0:00:50 216500 -- [-1422.650] (-1420.367) (-1424.592) (-1421.277) * (-1421.838) [-1420.912] (-1423.649) (-1424.721) -- 0:00:50 217000 -- (-1421.699) [-1420.453] (-1421.531) (-1424.039) * (-1420.376) (-1420.492) (-1423.498) [-1424.525] -- 0:00:50 217500 -- (-1420.291) (-1420.657) (-1419.710) [-1421.346] * (-1420.285) [-1420.419] (-1422.771) (-1424.531) -- 0:00:50 218000 -- (-1422.899) (-1423.485) [-1423.845] (-1421.393) * (-1421.752) [-1420.565] (-1423.417) (-1422.697) -- 0:00:50 218500 -- [-1420.727] (-1423.284) (-1424.754) (-1420.441) * (-1421.862) (-1422.717) (-1425.702) [-1423.107] -- 0:00:50 219000 -- (-1420.167) [-1421.447] (-1419.750) (-1421.579) * (-1425.369) [-1421.115] (-1421.094) (-1423.003) -- 0:00:49 219500 -- [-1420.637] (-1419.710) (-1422.652) (-1420.814) * (-1421.181) [-1420.297] (-1421.949) (-1421.786) -- 0:00:49 220000 -- (-1422.008) (-1420.506) [-1422.461] (-1425.604) * (-1424.565) [-1421.341] (-1419.931) (-1421.903) -- 0:00:49 Average standard deviation of split frequencies: 0.011356 220500 -- (-1422.687) [-1420.167] (-1423.754) (-1425.315) * (-1420.015) (-1421.037) [-1419.953] (-1421.094) -- 0:00:49 221000 -- (-1421.662) (-1421.117) (-1420.799) [-1422.033] * (-1420.004) [-1421.247] (-1420.429) (-1421.884) -- 0:00:49 221500 -- (-1424.176) [-1422.046] (-1421.898) (-1421.471) * (-1419.625) (-1422.090) (-1422.463) [-1422.684] -- 0:00:49 222000 -- (-1422.805) (-1423.792) [-1422.686] (-1424.008) * (-1420.934) (-1420.907) (-1420.862) [-1421.397] -- 0:00:52 222500 -- (-1421.449) [-1422.125] (-1423.332) (-1423.781) * (-1420.990) [-1420.845] (-1420.750) (-1422.854) -- 0:00:52 223000 -- (-1420.998) (-1420.000) (-1421.657) [-1421.210] * (-1419.979) (-1421.328) [-1420.928] (-1422.108) -- 0:00:52 223500 -- (-1421.369) (-1419.929) [-1420.918] (-1421.707) * (-1419.659) (-1424.111) (-1421.923) [-1420.048] -- 0:00:52 224000 -- [-1424.236] (-1420.873) (-1423.590) (-1422.163) * (-1419.565) (-1422.994) [-1420.682] (-1424.170) -- 0:00:51 224500 -- (-1426.181) (-1420.913) [-1421.187] (-1421.089) * [-1419.203] (-1422.119) (-1420.684) (-1425.401) -- 0:00:51 225000 -- (-1423.533) (-1421.932) [-1420.122] (-1421.006) * (-1420.730) (-1422.120) [-1422.265] (-1420.564) -- 0:00:51 Average standard deviation of split frequencies: 0.012405 225500 -- (-1422.073) [-1423.712] (-1420.276) (-1420.209) * (-1421.205) [-1422.278] (-1421.677) (-1419.867) -- 0:00:51 226000 -- (-1422.192) (-1421.045) [-1421.210] (-1419.579) * [-1422.323] (-1423.700) (-1420.885) (-1420.401) -- 0:00:51 226500 -- (-1421.012) (-1421.182) (-1421.284) [-1422.877] * (-1421.125) (-1421.356) [-1421.098] (-1421.548) -- 0:00:51 227000 -- (-1424.263) (-1421.300) [-1421.348] (-1426.151) * (-1420.646) (-1422.660) (-1420.956) [-1421.865] -- 0:00:51 227500 -- (-1419.826) (-1421.071) [-1420.386] (-1420.559) * (-1419.534) (-1420.322) [-1421.536] (-1422.218) -- 0:00:50 228000 -- (-1425.438) (-1420.886) (-1421.344) [-1421.920] * (-1421.208) [-1420.556] (-1421.326) (-1422.974) -- 0:00:50 228500 -- (-1422.122) (-1421.388) [-1420.508] (-1421.795) * [-1420.001] (-1422.796) (-1423.904) (-1421.530) -- 0:00:50 229000 -- (-1420.930) (-1421.401) [-1419.779] (-1421.988) * (-1429.139) [-1422.758] (-1423.822) (-1421.095) -- 0:00:50 229500 -- (-1420.964) (-1422.806) (-1425.221) [-1421.268] * [-1422.713] (-1422.945) (-1424.852) (-1420.308) -- 0:00:50 230000 -- (-1420.199) (-1422.027) [-1422.840] (-1421.214) * [-1420.661] (-1421.411) (-1420.142) (-1423.262) -- 0:00:50 Average standard deviation of split frequencies: 0.011724 230500 -- (-1420.553) (-1423.118) [-1420.855] (-1426.174) * (-1423.230) (-1419.873) (-1421.842) [-1427.452] -- 0:00:50 231000 -- [-1422.367] (-1420.466) (-1422.248) (-1423.967) * (-1422.528) [-1423.894] (-1422.184) (-1421.680) -- 0:00:49 231500 -- (-1422.160) (-1420.020) [-1420.842] (-1424.019) * [-1421.567] (-1422.998) (-1420.408) (-1423.543) -- 0:00:49 232000 -- (-1422.976) (-1419.922) (-1420.719) [-1423.734] * (-1420.865) [-1422.922] (-1420.661) (-1426.419) -- 0:00:49 232500 -- [-1421.020] (-1419.922) (-1422.141) (-1423.913) * (-1421.504) [-1423.124] (-1421.741) (-1424.520) -- 0:00:49 233000 -- (-1420.757) [-1420.269] (-1420.628) (-1422.614) * (-1421.530) [-1421.091] (-1421.928) (-1419.834) -- 0:00:49 233500 -- (-1420.034) (-1420.882) (-1423.975) [-1422.781] * (-1422.625) (-1420.795) (-1422.168) [-1419.894] -- 0:00:49 234000 -- (-1420.388) (-1421.465) (-1422.668) [-1421.174] * (-1423.564) [-1421.073] (-1424.819) (-1420.105) -- 0:00:49 234500 -- [-1420.095] (-1420.268) (-1422.498) (-1421.579) * (-1423.771) [-1423.475] (-1422.783) (-1420.400) -- 0:00:48 235000 -- (-1419.842) (-1420.483) (-1419.348) [-1421.562] * (-1424.874) (-1421.998) (-1424.546) [-1421.313] -- 0:00:48 Average standard deviation of split frequencies: 0.012195 235500 -- (-1421.199) [-1420.128] (-1423.762) (-1420.617) * (-1422.833) (-1422.377) (-1422.218) [-1422.952] -- 0:00:48 236000 -- (-1419.884) [-1420.694] (-1419.487) (-1419.512) * [-1423.083] (-1422.104) (-1423.524) (-1419.695) -- 0:00:48 236500 -- (-1419.883) (-1421.029) (-1420.752) [-1420.867] * (-1422.486) (-1423.744) [-1421.955] (-1420.490) -- 0:00:48 237000 -- [-1419.741] (-1421.910) (-1420.799) (-1423.167) * [-1422.124] (-1419.887) (-1421.758) (-1420.536) -- 0:00:48 237500 -- (-1420.936) (-1423.379) [-1422.929] (-1421.111) * [-1420.811] (-1419.807) (-1423.468) (-1423.724) -- 0:00:48 238000 -- (-1420.555) [-1423.929] (-1420.053) (-1421.877) * (-1420.811) (-1421.001) [-1424.578] (-1423.175) -- 0:00:51 238500 -- [-1420.626] (-1422.476) (-1420.042) (-1422.170) * (-1424.204) [-1423.956] (-1421.846) (-1422.745) -- 0:00:51 239000 -- [-1420.006] (-1420.282) (-1421.082) (-1421.638) * (-1426.924) [-1423.225] (-1421.331) (-1422.395) -- 0:00:50 239500 -- (-1419.526) [-1420.859] (-1424.360) (-1421.277) * (-1424.514) (-1423.404) (-1421.549) [-1421.229] -- 0:00:50 240000 -- (-1420.135) (-1423.927) (-1420.789) [-1420.155] * [-1425.692] (-1422.163) (-1421.371) (-1421.803) -- 0:00:50 Average standard deviation of split frequencies: 0.012732 240500 -- (-1420.061) [-1423.632] (-1423.725) (-1423.189) * [-1423.310] (-1423.644) (-1420.963) (-1421.062) -- 0:00:50 241000 -- [-1420.561] (-1422.661) (-1421.847) (-1421.614) * (-1424.195) (-1425.811) (-1423.309) [-1420.924] -- 0:00:50 241500 -- (-1421.092) (-1422.673) (-1420.294) [-1422.283] * (-1419.323) (-1420.726) [-1423.333] (-1421.562) -- 0:00:50 242000 -- (-1422.508) (-1419.948) (-1426.940) [-1422.283] * [-1419.895] (-1422.247) (-1423.905) (-1420.664) -- 0:00:50 242500 -- [-1420.779] (-1420.056) (-1422.982) (-1423.925) * (-1419.311) (-1421.029) (-1422.553) [-1421.476] -- 0:00:49 243000 -- [-1420.121] (-1420.687) (-1422.793) (-1423.976) * [-1419.357] (-1424.896) (-1421.040) (-1423.340) -- 0:00:49 243500 -- [-1420.778] (-1419.209) (-1421.696) (-1423.738) * (-1419.385) (-1423.046) (-1424.281) [-1419.888] -- 0:00:49 244000 -- [-1420.737] (-1421.789) (-1421.657) (-1423.458) * (-1419.957) [-1422.893] (-1420.999) (-1421.123) -- 0:00:49 244500 -- (-1421.251) (-1424.225) (-1422.211) [-1421.825] * (-1420.827) (-1423.597) (-1423.543) [-1421.758] -- 0:00:49 245000 -- [-1421.157] (-1422.746) (-1422.086) (-1422.729) * (-1420.403) (-1422.998) (-1421.716) [-1420.842] -- 0:00:49 Average standard deviation of split frequencies: 0.011711 245500 -- [-1421.016] (-1420.667) (-1422.539) (-1423.476) * [-1420.882] (-1427.607) (-1420.845) (-1425.703) -- 0:00:49 246000 -- [-1421.180] (-1423.914) (-1420.802) (-1420.535) * [-1420.776] (-1423.605) (-1424.861) (-1425.104) -- 0:00:49 246500 -- (-1422.110) (-1425.048) (-1421.479) [-1421.945] * (-1419.957) (-1425.009) [-1420.673] (-1427.740) -- 0:00:48 247000 -- (-1422.530) [-1421.007] (-1420.917) (-1422.867) * (-1423.648) [-1422.729] (-1420.676) (-1424.969) -- 0:00:48 247500 -- (-1423.273) (-1425.569) [-1420.295] (-1425.696) * (-1422.156) [-1423.911] (-1419.703) (-1423.945) -- 0:00:48 248000 -- (-1422.955) (-1423.228) [-1422.165] (-1423.185) * [-1419.768] (-1423.520) (-1421.442) (-1420.606) -- 0:00:48 248500 -- (-1420.247) (-1421.425) (-1421.509) [-1421.262] * (-1421.843) [-1420.538] (-1419.319) (-1421.233) -- 0:00:48 249000 -- (-1420.475) (-1425.931) [-1420.439] (-1422.469) * [-1422.238] (-1422.081) (-1422.683) (-1423.693) -- 0:00:48 249500 -- (-1419.745) (-1422.977) [-1421.312] (-1422.029) * [-1422.052] (-1422.074) (-1421.318) (-1424.117) -- 0:00:48 250000 -- (-1425.879) (-1429.141) (-1421.477) [-1423.849] * (-1426.711) (-1421.614) (-1424.345) [-1420.743] -- 0:00:48 Average standard deviation of split frequencies: 0.010343 250500 -- (-1424.207) [-1423.797] (-1421.144) (-1422.384) * (-1421.652) (-1423.313) (-1423.546) [-1420.982] -- 0:00:47 251000 -- (-1424.140) (-1420.908) [-1421.158] (-1423.321) * (-1420.203) [-1423.550] (-1419.941) (-1420.838) -- 0:00:47 251500 -- (-1419.244) [-1421.552] (-1422.574) (-1422.008) * [-1421.069] (-1423.225) (-1420.013) (-1422.662) -- 0:00:47 252000 -- (-1423.127) (-1422.052) [-1420.803] (-1422.097) * (-1424.208) [-1425.298] (-1422.926) (-1421.469) -- 0:00:47 252500 -- [-1419.684] (-1422.066) (-1421.948) (-1421.867) * (-1420.827) [-1420.925] (-1424.715) (-1420.727) -- 0:00:47 253000 -- (-1420.087) (-1421.173) [-1423.583] (-1420.590) * (-1421.014) (-1422.123) (-1421.502) [-1422.031] -- 0:00:47 253500 -- (-1421.767) (-1420.564) (-1423.958) [-1420.552] * (-1422.313) (-1421.525) (-1420.576) [-1420.768] -- 0:00:47 254000 -- (-1422.080) (-1421.671) [-1421.877] (-1423.998) * (-1420.142) (-1422.489) (-1420.950) [-1422.187] -- 0:00:49 254500 -- [-1419.355] (-1420.240) (-1420.379) (-1421.974) * [-1420.810] (-1419.909) (-1419.691) (-1422.286) -- 0:00:49 255000 -- [-1420.365] (-1419.555) (-1424.191) (-1421.086) * (-1420.360) (-1420.029) (-1420.416) [-1423.170] -- 0:00:49 Average standard deviation of split frequencies: 0.011049 255500 -- (-1425.041) (-1419.863) (-1422.649) [-1420.901] * (-1420.209) [-1419.690] (-1420.441) (-1421.531) -- 0:00:49 256000 -- [-1422.355] (-1419.759) (-1422.035) (-1421.016) * (-1424.710) [-1421.866] (-1424.385) (-1421.076) -- 0:00:49 256500 -- [-1423.086] (-1424.247) (-1425.906) (-1420.205) * [-1422.473] (-1421.608) (-1424.978) (-1420.852) -- 0:00:49 257000 -- (-1420.324) (-1421.919) (-1425.845) [-1420.263] * [-1422.638] (-1421.123) (-1424.363) (-1420.389) -- 0:00:49 257500 -- (-1421.906) [-1421.127] (-1424.580) (-1419.666) * (-1422.414) (-1421.260) [-1422.821] (-1420.353) -- 0:00:49 258000 -- [-1421.061] (-1422.357) (-1424.595) (-1424.118) * (-1421.074) (-1422.577) [-1420.032] (-1420.280) -- 0:00:48 258500 -- (-1422.975) (-1421.278) (-1424.475) [-1430.554] * (-1420.840) [-1422.216] (-1421.814) (-1420.798) -- 0:00:48 259000 -- (-1424.013) (-1420.544) (-1423.516) [-1423.463] * [-1421.448] (-1423.533) (-1420.800) (-1420.953) -- 0:00:48 259500 -- (-1421.967) (-1421.611) [-1425.514] (-1421.557) * (-1422.361) (-1422.517) (-1421.952) [-1420.850] -- 0:00:48 260000 -- (-1423.073) (-1421.280) [-1421.081] (-1422.385) * (-1421.539) (-1419.989) (-1422.291) [-1424.152] -- 0:00:48 Average standard deviation of split frequencies: 0.009893 260500 -- [-1420.215] (-1422.757) (-1421.851) (-1420.176) * (-1419.978) [-1421.889] (-1422.724) (-1423.169) -- 0:00:48 261000 -- (-1419.509) (-1422.893) (-1422.930) [-1420.428] * [-1420.793] (-1423.806) (-1422.327) (-1424.816) -- 0:00:48 261500 -- (-1421.047) [-1422.374] (-1423.928) (-1420.561) * [-1420.689] (-1419.579) (-1420.966) (-1426.550) -- 0:00:48 262000 -- (-1420.348) [-1423.415] (-1421.717) (-1421.931) * (-1420.720) (-1421.217) [-1421.886] (-1423.100) -- 0:00:47 262500 -- [-1419.668] (-1421.378) (-1419.367) (-1420.923) * (-1423.000) (-1422.365) [-1422.327] (-1425.241) -- 0:00:47 263000 -- [-1420.622] (-1420.090) (-1420.509) (-1420.590) * (-1420.151) (-1421.573) (-1422.038) [-1423.912] -- 0:00:47 263500 -- (-1420.629) [-1423.457] (-1422.359) (-1420.658) * (-1421.053) (-1420.643) [-1422.416] (-1423.611) -- 0:00:47 264000 -- (-1421.699) (-1423.685) [-1423.063] (-1420.270) * (-1422.155) (-1422.211) (-1422.016) [-1423.241] -- 0:00:47 264500 -- [-1421.183] (-1421.445) (-1421.878) (-1420.951) * (-1420.802) [-1422.001] (-1421.257) (-1422.388) -- 0:00:47 265000 -- [-1421.220] (-1425.998) (-1421.025) (-1421.879) * (-1420.985) [-1421.901] (-1424.231) (-1422.084) -- 0:00:47 Average standard deviation of split frequencies: 0.009058 265500 -- [-1419.732] (-1422.667) (-1421.009) (-1422.363) * (-1421.911) (-1421.026) [-1420.970] (-1423.853) -- 0:00:47 266000 -- [-1419.674] (-1421.618) (-1419.815) (-1422.404) * (-1420.445) (-1420.085) [-1421.376] (-1422.062) -- 0:00:46 266500 -- (-1420.495) (-1420.306) [-1420.553] (-1421.919) * (-1421.105) (-1419.871) [-1421.449] (-1422.219) -- 0:00:46 267000 -- (-1422.623) (-1419.911) (-1421.294) [-1419.780] * (-1422.227) (-1419.327) [-1421.888] (-1423.131) -- 0:00:46 267500 -- (-1428.687) (-1420.999) (-1422.956) [-1419.355] * (-1422.657) [-1420.007] (-1425.084) (-1422.756) -- 0:00:46 268000 -- (-1420.170) (-1420.428) [-1423.293] (-1422.972) * (-1425.411) [-1420.108] (-1423.697) (-1420.731) -- 0:00:46 268500 -- (-1420.908) (-1420.997) [-1421.601] (-1422.217) * (-1421.798) [-1420.439] (-1433.972) (-1420.343) -- 0:00:46 269000 -- (-1420.856) (-1420.450) (-1420.916) [-1421.320] * (-1420.888) [-1419.845] (-1421.276) (-1423.310) -- 0:00:46 269500 -- (-1422.056) (-1420.565) [-1419.544] (-1421.662) * (-1421.320) [-1422.523] (-1422.279) (-1422.581) -- 0:00:46 270000 -- [-1422.998] (-1424.612) (-1419.479) (-1421.422) * [-1423.509] (-1421.683) (-1422.413) (-1422.278) -- 0:00:48 Average standard deviation of split frequencies: 0.009630 270500 -- (-1422.709) (-1425.220) [-1419.474] (-1421.026) * (-1421.055) [-1420.474] (-1421.470) (-1422.539) -- 0:00:48 271000 -- (-1425.139) (-1423.030) [-1420.192] (-1420.203) * (-1420.663) (-1423.183) [-1421.298] (-1420.627) -- 0:00:48 271500 -- (-1424.696) [-1421.715] (-1420.573) (-1423.576) * [-1421.244] (-1423.801) (-1421.787) (-1426.398) -- 0:00:48 272000 -- (-1421.573) (-1420.529) [-1421.189] (-1421.167) * (-1421.302) (-1423.201) (-1423.695) [-1420.693] -- 0:00:48 272500 -- (-1420.973) [-1421.149] (-1420.090) (-1424.748) * (-1421.245) (-1422.492) [-1419.346] (-1420.766) -- 0:00:48 273000 -- [-1422.904] (-1421.320) (-1421.449) (-1423.959) * (-1421.188) [-1422.567] (-1421.720) (-1419.282) -- 0:00:47 273500 -- [-1424.136] (-1422.674) (-1423.844) (-1423.492) * (-1421.547) [-1420.195] (-1420.590) (-1421.701) -- 0:00:47 274000 -- [-1423.109] (-1424.749) (-1419.663) (-1422.244) * [-1420.126] (-1421.549) (-1423.422) (-1420.758) -- 0:00:47 274500 -- (-1422.978) (-1420.911) [-1420.087] (-1420.801) * (-1423.901) [-1421.444] (-1428.344) (-1420.500) -- 0:00:47 275000 -- (-1422.453) (-1422.089) (-1424.409) [-1422.689] * (-1426.097) (-1422.426) [-1420.983] (-1428.631) -- 0:00:47 Average standard deviation of split frequencies: 0.009489 275500 -- [-1421.644] (-1421.476) (-1425.385) (-1419.978) * (-1423.065) (-1426.270) (-1420.022) [-1422.539] -- 0:00:47 276000 -- (-1422.886) [-1421.392] (-1423.248) (-1426.353) * (-1422.654) (-1422.267) [-1420.463] (-1420.861) -- 0:00:47 276500 -- (-1423.762) (-1421.978) [-1420.812] (-1423.068) * (-1424.241) (-1423.827) [-1419.882] (-1419.964) -- 0:00:47 277000 -- (-1423.737) [-1422.458] (-1420.874) (-1426.657) * (-1423.091) (-1424.711) [-1422.744] (-1421.010) -- 0:00:46 277500 -- (-1422.541) (-1421.563) (-1420.096) [-1423.014] * (-1422.111) (-1424.070) [-1420.377] (-1421.362) -- 0:00:46 278000 -- (-1426.882) [-1420.881] (-1419.757) (-1420.057) * [-1423.968] (-1426.346) (-1420.641) (-1424.492) -- 0:00:46 278500 -- (-1425.786) (-1422.937) [-1420.239] (-1421.292) * (-1421.990) (-1425.142) [-1421.136] (-1422.261) -- 0:00:46 279000 -- (-1424.497) (-1423.303) (-1420.839) [-1425.725] * (-1421.108) (-1423.362) (-1419.647) [-1420.307] -- 0:00:46 279500 -- (-1428.615) (-1423.569) [-1419.564] (-1427.376) * (-1420.277) (-1427.967) (-1420.932) [-1420.823] -- 0:00:46 280000 -- [-1422.798] (-1421.466) (-1421.599) (-1425.631) * (-1423.279) (-1425.235) [-1422.396] (-1421.212) -- 0:00:46 Average standard deviation of split frequencies: 0.008958 280500 -- (-1421.382) [-1422.623] (-1420.752) (-1423.416) * (-1420.642) (-1425.493) (-1422.304) [-1420.456] -- 0:00:46 281000 -- (-1421.947) [-1423.282] (-1420.263) (-1423.503) * (-1420.246) (-1422.387) (-1421.731) [-1420.770] -- 0:00:46 281500 -- [-1421.778] (-1424.786) (-1419.619) (-1420.852) * (-1422.199) [-1422.387] (-1420.495) (-1422.087) -- 0:00:45 282000 -- (-1421.870) (-1422.856) (-1421.887) [-1420.449] * (-1422.270) [-1421.486] (-1420.286) (-1420.713) -- 0:00:45 282500 -- (-1419.876) (-1422.223) (-1425.276) [-1420.429] * [-1421.407] (-1422.735) (-1420.208) (-1420.382) -- 0:00:45 283000 -- [-1420.368] (-1422.369) (-1424.062) (-1420.100) * (-1423.542) [-1420.676] (-1421.294) (-1423.647) -- 0:00:45 283500 -- [-1421.029] (-1422.229) (-1421.415) (-1423.356) * (-1420.637) (-1420.436) (-1421.012) [-1420.148] -- 0:00:45 284000 -- [-1420.344] (-1422.522) (-1420.962) (-1422.009) * (-1420.905) (-1420.250) [-1420.697] (-1420.770) -- 0:00:45 284500 -- [-1422.453] (-1422.140) (-1420.667) (-1420.291) * (-1422.036) (-1421.028) [-1420.364] (-1420.772) -- 0:00:45 285000 -- (-1422.378) [-1421.182] (-1420.390) (-1421.404) * (-1425.606) [-1419.208] (-1423.726) (-1420.900) -- 0:00:45 Average standard deviation of split frequencies: 0.008333 285500 -- (-1423.659) [-1424.341] (-1421.922) (-1421.288) * (-1421.007) (-1421.016) [-1423.668] (-1428.235) -- 0:00:45 286000 -- (-1423.584) [-1425.276] (-1422.625) (-1421.288) * (-1422.036) [-1423.913] (-1421.192) (-1424.115) -- 0:00:47 286500 -- [-1421.642] (-1427.246) (-1425.839) (-1421.052) * [-1421.332] (-1425.663) (-1423.205) (-1427.590) -- 0:00:47 287000 -- [-1421.651] (-1421.744) (-1424.634) (-1421.486) * [-1420.903] (-1422.907) (-1422.042) (-1422.283) -- 0:00:47 287500 -- (-1419.811) (-1420.955) [-1424.542] (-1421.519) * (-1423.369) (-1423.606) (-1422.149) [-1423.200] -- 0:00:47 288000 -- (-1420.023) (-1420.385) [-1421.060] (-1421.772) * (-1426.228) [-1420.178] (-1420.637) (-1424.581) -- 0:00:46 288500 -- (-1423.875) (-1425.426) [-1420.314] (-1420.863) * (-1423.172) (-1421.582) [-1423.739] (-1425.756) -- 0:00:46 289000 -- (-1422.375) [-1424.201] (-1420.422) (-1420.698) * (-1424.507) (-1422.233) [-1423.174] (-1423.625) -- 0:00:46 289500 -- (-1421.295) (-1423.989) (-1420.565) [-1422.379] * (-1423.662) [-1422.553] (-1419.762) (-1426.925) -- 0:00:46 290000 -- [-1421.208] (-1424.203) (-1421.692) (-1423.690) * (-1423.165) (-1422.935) [-1421.213] (-1422.820) -- 0:00:46 Average standard deviation of split frequencies: 0.008740 290500 -- (-1419.341) [-1420.960] (-1420.898) (-1429.347) * [-1422.167] (-1421.912) (-1423.444) (-1421.558) -- 0:00:46 291000 -- [-1419.341] (-1421.542) (-1420.073) (-1424.253) * (-1420.747) (-1422.062) [-1422.621] (-1423.341) -- 0:00:46 291500 -- (-1420.332) [-1420.531] (-1420.543) (-1421.129) * (-1420.293) (-1421.703) [-1422.519] (-1422.840) -- 0:00:46 292000 -- (-1423.490) (-1421.566) (-1420.901) [-1421.146] * (-1422.311) (-1422.075) [-1427.795] (-1421.594) -- 0:00:46 292500 -- (-1420.488) (-1419.946) (-1420.422) [-1419.655] * (-1419.704) (-1426.894) [-1423.798] (-1423.669) -- 0:00:45 293000 -- (-1420.996) (-1422.925) (-1422.072) [-1421.832] * (-1419.954) [-1420.249] (-1423.819) (-1422.224) -- 0:00:45 293500 -- [-1421.729] (-1420.540) (-1420.997) (-1419.275) * [-1419.130] (-1421.528) (-1424.256) (-1424.986) -- 0:00:45 294000 -- (-1420.547) (-1426.497) [-1423.107] (-1420.267) * [-1422.035] (-1421.922) (-1423.514) (-1423.012) -- 0:00:45 294500 -- (-1420.396) (-1421.576) [-1421.669] (-1419.600) * (-1422.039) [-1421.026] (-1421.622) (-1424.895) -- 0:00:45 295000 -- [-1421.405] (-1420.295) (-1419.583) (-1423.074) * (-1420.141) (-1422.668) (-1421.680) [-1419.961] -- 0:00:45 Average standard deviation of split frequencies: 0.009467 295500 -- [-1422.970] (-1419.989) (-1421.656) (-1422.424) * (-1419.463) (-1424.329) [-1422.224] (-1419.162) -- 0:00:45 296000 -- [-1422.790] (-1420.821) (-1420.551) (-1422.581) * [-1419.410] (-1422.485) (-1423.586) (-1419.159) -- 0:00:45 296500 -- (-1420.573) (-1422.032) (-1420.164) [-1421.267] * (-1419.285) (-1422.478) (-1419.483) [-1419.824] -- 0:00:45 297000 -- (-1420.550) (-1421.043) [-1421.349] (-1420.037) * (-1421.400) [-1423.379] (-1421.930) (-1421.279) -- 0:00:44 297500 -- [-1421.487] (-1420.793) (-1421.311) (-1420.612) * (-1420.762) (-1422.427) (-1422.886) [-1421.684] -- 0:00:44 298000 -- [-1421.865] (-1421.946) (-1422.963) (-1421.052) * (-1422.934) [-1420.564] (-1420.328) (-1420.438) -- 0:00:44 298500 -- (-1421.274) (-1419.757) [-1420.219] (-1421.284) * (-1421.359) (-1424.446) [-1419.294] (-1421.817) -- 0:00:44 299000 -- (-1421.274) [-1420.871] (-1421.766) (-1425.709) * (-1422.692) (-1420.378) (-1419.341) [-1422.309] -- 0:00:44 299500 -- (-1422.695) [-1419.490] (-1428.302) (-1425.741) * (-1424.319) [-1421.400] (-1420.118) (-1420.245) -- 0:00:44 300000 -- (-1420.231) (-1419.920) [-1419.771] (-1426.625) * [-1419.374] (-1420.311) (-1421.481) (-1420.211) -- 0:00:44 Average standard deviation of split frequencies: 0.009961 300500 -- [-1421.104] (-1420.226) (-1427.244) (-1427.209) * [-1421.946] (-1419.966) (-1421.951) (-1423.300) -- 0:00:44 301000 -- (-1419.760) (-1420.490) [-1421.287] (-1422.633) * (-1426.594) [-1419.349] (-1420.246) (-1421.545) -- 0:00:44 301500 -- (-1419.996) (-1420.219) [-1420.468] (-1420.932) * [-1421.334] (-1419.366) (-1422.445) (-1423.608) -- 0:00:44 302000 -- (-1423.639) (-1420.815) [-1420.620] (-1422.917) * (-1420.183) (-1421.856) (-1419.569) [-1422.678] -- 0:00:46 302500 -- (-1426.702) [-1421.103] (-1420.586) (-1422.162) * (-1419.986) (-1421.389) [-1423.544] (-1422.257) -- 0:00:46 303000 -- [-1420.509] (-1423.316) (-1420.776) (-1422.039) * (-1422.165) (-1422.825) [-1426.665] (-1423.004) -- 0:00:46 303500 -- (-1420.435) [-1420.650] (-1421.446) (-1422.517) * [-1419.875] (-1422.802) (-1421.397) (-1424.779) -- 0:00:45 304000 -- (-1420.484) (-1419.808) [-1420.982] (-1421.434) * [-1423.931] (-1423.438) (-1425.025) (-1420.170) -- 0:00:45 304500 -- (-1420.488) (-1423.768) [-1421.173] (-1421.471) * (-1423.217) [-1424.418] (-1422.659) (-1420.540) -- 0:00:45 305000 -- [-1421.267] (-1421.034) (-1421.248) (-1423.626) * (-1424.070) [-1419.794] (-1422.711) (-1421.676) -- 0:00:45 Average standard deviation of split frequencies: 0.010512 305500 -- [-1421.117] (-1421.980) (-1422.467) (-1422.212) * (-1422.723) (-1421.139) [-1425.854] (-1419.760) -- 0:00:45 306000 -- (-1429.631) (-1420.424) [-1425.167] (-1423.070) * (-1423.722) [-1419.492] (-1422.367) (-1421.450) -- 0:00:45 306500 -- (-1420.770) (-1420.122) (-1421.794) [-1421.133] * (-1422.370) (-1423.930) (-1423.718) [-1420.661] -- 0:00:45 307000 -- (-1419.670) [-1420.116] (-1421.920) (-1421.493) * (-1424.005) (-1422.072) (-1422.818) [-1422.133] -- 0:00:45 307500 -- [-1419.820] (-1419.344) (-1425.089) (-1420.095) * [-1424.403] (-1425.622) (-1422.587) (-1421.757) -- 0:00:45 308000 -- [-1419.723] (-1419.478) (-1423.016) (-1422.289) * (-1420.281) (-1420.030) [-1422.896] (-1420.058) -- 0:00:44 308500 -- (-1419.933) [-1419.770] (-1423.762) (-1424.437) * (-1422.402) [-1420.683] (-1424.562) (-1421.564) -- 0:00:44 309000 -- (-1419.953) (-1423.282) [-1421.641] (-1424.160) * [-1422.659] (-1422.201) (-1425.250) (-1421.890) -- 0:00:44 309500 -- [-1420.328] (-1420.584) (-1422.633) (-1422.797) * (-1420.605) [-1419.707] (-1423.057) (-1421.613) -- 0:00:44 310000 -- (-1420.737) [-1420.165] (-1421.360) (-1420.384) * (-1421.659) (-1420.647) (-1425.108) [-1422.541] -- 0:00:44 Average standard deviation of split frequencies: 0.010443 310500 -- [-1420.331] (-1419.480) (-1422.341) (-1420.155) * (-1420.801) (-1419.824) (-1421.451) [-1423.986] -- 0:00:44 311000 -- (-1420.167) (-1419.480) (-1421.533) [-1423.580] * (-1427.348) (-1424.327) (-1421.310) [-1421.799] -- 0:00:44 311500 -- (-1421.116) (-1419.268) (-1425.795) [-1423.063] * (-1424.534) (-1423.254) (-1422.387) [-1420.781] -- 0:00:44 312000 -- (-1420.854) (-1419.216) [-1421.736] (-1420.959) * (-1424.830) (-1420.699) (-1421.637) [-1421.732] -- 0:00:44 312500 -- [-1420.735] (-1423.559) (-1421.062) (-1421.042) * (-1427.852) (-1422.847) (-1421.040) [-1421.450] -- 0:00:44 313000 -- (-1419.578) (-1420.082) (-1422.687) [-1420.326] * (-1423.002) [-1423.614] (-1421.213) (-1420.924) -- 0:00:43 313500 -- (-1420.455) (-1421.182) [-1425.828] (-1420.740) * (-1420.611) [-1424.304] (-1420.762) (-1422.304) -- 0:00:43 314000 -- (-1420.129) (-1422.930) [-1426.531] (-1421.096) * (-1420.839) (-1421.275) (-1420.436) [-1423.841] -- 0:00:43 314500 -- [-1421.044] (-1420.717) (-1424.529) (-1422.048) * [-1423.981] (-1422.750) (-1421.671) (-1419.556) -- 0:00:43 315000 -- (-1425.602) (-1421.307) [-1420.835] (-1422.162) * (-1421.829) (-1422.564) (-1420.779) [-1420.816] -- 0:00:43 Average standard deviation of split frequencies: 0.010355 315500 -- [-1420.113] (-1425.034) (-1420.805) (-1421.707) * [-1420.369] (-1421.589) (-1421.782) (-1419.661) -- 0:00:43 316000 -- (-1421.179) (-1424.402) [-1420.188] (-1425.759) * (-1421.923) (-1421.926) (-1422.108) [-1420.278] -- 0:00:43 316500 -- (-1423.409) (-1424.812) [-1420.071] (-1422.461) * (-1423.492) [-1420.521] (-1422.108) (-1420.714) -- 0:00:43 317000 -- [-1420.248] (-1424.075) (-1419.913) (-1420.340) * (-1421.723) [-1422.192] (-1420.474) (-1421.129) -- 0:00:43 317500 -- [-1421.635] (-1420.346) (-1420.893) (-1420.012) * (-1421.179) (-1423.900) (-1420.292) [-1421.716] -- 0:00:42 318000 -- (-1421.892) (-1421.051) (-1421.056) [-1419.561] * (-1421.210) (-1420.470) (-1422.674) [-1420.499] -- 0:00:42 318500 -- [-1422.782] (-1422.549) (-1421.388) (-1419.936) * (-1421.137) (-1420.772) [-1421.303] (-1420.623) -- 0:00:44 319000 -- (-1423.124) (-1421.276) (-1421.237) [-1421.654] * (-1421.624) (-1421.440) (-1422.172) [-1420.611] -- 0:00:44 319500 -- (-1424.536) [-1420.415] (-1420.540) (-1426.637) * [-1423.543] (-1419.289) (-1423.337) (-1420.122) -- 0:00:44 320000 -- (-1420.369) (-1420.053) (-1420.540) [-1422.107] * (-1421.166) (-1421.183) (-1421.381) [-1420.122] -- 0:00:44 Average standard deviation of split frequencies: 0.010031 320500 -- (-1421.564) (-1421.042) (-1423.362) [-1421.240] * [-1420.910] (-1424.601) (-1423.243) (-1420.101) -- 0:00:44 321000 -- [-1420.357] (-1420.501) (-1419.716) (-1420.318) * (-1422.768) (-1420.104) [-1419.896] (-1419.969) -- 0:00:44 321500 -- (-1422.698) [-1422.394] (-1422.560) (-1419.514) * (-1419.756) (-1422.773) (-1425.090) [-1419.244] -- 0:00:44 322000 -- [-1420.303] (-1423.938) (-1423.453) (-1420.076) * (-1421.749) [-1419.877] (-1425.033) (-1429.243) -- 0:00:44 322500 -- (-1422.072) [-1421.315] (-1419.918) (-1424.516) * (-1420.478) (-1420.802) (-1420.805) [-1420.965] -- 0:00:44 323000 -- [-1421.009] (-1420.189) (-1420.125) (-1423.456) * (-1419.959) (-1421.230) [-1419.676] (-1420.734) -- 0:00:44 323500 -- (-1422.345) (-1420.019) [-1422.252] (-1421.621) * (-1422.994) [-1421.740] (-1422.086) (-1420.552) -- 0:00:43 324000 -- (-1421.402) (-1420.019) (-1422.540) [-1423.517] * (-1424.521) [-1421.291] (-1424.912) (-1420.734) -- 0:00:43 324500 -- (-1420.607) (-1421.661) [-1421.492] (-1426.439) * (-1421.421) (-1421.685) (-1423.331) [-1422.591] -- 0:00:43 325000 -- [-1420.754] (-1423.264) (-1422.109) (-1423.069) * [-1419.882] (-1421.538) (-1420.923) (-1423.127) -- 0:00:43 Average standard deviation of split frequencies: 0.010547 325500 -- (-1423.424) (-1422.722) [-1422.412] (-1420.501) * [-1423.153] (-1421.297) (-1421.440) (-1419.967) -- 0:00:43 326000 -- [-1420.609] (-1420.441) (-1420.388) (-1427.028) * (-1426.784) (-1423.144) (-1422.384) [-1422.804] -- 0:00:43 326500 -- (-1420.211) (-1420.545) (-1428.233) [-1421.764] * (-1423.860) [-1420.991] (-1430.592) (-1420.109) -- 0:00:43 327000 -- [-1420.347] (-1422.909) (-1422.687) (-1423.082) * (-1421.571) [-1422.040] (-1429.437) (-1420.920) -- 0:00:43 327500 -- (-1421.797) (-1423.902) (-1425.671) [-1421.874] * [-1420.993] (-1421.805) (-1425.052) (-1419.997) -- 0:00:43 328000 -- (-1421.287) [-1421.452] (-1420.056) (-1421.908) * (-1421.181) [-1421.515] (-1421.733) (-1420.691) -- 0:00:43 328500 -- (-1427.219) (-1420.705) (-1420.126) [-1421.051] * (-1423.297) (-1420.949) (-1420.675) [-1421.039] -- 0:00:42 329000 -- (-1426.117) (-1421.441) (-1421.370) [-1422.095] * (-1427.538) (-1421.884) [-1420.339] (-1419.824) -- 0:00:42 329500 -- (-1422.139) [-1421.550] (-1421.259) (-1420.520) * (-1428.589) (-1421.404) (-1421.645) [-1420.358] -- 0:00:42 330000 -- (-1423.868) (-1421.669) [-1421.172] (-1424.704) * (-1426.987) [-1421.187] (-1422.168) (-1420.278) -- 0:00:42 Average standard deviation of split frequencies: 0.010566 330500 -- [-1423.430] (-1419.447) (-1425.803) (-1425.655) * (-1424.979) (-1425.484) [-1422.037] (-1420.416) -- 0:00:42 331000 -- (-1425.820) [-1421.259] (-1422.472) (-1420.404) * (-1420.457) [-1420.769] (-1422.109) (-1421.326) -- 0:00:42 331500 -- (-1421.883) (-1421.584) [-1422.272] (-1420.396) * [-1420.018] (-1420.408) (-1422.092) (-1421.098) -- 0:00:42 332000 -- (-1423.249) (-1422.226) (-1422.351) [-1420.619] * [-1421.737] (-1421.179) (-1424.939) (-1424.660) -- 0:00:42 332500 -- (-1424.871) [-1421.038] (-1424.877) (-1424.357) * (-1422.998) (-1422.797) (-1421.216) [-1421.465] -- 0:00:42 333000 -- (-1424.790) (-1420.753) (-1422.709) [-1424.003] * [-1421.809] (-1424.005) (-1421.723) (-1421.831) -- 0:00:42 333500 -- (-1428.223) (-1425.379) (-1419.690) [-1419.741] * (-1420.563) (-1425.167) [-1420.561] (-1424.534) -- 0:00:41 334000 -- (-1422.954) (-1420.943) (-1419.859) [-1420.172] * (-1421.873) (-1422.913) (-1420.511) [-1422.191] -- 0:00:41 334500 -- (-1421.324) (-1423.545) (-1422.182) [-1423.963] * (-1427.024) (-1423.938) [-1422.727] (-1419.757) -- 0:00:43 335000 -- (-1422.052) [-1421.737] (-1419.796) (-1421.031) * [-1420.803] (-1422.304) (-1424.337) (-1419.509) -- 0:00:43 Average standard deviation of split frequencies: 0.011224 335500 -- [-1421.343] (-1420.618) (-1420.913) (-1423.769) * (-1421.099) [-1422.330] (-1422.503) (-1420.590) -- 0:00:43 336000 -- (-1421.089) (-1419.639) (-1431.577) [-1423.988] * (-1421.156) [-1419.990] (-1424.493) (-1420.918) -- 0:00:43 336500 -- (-1421.089) [-1419.627] (-1427.114) (-1419.854) * [-1420.542] (-1422.214) (-1424.636) (-1421.778) -- 0:00:43 337000 -- (-1420.852) (-1421.945) [-1420.477] (-1423.382) * (-1421.022) [-1422.247] (-1420.682) (-1421.323) -- 0:00:43 337500 -- (-1421.807) (-1422.077) (-1420.388) [-1423.985] * [-1419.795] (-1421.024) (-1422.391) (-1420.388) -- 0:00:43 338000 -- [-1420.311] (-1421.994) (-1420.743) (-1422.112) * (-1419.229) (-1420.758) (-1421.182) [-1420.428] -- 0:00:43 338500 -- (-1422.317) [-1423.524] (-1420.069) (-1426.768) * (-1420.052) [-1420.500] (-1424.273) (-1422.034) -- 0:00:42 339000 -- (-1428.013) (-1424.797) [-1421.175] (-1427.284) * (-1421.458) [-1420.553] (-1422.260) (-1420.559) -- 0:00:42 339500 -- (-1424.995) [-1421.870] (-1425.063) (-1425.416) * (-1422.121) (-1421.012) (-1421.824) [-1422.823] -- 0:00:42 340000 -- (-1421.715) (-1423.531) (-1422.933) [-1427.470] * [-1422.509] (-1420.568) (-1422.248) (-1422.127) -- 0:00:42 Average standard deviation of split frequencies: 0.010907 340500 -- (-1420.061) [-1420.663] (-1419.727) (-1422.440) * (-1427.955) [-1420.912] (-1425.054) (-1420.198) -- 0:00:42 341000 -- (-1419.898) (-1421.494) [-1421.015] (-1421.074) * (-1421.920) [-1420.967] (-1419.326) (-1421.471) -- 0:00:42 341500 -- (-1421.877) [-1420.954] (-1421.570) (-1421.159) * (-1421.666) (-1422.230) [-1420.161] (-1420.064) -- 0:00:42 342000 -- (-1424.310) [-1420.274] (-1424.349) (-1421.211) * (-1421.337) (-1423.650) [-1421.292] (-1419.996) -- 0:00:42 342500 -- [-1421.436] (-1420.098) (-1421.406) (-1422.041) * (-1424.915) [-1420.999] (-1421.696) (-1419.899) -- 0:00:42 343000 -- (-1420.626) (-1422.188) (-1421.336) [-1420.775] * (-1429.346) [-1425.653] (-1422.358) (-1420.035) -- 0:00:42 343500 -- (-1421.371) (-1425.906) (-1421.883) [-1421.666] * (-1423.559) (-1422.211) (-1421.344) [-1421.095] -- 0:00:42 344000 -- [-1420.936] (-1423.199) (-1422.817) (-1424.716) * (-1422.038) [-1424.965] (-1422.833) (-1421.937) -- 0:00:41 344500 -- (-1421.280) (-1426.558) [-1422.425] (-1421.403) * (-1421.798) (-1422.738) [-1421.135] (-1425.009) -- 0:00:41 345000 -- (-1423.305) (-1423.536) [-1420.072] (-1419.831) * [-1421.475] (-1423.770) (-1421.204) (-1420.831) -- 0:00:41 Average standard deviation of split frequencies: 0.010218 345500 -- (-1421.767) [-1419.750] (-1420.454) (-1423.406) * (-1424.781) (-1421.042) [-1420.437] (-1420.499) -- 0:00:41 346000 -- (-1426.103) (-1419.623) [-1422.476] (-1422.446) * (-1421.436) (-1422.735) [-1419.557] (-1420.998) -- 0:00:41 346500 -- (-1425.496) (-1421.296) (-1423.989) [-1421.768] * [-1421.244] (-1422.008) (-1423.805) (-1420.435) -- 0:00:41 347000 -- [-1420.638] (-1421.850) (-1425.998) (-1421.155) * (-1419.774) (-1422.038) (-1419.752) [-1423.969] -- 0:00:41 347500 -- (-1420.540) (-1420.651) (-1424.119) [-1420.257] * (-1420.125) [-1419.937] (-1421.757) (-1424.416) -- 0:00:41 348000 -- (-1421.009) [-1421.376] (-1425.439) (-1420.017) * (-1422.842) [-1422.409] (-1422.863) (-1420.924) -- 0:00:41 348500 -- (-1421.018) (-1421.388) (-1424.666) [-1420.013] * (-1423.284) [-1420.312] (-1425.552) (-1420.379) -- 0:00:41 349000 -- (-1420.708) (-1421.087) (-1422.053) [-1420.166] * (-1422.090) [-1419.751] (-1422.445) (-1423.036) -- 0:00:41 349500 -- (-1423.614) [-1421.140] (-1420.245) (-1420.484) * (-1424.878) [-1422.071] (-1424.670) (-1422.534) -- 0:00:40 350000 -- [-1424.564] (-1420.070) (-1421.161) (-1425.585) * [-1421.054] (-1421.056) (-1424.690) (-1423.406) -- 0:00:40 Average standard deviation of split frequencies: 0.010157 350500 -- (-1427.768) (-1422.430) (-1420.108) [-1425.841] * (-1420.035) (-1421.804) (-1424.876) [-1423.396] -- 0:00:42 351000 -- (-1428.018) [-1420.400] (-1420.811) (-1423.061) * (-1420.092) (-1421.011) [-1421.850] (-1428.088) -- 0:00:42 351500 -- (-1424.076) (-1420.421) [-1422.676] (-1420.292) * (-1421.093) (-1422.789) [-1419.624] (-1423.923) -- 0:00:42 352000 -- (-1421.097) (-1421.396) (-1422.794) [-1421.061] * [-1420.910] (-1420.324) (-1421.298) (-1420.806) -- 0:00:42 352500 -- (-1420.004) (-1421.279) (-1421.773) [-1420.139] * (-1422.734) [-1420.345] (-1424.410) (-1420.463) -- 0:00:42 353000 -- (-1420.111) [-1419.852] (-1425.691) (-1419.626) * (-1425.534) (-1419.661) (-1421.440) [-1421.537] -- 0:00:42 353500 -- (-1423.452) (-1424.787) [-1422.413] (-1420.600) * [-1422.691] (-1421.316) (-1421.246) (-1423.901) -- 0:00:42 354000 -- (-1420.497) (-1421.575) (-1423.744) [-1420.290] * (-1422.629) [-1419.854] (-1420.732) (-1420.714) -- 0:00:41 354500 -- [-1423.454] (-1421.569) (-1427.036) (-1422.336) * [-1421.012] (-1420.001) (-1421.340) (-1420.906) -- 0:00:41 355000 -- (-1420.304) (-1420.391) (-1421.474) [-1422.145] * (-1420.028) (-1420.860) [-1420.437] (-1422.998) -- 0:00:41 Average standard deviation of split frequencies: 0.010005 355500 -- (-1420.866) [-1420.993] (-1421.128) (-1422.941) * (-1421.509) (-1421.867) (-1419.196) [-1421.683] -- 0:00:41 356000 -- [-1420.399] (-1421.596) (-1421.787) (-1420.057) * (-1420.933) (-1424.777) [-1419.192] (-1422.474) -- 0:00:41 356500 -- (-1421.487) (-1420.809) (-1422.952) [-1421.035] * (-1420.513) (-1423.338) [-1419.196] (-1421.976) -- 0:00:41 357000 -- (-1419.568) [-1420.611] (-1423.054) (-1420.697) * [-1421.581] (-1420.847) (-1419.504) (-1422.491) -- 0:00:41 357500 -- (-1421.284) (-1422.164) (-1422.100) [-1420.878] * (-1423.156) [-1420.647] (-1421.845) (-1421.268) -- 0:00:41 358000 -- (-1420.500) (-1420.788) (-1420.824) [-1421.285] * (-1422.809) [-1420.202] (-1422.962) (-1419.878) -- 0:00:41 358500 -- (-1421.168) (-1419.815) [-1420.963] (-1422.787) * [-1421.944] (-1421.578) (-1419.903) (-1419.979) -- 0:00:41 359000 -- (-1423.008) [-1422.466] (-1420.626) (-1420.373) * [-1422.056] (-1421.919) (-1420.315) (-1419.532) -- 0:00:41 359500 -- (-1423.287) (-1425.292) [-1421.904] (-1421.504) * [-1422.083] (-1422.232) (-1424.055) (-1419.548) -- 0:00:40 360000 -- [-1424.879] (-1425.262) (-1421.904) (-1422.043) * [-1424.508] (-1425.838) (-1423.045) (-1422.892) -- 0:00:40 Average standard deviation of split frequencies: 0.010238 360500 -- (-1424.458) (-1425.183) (-1421.408) [-1423.082] * (-1424.397) (-1420.549) (-1419.863) [-1422.420] -- 0:00:40 361000 -- (-1423.798) (-1424.353) (-1421.986) [-1423.716] * (-1424.542) (-1420.120) [-1420.443] (-1423.023) -- 0:00:40 361500 -- (-1422.356) (-1422.800) [-1421.641] (-1425.415) * (-1426.070) (-1420.817) [-1419.902] (-1426.586) -- 0:00:40 362000 -- (-1422.475) (-1423.448) [-1420.064] (-1421.384) * (-1423.058) (-1421.909) [-1419.591] (-1421.294) -- 0:00:40 362500 -- (-1421.522) (-1421.931) (-1421.688) [-1421.267] * (-1421.930) (-1420.193) [-1420.099] (-1421.684) -- 0:00:40 363000 -- (-1421.833) (-1421.956) [-1421.471] (-1423.235) * (-1420.569) [-1421.265] (-1420.792) (-1423.325) -- 0:00:40 363500 -- (-1423.072) [-1421.272] (-1425.549) (-1423.959) * [-1419.868] (-1420.700) (-1423.365) (-1420.378) -- 0:00:40 364000 -- (-1423.873) (-1421.204) (-1424.433) [-1421.577] * (-1420.570) [-1419.892] (-1420.278) (-1420.448) -- 0:00:40 364500 -- [-1420.147] (-1419.859) (-1420.618) (-1420.047) * (-1420.001) (-1423.933) [-1423.381] (-1421.731) -- 0:00:40 365000 -- [-1420.566] (-1423.056) (-1423.705) (-1423.264) * (-1419.795) (-1422.638) [-1423.607] (-1426.151) -- 0:00:40 Average standard deviation of split frequencies: 0.009517 365500 -- (-1420.178) (-1421.196) [-1421.580] (-1424.629) * (-1419.896) (-1424.148) [-1420.978] (-1422.212) -- 0:00:39 366000 -- (-1420.295) (-1419.891) [-1422.131] (-1423.080) * [-1421.061] (-1422.092) (-1422.743) (-1420.118) -- 0:00:39 366500 -- [-1422.225] (-1419.656) (-1422.050) (-1422.465) * [-1419.856] (-1423.607) (-1422.769) (-1422.365) -- 0:00:41 367000 -- (-1422.537) (-1421.229) [-1420.408] (-1423.679) * (-1420.858) (-1423.750) (-1420.797) [-1421.690] -- 0:00:41 367500 -- [-1420.991] (-1420.523) (-1421.487) (-1423.971) * [-1419.543] (-1425.979) (-1424.836) (-1420.837) -- 0:00:41 368000 -- (-1424.819) [-1419.200] (-1421.310) (-1423.812) * [-1420.311] (-1422.594) (-1424.844) (-1422.579) -- 0:00:41 368500 -- (-1420.919) [-1419.198] (-1421.369) (-1420.306) * (-1420.682) (-1423.045) (-1423.158) [-1422.570] -- 0:00:41 369000 -- (-1419.949) [-1419.807] (-1421.495) (-1422.442) * (-1419.725) (-1421.463) [-1421.054] (-1423.808) -- 0:00:41 369500 -- (-1420.195) (-1419.231) [-1424.690] (-1422.541) * [-1419.737] (-1422.147) (-1420.980) (-1427.184) -- 0:00:40 370000 -- (-1420.257) [-1422.671] (-1420.357) (-1421.596) * (-1419.843) (-1421.630) [-1420.207] (-1421.433) -- 0:00:40 Average standard deviation of split frequencies: 0.009044 370500 -- (-1420.996) (-1421.078) (-1420.002) [-1424.528] * (-1419.262) (-1421.617) (-1421.044) [-1421.105] -- 0:00:40 371000 -- (-1420.684) (-1421.119) [-1419.512] (-1420.523) * (-1422.949) (-1423.070) (-1420.499) [-1424.105] -- 0:00:40 371500 -- (-1421.300) [-1419.881] (-1420.299) (-1430.654) * [-1421.858] (-1421.529) (-1423.958) (-1422.090) -- 0:00:40 372000 -- (-1421.906) [-1424.036] (-1421.916) (-1422.683) * [-1419.886] (-1420.064) (-1421.169) (-1424.563) -- 0:00:40 372500 -- [-1422.780] (-1424.774) (-1421.441) (-1419.785) * [-1419.904] (-1420.504) (-1421.039) (-1421.997) -- 0:00:40 373000 -- [-1422.868] (-1421.440) (-1419.909) (-1421.734) * [-1423.517] (-1421.550) (-1421.115) (-1420.868) -- 0:00:40 373500 -- (-1422.935) [-1420.013] (-1420.668) (-1419.519) * [-1420.533] (-1425.061) (-1424.837) (-1420.653) -- 0:00:40 374000 -- (-1421.583) (-1422.179) [-1421.228] (-1420.903) * (-1425.218) (-1422.593) (-1420.631) [-1420.754] -- 0:00:40 374500 -- (-1422.267) (-1423.697) [-1419.872] (-1421.853) * (-1421.846) (-1421.308) (-1421.906) [-1423.056] -- 0:00:40 375000 -- (-1426.100) (-1420.201) [-1421.896] (-1421.406) * [-1421.992] (-1421.625) (-1421.047) (-1420.692) -- 0:00:40 Average standard deviation of split frequencies: 0.009682 375500 -- [-1420.343] (-1422.407) (-1422.262) (-1420.569) * (-1423.032) (-1421.444) (-1421.146) [-1421.060] -- 0:00:39 376000 -- (-1420.823) (-1419.495) [-1421.952] (-1420.575) * (-1420.802) (-1420.967) [-1420.333] (-1421.370) -- 0:00:39 376500 -- (-1420.863) [-1420.827] (-1420.005) (-1422.177) * (-1423.651) (-1420.854) [-1424.532] (-1419.503) -- 0:00:39 377000 -- (-1423.432) (-1422.041) [-1422.008] (-1420.032) * [-1419.729] (-1420.141) (-1421.698) (-1420.149) -- 0:00:39 377500 -- (-1422.527) [-1420.917] (-1424.646) (-1420.620) * (-1421.737) (-1420.035) (-1423.772) [-1419.803] -- 0:00:39 378000 -- (-1424.992) (-1420.420) (-1420.577) [-1419.959] * [-1422.640] (-1420.623) (-1423.532) (-1419.854) -- 0:00:39 378500 -- (-1425.861) [-1419.617] (-1422.240) (-1420.918) * [-1422.234] (-1419.933) (-1423.120) (-1421.937) -- 0:00:39 379000 -- [-1422.034] (-1420.772) (-1422.971) (-1423.063) * (-1421.216) (-1421.594) (-1423.312) [-1421.031] -- 0:00:39 379500 -- (-1419.565) [-1420.561] (-1420.236) (-1421.818) * (-1420.540) [-1419.679] (-1425.991) (-1423.186) -- 0:00:39 380000 -- (-1420.208) (-1420.308) (-1420.939) [-1420.584] * [-1420.473] (-1421.168) (-1424.182) (-1423.755) -- 0:00:39 Average standard deviation of split frequencies: 0.010125 380500 -- (-1423.330) (-1423.864) (-1423.064) [-1422.361] * [-1420.284] (-1422.700) (-1426.912) (-1420.045) -- 0:00:39 381000 -- (-1423.028) [-1422.567] (-1421.450) (-1421.941) * (-1420.909) [-1422.448] (-1420.853) (-1422.842) -- 0:00:38 381500 -- (-1423.655) (-1422.469) (-1421.324) [-1421.532] * (-1421.415) [-1421.432] (-1424.013) (-1421.837) -- 0:00:38 382000 -- (-1420.177) [-1421.562] (-1420.361) (-1419.845) * (-1420.681) (-1422.088) [-1420.596] (-1421.990) -- 0:00:38 382500 -- (-1419.679) (-1422.250) [-1422.709] (-1421.268) * (-1420.680) (-1423.187) [-1420.945] (-1419.517) -- 0:00:40 383000 -- (-1420.271) (-1420.430) (-1423.436) [-1420.704] * (-1420.292) [-1420.792] (-1425.209) (-1423.181) -- 0:00:40 383500 -- (-1420.416) [-1421.556] (-1426.951) (-1423.538) * (-1420.205) (-1421.053) (-1422.814) [-1422.574] -- 0:00:40 384000 -- [-1420.118] (-1421.645) (-1423.216) (-1422.946) * [-1424.876] (-1419.653) (-1422.255) (-1421.230) -- 0:00:40 384500 -- [-1423.104] (-1423.613) (-1424.065) (-1423.711) * [-1421.503] (-1419.553) (-1423.826) (-1423.442) -- 0:00:40 385000 -- (-1421.290) (-1423.041) [-1420.962] (-1424.959) * [-1420.763] (-1419.759) (-1421.312) (-1422.094) -- 0:00:39 Average standard deviation of split frequencies: 0.009577 385500 -- (-1419.586) (-1422.799) (-1420.629) [-1422.288] * (-1422.713) [-1419.836] (-1422.669) (-1422.376) -- 0:00:39 386000 -- (-1420.674) [-1422.945] (-1422.198) (-1427.171) * (-1422.622) [-1421.334] (-1421.460) (-1421.183) -- 0:00:39 386500 -- (-1420.172) [-1421.298] (-1421.494) (-1423.936) * (-1420.133) (-1419.896) (-1422.235) [-1421.622] -- 0:00:39 387000 -- (-1419.994) (-1419.931) (-1423.754) [-1420.974] * (-1420.246) [-1419.903] (-1420.816) (-1421.830) -- 0:00:39 387500 -- [-1420.513] (-1422.786) (-1422.166) (-1419.831) * (-1420.601) (-1424.208) [-1421.576] (-1423.687) -- 0:00:39 388000 -- (-1423.309) [-1421.653] (-1423.660) (-1423.799) * [-1420.415] (-1420.298) (-1423.309) (-1424.279) -- 0:00:39 388500 -- (-1422.460) (-1422.758) (-1420.711) [-1420.794] * [-1419.795] (-1422.962) (-1421.447) (-1426.228) -- 0:00:39 389000 -- (-1420.994) (-1421.466) (-1423.580) [-1420.323] * [-1420.271] (-1422.933) (-1421.693) (-1422.109) -- 0:00:39 389500 -- (-1419.618) [-1421.144] (-1421.720) (-1422.902) * (-1420.191) (-1430.916) (-1422.301) [-1420.565] -- 0:00:39 390000 -- (-1420.854) (-1421.429) [-1422.418] (-1420.039) * (-1420.575) (-1420.383) (-1421.747) [-1424.725] -- 0:00:39 Average standard deviation of split frequencies: 0.009463 390500 -- (-1420.606) (-1422.551) (-1421.125) [-1420.816] * (-1420.918) (-1419.906) (-1421.435) [-1419.576] -- 0:00:39 391000 -- (-1419.652) (-1422.400) [-1421.532] (-1419.893) * (-1419.914) [-1420.438] (-1424.313) (-1419.444) -- 0:00:38 391500 -- (-1420.068) (-1420.289) [-1421.474] (-1420.562) * (-1420.859) [-1423.184] (-1423.394) (-1421.485) -- 0:00:38 392000 -- [-1422.374] (-1420.908) (-1421.196) (-1422.974) * (-1422.800) (-1419.881) (-1420.935) [-1419.847] -- 0:00:38 392500 -- (-1421.192) [-1421.683] (-1420.712) (-1425.124) * (-1424.336) (-1421.724) [-1420.934] (-1421.849) -- 0:00:38 393000 -- (-1420.256) (-1422.466) [-1424.524] (-1422.829) * (-1423.021) [-1422.253] (-1420.837) (-1420.090) -- 0:00:38 393500 -- (-1420.393) (-1424.346) (-1423.078) [-1422.218] * (-1425.146) (-1420.711) [-1420.079] (-1419.974) -- 0:00:38 394000 -- (-1419.869) [-1421.456] (-1422.595) (-1422.548) * (-1422.048) (-1420.571) (-1422.649) [-1420.951] -- 0:00:38 394500 -- (-1419.880) (-1422.240) [-1423.313] (-1422.594) * (-1421.849) [-1420.405] (-1421.182) (-1421.764) -- 0:00:38 395000 -- (-1419.868) (-1422.523) (-1421.343) [-1422.166] * (-1421.868) (-1419.332) (-1422.580) [-1424.421] -- 0:00:38 Average standard deviation of split frequencies: 0.008399 395500 -- [-1420.176] (-1420.697) (-1421.125) (-1421.862) * (-1420.153) [-1420.094] (-1424.849) (-1425.089) -- 0:00:38 396000 -- (-1420.134) (-1422.481) (-1426.215) [-1424.231] * (-1421.106) (-1426.731) [-1422.601] (-1423.627) -- 0:00:38 396500 -- [-1419.905] (-1421.635) (-1424.865) (-1422.401) * [-1419.841] (-1423.950) (-1421.977) (-1425.245) -- 0:00:38 397000 -- (-1422.406) [-1422.479] (-1421.148) (-1427.090) * [-1424.144] (-1422.068) (-1422.973) (-1420.635) -- 0:00:37 397500 -- (-1419.964) [-1421.961] (-1421.577) (-1423.863) * [-1419.882] (-1422.226) (-1421.076) (-1423.706) -- 0:00:37 398000 -- [-1420.768] (-1422.936) (-1421.659) (-1421.666) * (-1421.387) [-1422.208] (-1424.464) (-1424.006) -- 0:00:37 398500 -- (-1421.865) (-1423.989) (-1420.348) [-1422.738] * (-1423.143) [-1422.358] (-1421.932) (-1420.302) -- 0:00:37 399000 -- [-1422.037] (-1422.838) (-1420.455) (-1425.144) * (-1420.282) [-1423.872] (-1427.213) (-1420.622) -- 0:00:39 399500 -- (-1422.791) (-1422.738) [-1420.018] (-1421.586) * (-1423.019) (-1422.363) [-1424.494] (-1420.341) -- 0:00:39 400000 -- [-1420.725] (-1421.129) (-1420.035) (-1425.772) * [-1424.707] (-1421.674) (-1425.318) (-1422.755) -- 0:00:39 Average standard deviation of split frequencies: 0.008889 400500 -- (-1420.371) (-1421.174) (-1422.368) [-1420.951] * [-1421.758] (-1420.872) (-1424.584) (-1421.772) -- 0:00:38 401000 -- (-1420.669) [-1421.651] (-1419.879) (-1421.464) * [-1421.271] (-1425.028) (-1420.298) (-1423.011) -- 0:00:38 401500 -- (-1421.218) (-1420.648) [-1419.743] (-1421.295) * [-1424.116] (-1422.049) (-1421.260) (-1419.698) -- 0:00:38 402000 -- (-1419.717) (-1420.535) [-1422.902] (-1424.138) * (-1424.343) (-1423.039) [-1419.807] (-1421.133) -- 0:00:38 402500 -- (-1421.750) (-1421.901) (-1423.362) [-1422.560] * [-1425.219] (-1426.534) (-1420.549) (-1423.442) -- 0:00:38 403000 -- (-1421.663) (-1420.556) [-1421.189] (-1421.751) * (-1422.827) (-1426.792) [-1424.118] (-1422.739) -- 0:00:38 403500 -- (-1423.077) (-1421.310) [-1421.642] (-1421.614) * [-1422.380] (-1422.821) (-1424.570) (-1421.287) -- 0:00:38 404000 -- (-1421.422) [-1421.310] (-1420.957) (-1424.057) * (-1420.160) (-1421.337) [-1421.871] (-1421.153) -- 0:00:38 404500 -- (-1427.373) [-1420.022] (-1420.211) (-1421.900) * (-1426.466) (-1424.552) [-1421.805] (-1420.108) -- 0:00:38 405000 -- (-1421.476) [-1419.473] (-1419.722) (-1421.829) * [-1424.898] (-1423.046) (-1423.228) (-1420.324) -- 0:00:38 Average standard deviation of split frequencies: 0.008861 405500 -- (-1422.150) (-1419.621) (-1422.276) [-1419.557] * (-1422.794) (-1423.537) [-1422.393] (-1421.717) -- 0:00:38 406000 -- (-1422.756) (-1419.987) (-1422.559) [-1419.598] * [-1420.888] (-1424.352) (-1424.744) (-1423.873) -- 0:00:38 406500 -- (-1421.134) (-1419.986) (-1420.341) [-1420.036] * (-1420.810) (-1421.913) (-1422.344) [-1423.186] -- 0:00:37 407000 -- (-1422.683) [-1419.824] (-1420.726) (-1419.797) * (-1421.520) [-1420.246] (-1422.499) (-1425.679) -- 0:00:37 407500 -- [-1420.304] (-1421.344) (-1419.214) (-1420.454) * (-1427.592) (-1423.207) (-1421.930) [-1422.900] -- 0:00:37 408000 -- [-1420.274] (-1422.970) (-1423.601) (-1422.018) * [-1419.526] (-1421.325) (-1421.659) (-1421.983) -- 0:00:37 408500 -- [-1420.156] (-1424.503) (-1422.604) (-1420.240) * (-1420.338) (-1420.148) [-1421.493] (-1420.542) -- 0:00:37 409000 -- [-1419.721] (-1419.510) (-1422.263) (-1420.067) * (-1419.922) [-1423.118] (-1422.870) (-1421.423) -- 0:00:37 409500 -- [-1420.742] (-1422.070) (-1425.352) (-1419.528) * (-1419.696) (-1424.433) (-1420.590) [-1423.256] -- 0:00:37 410000 -- (-1421.800) (-1420.227) (-1422.158) [-1419.544] * (-1421.772) (-1422.534) (-1422.884) [-1423.445] -- 0:00:37 Average standard deviation of split frequencies: 0.008227 410500 -- (-1424.370) (-1420.788) [-1423.142] (-1424.337) * (-1422.135) (-1419.636) (-1420.457) [-1422.185] -- 0:00:37 411000 -- (-1419.999) (-1421.263) [-1422.377] (-1423.943) * [-1420.243] (-1420.346) (-1420.265) (-1420.099) -- 0:00:37 411500 -- (-1424.788) (-1423.510) [-1422.209] (-1422.677) * (-1420.543) [-1420.459] (-1420.376) (-1419.571) -- 0:00:37 412000 -- (-1421.327) [-1420.960] (-1422.182) (-1423.791) * (-1422.149) (-1420.273) [-1420.475] (-1422.412) -- 0:00:37 412500 -- (-1420.843) [-1420.453] (-1421.053) (-1424.861) * (-1423.013) [-1423.906] (-1420.476) (-1421.830) -- 0:00:37 413000 -- (-1425.294) [-1421.077] (-1420.271) (-1424.344) * (-1421.052) (-1421.515) (-1421.506) [-1421.150] -- 0:00:36 413500 -- (-1419.674) (-1421.426) (-1419.575) [-1420.760] * (-1420.892) [-1420.966] (-1424.002) (-1423.560) -- 0:00:36 414000 -- (-1419.982) [-1421.679] (-1423.328) (-1423.960) * (-1420.670) (-1420.477) (-1423.022) [-1421.381] -- 0:00:36 414500 -- (-1419.949) [-1420.051] (-1420.008) (-1421.243) * [-1422.245] (-1419.940) (-1421.797) (-1421.639) -- 0:00:36 415000 -- [-1420.217] (-1423.415) (-1421.175) (-1421.231) * (-1421.584) (-1421.289) (-1422.184) [-1420.028] -- 0:00:38 Average standard deviation of split frequencies: 0.008688 415500 -- (-1420.291) [-1419.908] (-1422.760) (-1421.982) * (-1422.465) [-1419.727] (-1422.487) (-1424.299) -- 0:00:37 416000 -- [-1423.053] (-1424.738) (-1420.759) (-1421.251) * (-1421.421) (-1423.596) [-1422.136] (-1422.494) -- 0:00:37 416500 -- (-1423.503) [-1419.258] (-1421.668) (-1420.324) * (-1421.885) (-1424.216) (-1423.676) [-1420.468] -- 0:00:37 417000 -- (-1424.889) (-1419.258) [-1421.071] (-1421.254) * [-1420.613] (-1422.202) (-1422.133) (-1423.470) -- 0:00:37 417500 -- (-1422.404) [-1420.430] (-1419.879) (-1420.880) * [-1422.423] (-1423.068) (-1421.511) (-1420.379) -- 0:00:37 418000 -- (-1421.251) (-1420.757) [-1420.309] (-1419.650) * [-1421.078] (-1421.601) (-1422.852) (-1423.446) -- 0:00:37 418500 -- (-1421.115) (-1419.672) (-1420.462) [-1419.510] * (-1421.607) (-1423.032) [-1420.699] (-1423.527) -- 0:00:37 419000 -- (-1422.493) (-1428.984) [-1421.561] (-1419.490) * [-1421.061] (-1420.060) (-1421.117) (-1422.989) -- 0:00:37 419500 -- [-1423.778] (-1423.872) (-1419.531) (-1419.976) * (-1419.750) [-1422.195] (-1421.667) (-1421.215) -- 0:00:37 420000 -- (-1423.431) [-1424.947] (-1422.577) (-1425.930) * (-1419.499) (-1422.708) (-1421.551) [-1420.874] -- 0:00:37 Average standard deviation of split frequencies: 0.008825 420500 -- (-1420.881) (-1428.634) [-1424.521] (-1420.513) * (-1420.345) [-1423.680] (-1420.329) (-1420.457) -- 0:00:37 421000 -- (-1421.604) [-1420.520] (-1424.962) (-1420.359) * (-1421.278) (-1419.633) [-1420.055] (-1420.255) -- 0:00:37 421500 -- (-1423.334) (-1421.054) (-1421.355) [-1421.225] * (-1420.642) (-1421.447) [-1422.055] (-1420.496) -- 0:00:37 422000 -- (-1421.151) (-1421.737) [-1420.234] (-1419.883) * (-1420.541) (-1420.733) (-1419.540) [-1419.689] -- 0:00:36 422500 -- (-1421.333) (-1422.080) [-1420.801] (-1419.877) * (-1423.589) (-1422.609) [-1423.843] (-1420.274) -- 0:00:36 423000 -- (-1426.421) (-1421.293) [-1421.986] (-1423.673) * (-1426.619) (-1421.483) (-1421.747) [-1419.574] -- 0:00:36 423500 -- (-1419.868) (-1423.094) (-1422.401) [-1421.206] * (-1420.913) (-1424.013) (-1421.837) [-1419.567] -- 0:00:36 424000 -- (-1420.586) (-1424.623) [-1423.563] (-1420.147) * (-1421.059) (-1424.594) (-1421.301) [-1419.839] -- 0:00:36 424500 -- [-1421.628] (-1419.965) (-1422.856) (-1419.791) * [-1422.341] (-1425.070) (-1421.108) (-1421.844) -- 0:00:36 425000 -- [-1420.763] (-1423.209) (-1420.632) (-1420.568) * (-1421.690) (-1420.071) [-1423.667] (-1422.037) -- 0:00:36 Average standard deviation of split frequencies: 0.008918 425500 -- (-1419.196) [-1424.902] (-1420.747) (-1421.585) * (-1433.810) (-1421.044) [-1424.271] (-1421.897) -- 0:00:36 426000 -- [-1419.515] (-1422.067) (-1420.406) (-1424.922) * (-1424.853) (-1423.992) [-1424.201] (-1424.498) -- 0:00:36 426500 -- (-1419.498) (-1424.660) (-1419.468) [-1431.821] * [-1422.138] (-1426.669) (-1420.851) (-1419.915) -- 0:00:36 427000 -- (-1430.764) (-1423.510) (-1420.445) [-1424.668] * [-1428.212] (-1424.827) (-1424.763) (-1420.929) -- 0:00:36 427500 -- (-1425.694) [-1420.294] (-1419.687) (-1419.707) * (-1423.954) (-1422.964) (-1425.842) [-1422.902] -- 0:00:36 428000 -- (-1422.366) [-1419.996] (-1423.499) (-1420.917) * [-1424.094] (-1423.202) (-1426.100) (-1419.749) -- 0:00:36 428500 -- (-1425.214) (-1422.917) (-1426.023) [-1422.359] * (-1424.102) (-1420.073) (-1421.139) [-1419.789] -- 0:00:36 429000 -- (-1424.541) (-1422.150) (-1427.208) [-1425.776] * (-1424.263) (-1421.771) (-1423.841) [-1420.170] -- 0:00:35 429500 -- (-1421.979) (-1420.293) (-1427.203) [-1423.064] * [-1422.836] (-1420.731) (-1420.093) (-1420.979) -- 0:00:35 430000 -- (-1422.377) (-1421.795) [-1421.860] (-1420.484) * (-1421.493) (-1420.588) [-1420.439] (-1420.844) -- 0:00:35 Average standard deviation of split frequencies: 0.008306 430500 -- [-1422.301] (-1421.767) (-1422.584) (-1420.915) * (-1419.833) (-1421.245) [-1420.519] (-1420.657) -- 0:00:35 431000 -- (-1421.623) [-1422.394] (-1421.781) (-1419.856) * (-1419.912) (-1424.591) [-1421.938] (-1420.668) -- 0:00:36 431500 -- (-1422.371) [-1421.179] (-1421.832) (-1420.314) * (-1419.853) (-1420.017) [-1420.481] (-1420.885) -- 0:00:36 432000 -- [-1424.928] (-1419.561) (-1422.800) (-1421.301) * (-1419.912) (-1427.661) [-1422.910] (-1420.363) -- 0:00:36 432500 -- (-1425.837) [-1419.574] (-1421.376) (-1422.064) * [-1419.443] (-1422.863) (-1421.279) (-1420.015) -- 0:00:36 433000 -- (-1420.977) (-1425.139) [-1419.477] (-1424.846) * [-1420.215] (-1422.788) (-1424.780) (-1422.128) -- 0:00:36 433500 -- (-1420.573) [-1423.990] (-1422.808) (-1426.779) * (-1419.888) [-1420.257] (-1420.696) (-1421.801) -- 0:00:36 434000 -- (-1420.224) [-1421.517] (-1419.320) (-1423.343) * (-1420.993) (-1421.019) [-1424.685] (-1420.871) -- 0:00:36 434500 -- (-1420.260) [-1423.460] (-1419.284) (-1423.075) * (-1420.576) [-1419.631] (-1422.389) (-1423.092) -- 0:00:36 435000 -- (-1419.815) [-1423.456] (-1427.764) (-1421.168) * (-1425.017) [-1421.123] (-1421.778) (-1422.514) -- 0:00:36 Average standard deviation of split frequencies: 0.008586 435500 -- [-1424.127] (-1422.666) (-1419.929) (-1420.559) * (-1420.130) (-1421.232) (-1422.072) [-1420.495] -- 0:00:36 436000 -- (-1422.355) (-1423.553) (-1420.202) [-1421.820] * [-1420.998] (-1420.689) (-1420.539) (-1425.520) -- 0:00:36 436500 -- (-1422.985) (-1422.599) [-1422.645] (-1423.799) * (-1419.771) [-1420.643] (-1421.621) (-1421.132) -- 0:00:36 437000 -- (-1422.229) (-1422.071) [-1419.678] (-1421.712) * (-1422.097) (-1421.171) (-1420.575) [-1421.029] -- 0:00:36 437500 -- (-1421.223) (-1422.887) (-1423.470) [-1423.347] * (-1422.510) [-1420.664] (-1421.414) (-1420.154) -- 0:00:36 438000 -- [-1421.521] (-1420.266) (-1423.728) (-1422.692) * (-1426.802) [-1420.450] (-1421.367) (-1420.162) -- 0:00:35 438500 -- (-1420.612) [-1420.743] (-1423.836) (-1422.425) * (-1425.385) [-1420.677] (-1420.068) (-1420.835) -- 0:00:35 439000 -- (-1420.238) (-1426.099) [-1425.937] (-1419.876) * (-1424.066) (-1420.698) (-1419.958) [-1420.910] -- 0:00:35 439500 -- (-1420.326) [-1420.474] (-1422.712) (-1422.193) * (-1421.790) [-1422.362] (-1425.827) (-1421.235) -- 0:00:35 440000 -- (-1419.924) [-1419.927] (-1420.269) (-1421.786) * [-1420.457] (-1422.486) (-1422.493) (-1420.337) -- 0:00:35 Average standard deviation of split frequencies: 0.009124 440500 -- [-1419.332] (-1420.376) (-1419.606) (-1421.115) * (-1421.623) [-1421.112] (-1423.877) (-1424.204) -- 0:00:35 441000 -- (-1419.495) (-1421.048) (-1419.606) [-1420.055] * (-1421.230) [-1419.624] (-1427.789) (-1430.696) -- 0:00:35 441500 -- (-1422.565) (-1419.957) (-1424.393) [-1422.287] * [-1423.544] (-1421.626) (-1424.542) (-1422.646) -- 0:00:35 442000 -- [-1421.336] (-1422.132) (-1423.072) (-1427.610) * [-1421.331] (-1420.759) (-1422.647) (-1423.601) -- 0:00:35 442500 -- (-1420.093) (-1421.573) (-1421.452) [-1422.535] * (-1421.895) [-1426.452] (-1424.431) (-1428.554) -- 0:00:35 443000 -- (-1420.034) [-1420.230] (-1420.364) (-1425.359) * (-1421.266) (-1423.194) (-1423.525) [-1423.413] -- 0:00:35 443500 -- [-1420.084] (-1419.958) (-1421.547) (-1422.536) * [-1420.822] (-1420.713) (-1422.151) (-1421.281) -- 0:00:35 444000 -- [-1420.908] (-1421.127) (-1422.448) (-1423.109) * [-1420.961] (-1420.563) (-1421.596) (-1424.877) -- 0:00:35 444500 -- (-1422.434) (-1420.125) [-1420.236] (-1419.828) * (-1421.138) (-1423.823) [-1421.996] (-1422.129) -- 0:00:34 445000 -- [-1425.681] (-1425.258) (-1420.245) (-1421.318) * (-1422.345) (-1421.634) [-1420.564] (-1420.407) -- 0:00:34 Average standard deviation of split frequencies: 0.009116 445500 -- (-1424.328) [-1424.491] (-1420.141) (-1421.745) * (-1421.414) (-1425.526) (-1424.691) [-1422.079] -- 0:00:34 446000 -- (-1420.091) [-1420.350] (-1421.180) (-1420.928) * (-1422.598) (-1424.697) (-1423.307) [-1424.665] -- 0:00:34 446500 -- [-1423.490] (-1421.042) (-1420.993) (-1419.664) * (-1421.375) [-1421.700] (-1423.019) (-1421.620) -- 0:00:34 447000 -- [-1420.688] (-1425.667) (-1421.241) (-1422.347) * (-1421.213) [-1423.202] (-1419.502) (-1420.114) -- 0:00:35 447500 -- (-1422.402) (-1426.439) [-1420.029] (-1423.023) * [-1420.717] (-1422.234) (-1424.274) (-1422.926) -- 0:00:35 448000 -- (-1423.436) [-1419.673] (-1422.257) (-1422.884) * (-1420.542) (-1422.944) [-1419.977] (-1423.740) -- 0:00:35 448500 -- (-1421.535) [-1423.638] (-1421.892) (-1420.615) * [-1420.099] (-1420.140) (-1424.402) (-1422.978) -- 0:00:35 449000 -- (-1419.816) (-1422.814) (-1422.065) [-1419.951] * [-1420.786] (-1419.747) (-1423.814) (-1422.450) -- 0:00:35 449500 -- (-1419.943) (-1423.942) [-1420.447] (-1419.925) * (-1422.259) (-1420.599) (-1423.061) [-1422.420] -- 0:00:35 450000 -- (-1421.298) (-1420.394) [-1421.294] (-1420.090) * (-1422.113) (-1425.701) [-1420.260] (-1421.525) -- 0:00:35 Average standard deviation of split frequencies: 0.008760 450500 -- (-1421.225) (-1420.935) [-1419.901] (-1423.215) * (-1423.276) (-1425.711) [-1421.132] (-1423.309) -- 0:00:35 451000 -- (-1420.936) (-1421.925) [-1420.640] (-1424.476) * (-1422.442) (-1422.282) (-1421.612) [-1420.905] -- 0:00:35 451500 -- [-1421.106] (-1420.316) (-1421.434) (-1422.858) * (-1426.045) [-1421.561] (-1421.055) (-1422.885) -- 0:00:35 452000 -- (-1423.725) (-1423.895) [-1421.333] (-1422.448) * (-1422.630) [-1421.408] (-1422.238) (-1422.410) -- 0:00:35 452500 -- [-1422.298] (-1426.826) (-1426.749) (-1422.959) * (-1421.399) (-1420.583) [-1421.090] (-1421.924) -- 0:00:35 453000 -- (-1422.613) (-1426.321) [-1422.306] (-1420.789) * [-1420.763] (-1419.896) (-1420.559) (-1431.713) -- 0:00:35 453500 -- (-1422.864) (-1422.986) [-1420.795] (-1422.297) * [-1423.133] (-1421.777) (-1420.588) (-1421.672) -- 0:00:34 454000 -- [-1421.416] (-1421.450) (-1420.368) (-1420.042) * (-1421.572) (-1422.027) [-1421.878] (-1421.837) -- 0:00:34 454500 -- (-1422.020) [-1421.249] (-1419.673) (-1419.953) * [-1420.322] (-1422.000) (-1424.176) (-1420.413) -- 0:00:34 455000 -- (-1424.107) (-1420.745) [-1419.443] (-1419.865) * [-1419.793] (-1419.913) (-1421.869) (-1419.255) -- 0:00:34 Average standard deviation of split frequencies: 0.009756 455500 -- (-1427.001) (-1422.170) (-1422.797) [-1428.455] * [-1419.518] (-1420.214) (-1421.351) (-1421.635) -- 0:00:34 456000 -- (-1422.429) [-1420.505] (-1420.940) (-1426.466) * (-1421.062) (-1420.857) [-1422.977] (-1420.410) -- 0:00:34 456500 -- (-1419.616) [-1420.818] (-1424.919) (-1421.118) * (-1421.820) [-1420.791] (-1424.951) (-1420.258) -- 0:00:34 457000 -- [-1420.429] (-1421.445) (-1422.879) (-1421.116) * (-1422.888) (-1424.993) [-1422.052] (-1420.320) -- 0:00:34 457500 -- [-1420.402] (-1424.497) (-1421.790) (-1421.926) * (-1419.489) [-1422.016] (-1421.603) (-1419.655) -- 0:00:34 458000 -- (-1419.562) [-1420.040] (-1421.482) (-1420.773) * (-1424.401) [-1424.722] (-1421.908) (-1420.323) -- 0:00:34 458500 -- (-1420.775) (-1422.176) [-1422.104] (-1420.354) * [-1423.160] (-1421.186) (-1422.035) (-1421.240) -- 0:00:34 459000 -- (-1422.531) (-1422.261) [-1421.387] (-1420.782) * [-1425.854] (-1421.935) (-1422.357) (-1420.337) -- 0:00:34 459500 -- (-1420.200) (-1421.649) (-1421.122) [-1422.230] * (-1423.702) [-1422.134] (-1422.191) (-1421.572) -- 0:00:34 460000 -- (-1420.144) [-1421.766] (-1421.669) (-1423.040) * (-1421.630) (-1420.542) (-1423.457) [-1420.775] -- 0:00:34 Average standard deviation of split frequencies: 0.009892 460500 -- (-1421.247) (-1420.856) (-1427.824) [-1419.505] * (-1420.483) (-1420.966) (-1419.387) [-1420.908] -- 0:00:33 461000 -- (-1420.805) [-1420.583] (-1423.419) (-1422.461) * (-1420.919) [-1420.864] (-1420.549) (-1421.202) -- 0:00:33 461500 -- (-1420.799) [-1420.180] (-1426.126) (-1419.879) * [-1421.930] (-1422.632) (-1423.068) (-1422.188) -- 0:00:33 462000 -- (-1423.860) (-1420.052) (-1423.892) [-1422.662] * (-1422.147) (-1424.082) [-1422.289] (-1422.321) -- 0:00:33 462500 -- (-1420.977) (-1419.573) [-1421.379] (-1421.140) * [-1423.599] (-1420.327) (-1420.035) (-1422.329) -- 0:00:33 463000 -- [-1421.403] (-1419.638) (-1421.409) (-1419.743) * (-1422.921) (-1422.066) [-1420.911] (-1421.820) -- 0:00:33 463500 -- [-1426.640] (-1421.263) (-1421.211) (-1421.070) * (-1421.506) [-1422.066] (-1423.688) (-1422.672) -- 0:00:34 464000 -- (-1421.369) (-1420.704) (-1422.923) [-1419.923] * (-1421.536) (-1419.520) [-1426.079] (-1420.204) -- 0:00:34 464500 -- (-1422.993) [-1420.674] (-1423.016) (-1422.676) * (-1421.535) (-1420.180) (-1421.617) [-1420.198] -- 0:00:34 465000 -- (-1422.431) (-1420.592) (-1425.382) [-1421.480] * (-1423.076) (-1419.935) (-1421.176) [-1420.242] -- 0:00:34 Average standard deviation of split frequencies: 0.010559 465500 -- (-1421.946) (-1420.592) (-1423.606) [-1422.982] * (-1423.299) (-1420.334) (-1423.795) [-1420.085] -- 0:00:34 466000 -- (-1420.195) (-1420.592) [-1423.121] (-1423.016) * (-1422.919) [-1420.153] (-1423.742) (-1419.906) -- 0:00:34 466500 -- (-1422.533) (-1420.552) (-1421.116) [-1423.053] * (-1421.236) [-1422.995] (-1428.491) (-1421.461) -- 0:00:34 467000 -- (-1421.280) (-1423.487) [-1424.785] (-1422.338) * (-1421.855) [-1424.147] (-1423.054) (-1420.952) -- 0:00:34 467500 -- (-1422.087) (-1424.928) (-1423.086) [-1421.116] * (-1421.414) (-1421.617) (-1422.901) [-1421.892] -- 0:00:34 468000 -- (-1420.596) [-1420.669] (-1422.446) (-1421.054) * (-1423.606) [-1422.416] (-1420.853) (-1422.530) -- 0:00:34 468500 -- (-1422.508) (-1422.026) [-1420.739] (-1420.060) * (-1422.776) (-1422.305) [-1422.225] (-1425.541) -- 0:00:34 469000 -- [-1422.146] (-1422.613) (-1420.023) (-1425.288) * (-1420.812) (-1420.607) (-1420.968) [-1423.057] -- 0:00:33 469500 -- (-1420.847) (-1421.807) (-1421.171) [-1422.183] * [-1420.424] (-1423.130) (-1420.968) (-1422.790) -- 0:00:33 470000 -- [-1422.196] (-1422.143) (-1422.339) (-1421.854) * [-1421.249] (-1422.021) (-1422.030) (-1420.651) -- 0:00:33 Average standard deviation of split frequencies: 0.010579 470500 -- (-1422.804) (-1422.174) [-1421.734] (-1425.488) * (-1424.901) (-1420.405) (-1421.147) [-1421.567] -- 0:00:33 471000 -- [-1424.913] (-1422.209) (-1422.797) (-1423.681) * [-1420.760] (-1422.995) (-1420.651) (-1419.666) -- 0:00:33 471500 -- [-1421.459] (-1421.435) (-1423.972) (-1421.869) * (-1425.335) (-1420.714) [-1422.194] (-1420.324) -- 0:00:33 472000 -- (-1425.253) [-1421.700] (-1424.440) (-1424.609) * (-1421.001) (-1423.400) (-1422.585) [-1420.329] -- 0:00:33 472500 -- (-1425.077) (-1421.196) [-1421.524] (-1421.670) * (-1420.872) (-1421.157) (-1421.345) [-1419.814] -- 0:00:33 473000 -- (-1426.686) (-1421.950) (-1421.554) [-1421.754] * (-1423.944) [-1420.810] (-1421.675) (-1419.620) -- 0:00:33 473500 -- (-1421.853) [-1421.607] (-1421.597) (-1422.305) * (-1420.495) [-1420.243] (-1421.216) (-1423.538) -- 0:00:33 474000 -- (-1420.613) [-1421.501] (-1421.179) (-1423.680) * [-1421.318] (-1419.539) (-1424.346) (-1422.176) -- 0:00:33 474500 -- [-1420.264] (-1421.673) (-1420.030) (-1422.349) * (-1422.049) (-1419.974) (-1424.876) [-1421.057] -- 0:00:33 475000 -- (-1420.444) (-1421.377) (-1419.805) [-1421.883] * [-1424.375] (-1420.446) (-1421.885) (-1420.365) -- 0:00:33 Average standard deviation of split frequencies: 0.010102 475500 -- (-1421.592) (-1422.632) [-1419.739] (-1421.896) * (-1425.223) [-1421.599] (-1421.293) (-1420.523) -- 0:00:33 476000 -- [-1420.782] (-1424.108) (-1419.943) (-1423.440) * (-1425.598) [-1419.888] (-1421.094) (-1420.790) -- 0:00:33 476500 -- (-1421.036) (-1421.527) [-1419.698] (-1419.975) * (-1424.029) [-1420.564] (-1420.777) (-1420.824) -- 0:00:32 477000 -- (-1423.915) [-1420.724] (-1421.290) (-1420.828) * (-1424.497) [-1419.854] (-1422.443) (-1421.093) -- 0:00:32 477500 -- (-1420.098) (-1423.927) [-1426.520] (-1425.070) * (-1420.575) (-1420.965) [-1420.386] (-1421.169) -- 0:00:32 478000 -- [-1421.247] (-1423.654) (-1420.071) (-1421.275) * (-1420.927) [-1420.853] (-1420.703) (-1421.527) -- 0:00:32 478500 -- (-1420.733) (-1421.174) (-1422.318) [-1421.936] * (-1422.350) (-1423.349) [-1419.822] (-1424.220) -- 0:00:32 479000 -- (-1421.290) (-1420.388) (-1425.017) [-1420.387] * (-1420.436) [-1420.903] (-1423.263) (-1419.984) -- 0:00:32 479500 -- (-1420.938) (-1421.041) (-1419.859) [-1419.803] * (-1419.895) (-1423.564) (-1425.048) [-1419.310] -- 0:00:33 480000 -- (-1420.696) [-1423.705] (-1419.959) (-1424.597) * [-1420.383] (-1424.065) (-1420.832) (-1420.761) -- 0:00:33 Average standard deviation of split frequencies: 0.010134 480500 -- (-1419.885) (-1423.175) (-1425.755) [-1420.697] * [-1420.094] (-1423.795) (-1421.539) (-1423.836) -- 0:00:33 481000 -- (-1419.813) (-1421.900) [-1421.520] (-1420.402) * (-1421.689) (-1423.184) (-1421.207) [-1420.956] -- 0:00:33 481500 -- (-1420.365) [-1420.744] (-1421.941) (-1421.597) * (-1422.893) (-1421.552) (-1420.841) [-1423.624] -- 0:00:33 482000 -- (-1422.009) (-1420.692) (-1420.852) [-1424.416] * (-1424.017) [-1421.747] (-1419.883) (-1421.937) -- 0:00:33 482500 -- (-1420.917) [-1419.772] (-1421.552) (-1426.733) * (-1421.608) (-1420.865) [-1419.956] (-1422.242) -- 0:00:33 483000 -- (-1420.635) [-1421.082] (-1432.406) (-1428.882) * (-1421.374) (-1419.799) (-1419.733) [-1425.014] -- 0:00:33 483500 -- (-1422.307) (-1421.733) (-1421.467) [-1419.503] * [-1421.155] (-1423.613) (-1423.139) (-1421.634) -- 0:00:33 484000 -- (-1422.919) [-1420.610] (-1420.988) (-1419.866) * (-1422.210) [-1420.679] (-1421.598) (-1423.061) -- 0:00:33 484500 -- (-1422.151) (-1419.668) (-1419.926) [-1421.890] * [-1422.635] (-1421.275) (-1421.637) (-1424.668) -- 0:00:32 485000 -- (-1422.106) (-1420.881) [-1419.397] (-1425.039) * [-1420.700] (-1421.585) (-1425.194) (-1419.607) -- 0:00:32 Average standard deviation of split frequencies: 0.009518 485500 -- (-1421.721) [-1426.081] (-1419.319) (-1425.991) * (-1422.799) (-1422.722) [-1421.856] (-1424.839) -- 0:00:32 486000 -- (-1427.509) (-1420.149) [-1419.772] (-1422.923) * (-1424.486) (-1422.037) (-1422.968) [-1426.136] -- 0:00:32 486500 -- [-1422.009] (-1421.954) (-1422.108) (-1420.692) * (-1425.689) [-1420.408] (-1422.113) (-1422.962) -- 0:00:32 487000 -- [-1422.060] (-1421.449) (-1419.324) (-1420.556) * (-1424.397) (-1419.750) (-1424.373) [-1424.834] -- 0:00:32 487500 -- (-1421.800) (-1422.754) (-1420.022) [-1423.769] * [-1423.695] (-1420.422) (-1421.160) (-1424.083) -- 0:00:32 488000 -- (-1422.693) [-1419.523] (-1420.859) (-1420.167) * (-1423.044) (-1420.773) [-1424.227] (-1422.007) -- 0:00:32 488500 -- (-1422.386) (-1419.769) (-1420.400) [-1421.221] * [-1421.370] (-1421.708) (-1420.339) (-1420.191) -- 0:00:32 489000 -- [-1423.126] (-1423.457) (-1421.206) (-1420.287) * (-1421.261) (-1424.528) [-1421.019] (-1422.121) -- 0:00:32 489500 -- [-1423.792] (-1423.137) (-1420.373) (-1420.333) * (-1421.797) (-1422.284) [-1420.823] (-1421.974) -- 0:00:32 490000 -- (-1421.788) (-1422.172) (-1421.267) [-1420.680] * (-1421.909) (-1422.507) [-1420.832] (-1421.908) -- 0:00:32 Average standard deviation of split frequencies: 0.009848 490500 -- [-1427.115] (-1421.824) (-1419.337) (-1427.592) * (-1419.830) (-1423.616) [-1422.144] (-1420.380) -- 0:00:32 491000 -- (-1421.862) (-1423.610) [-1419.764] (-1422.916) * [-1421.148] (-1422.268) (-1423.435) (-1423.135) -- 0:00:32 491500 -- (-1421.873) [-1422.997] (-1419.437) (-1422.335) * (-1421.386) (-1420.010) (-1422.264) [-1422.526] -- 0:00:32 492000 -- (-1424.739) [-1422.813] (-1423.906) (-1422.831) * (-1420.878) (-1419.862) [-1420.914] (-1422.102) -- 0:00:32 492500 -- (-1420.032) (-1421.361) [-1422.826] (-1424.312) * (-1420.971) (-1420.935) [-1421.789] (-1426.627) -- 0:00:31 493000 -- (-1420.582) (-1421.522) [-1423.462] (-1422.253) * [-1420.824] (-1425.172) (-1426.770) (-1424.978) -- 0:00:31 493500 -- (-1422.648) [-1421.284] (-1423.212) (-1426.407) * (-1424.284) (-1423.356) [-1422.021] (-1422.444) -- 0:00:31 494000 -- [-1422.863] (-1421.278) (-1424.178) (-1424.797) * [-1420.647] (-1420.839) (-1421.438) (-1421.725) -- 0:00:31 494500 -- [-1421.825] (-1421.811) (-1421.352) (-1425.886) * (-1425.237) (-1420.533) [-1422.999] (-1423.713) -- 0:00:31 495000 -- (-1421.360) (-1420.964) [-1420.992] (-1422.578) * (-1425.895) (-1419.677) (-1421.532) [-1424.334] -- 0:00:31 Average standard deviation of split frequencies: 0.010336 495500 -- (-1423.183) (-1422.955) [-1424.155] (-1424.980) * (-1422.950) (-1421.954) [-1420.131] (-1424.830) -- 0:00:32 496000 -- (-1421.056) [-1419.908] (-1419.750) (-1424.374) * (-1420.921) (-1419.704) [-1422.656] (-1420.793) -- 0:00:32 496500 -- [-1422.393] (-1420.218) (-1421.336) (-1421.740) * [-1421.144] (-1420.840) (-1423.538) (-1420.900) -- 0:00:32 497000 -- (-1420.535) [-1421.143] (-1422.586) (-1419.406) * (-1422.284) (-1421.771) (-1423.460) [-1425.207] -- 0:00:32 497500 -- (-1420.652) [-1420.090] (-1422.420) (-1419.387) * [-1420.823] (-1426.210) (-1423.268) (-1424.872) -- 0:00:32 498000 -- (-1421.436) (-1419.898) (-1423.423) [-1419.252] * (-1424.251) (-1419.933) [-1421.127] (-1422.162) -- 0:00:32 498500 -- [-1429.304] (-1421.687) (-1420.486) (-1420.317) * [-1421.234] (-1420.546) (-1420.668) (-1428.769) -- 0:00:32 499000 -- (-1423.444) (-1421.136) [-1420.064] (-1422.378) * (-1421.573) (-1420.959) [-1422.522] (-1423.972) -- 0:00:32 499500 -- (-1420.518) (-1420.961) (-1420.314) [-1421.927] * [-1419.575] (-1421.569) (-1423.054) (-1420.942) -- 0:00:32 500000 -- (-1419.593) (-1422.314) (-1420.167) [-1423.914] * (-1425.477) (-1421.583) (-1421.167) [-1420.868] -- 0:00:32 Average standard deviation of split frequencies: 0.010608 500500 -- (-1422.686) (-1423.682) [-1420.074] (-1426.137) * (-1425.021) (-1421.286) (-1421.355) [-1422.142] -- 0:00:31 501000 -- (-1427.730) [-1421.670] (-1420.638) (-1421.978) * (-1423.562) [-1420.761] (-1421.612) (-1422.334) -- 0:00:31 501500 -- (-1422.127) (-1424.857) (-1419.883) [-1420.651] * [-1422.268] (-1421.059) (-1420.991) (-1420.098) -- 0:00:31 502000 -- (-1419.768) (-1422.221) (-1419.783) [-1422.760] * (-1428.879) [-1421.008] (-1421.862) (-1421.243) -- 0:00:31 502500 -- (-1431.844) (-1421.042) [-1419.783] (-1422.579) * (-1421.666) [-1423.956] (-1420.750) (-1422.383) -- 0:00:31 503000 -- (-1422.028) (-1422.607) [-1420.303] (-1420.269) * (-1422.545) (-1420.060) [-1426.194] (-1422.064) -- 0:00:31 503500 -- [-1420.890] (-1420.401) (-1420.078) (-1421.706) * [-1420.693] (-1422.591) (-1423.582) (-1421.115) -- 0:00:31 504000 -- (-1420.040) (-1421.125) [-1420.312] (-1422.251) * [-1422.942] (-1421.306) (-1422.654) (-1424.050) -- 0:00:31 504500 -- [-1420.426] (-1420.582) (-1424.117) (-1420.782) * (-1420.975) (-1421.114) [-1423.483] (-1420.408) -- 0:00:31 505000 -- (-1423.093) (-1421.327) [-1419.778] (-1420.766) * (-1421.159) (-1420.785) [-1420.096] (-1421.525) -- 0:00:31 Average standard deviation of split frequencies: 0.010434 505500 -- [-1422.624] (-1419.371) (-1420.014) (-1422.583) * (-1422.219) (-1423.145) [-1419.668] (-1421.877) -- 0:00:31 506000 -- (-1421.307) (-1419.367) [-1420.025] (-1420.354) * (-1421.424) (-1424.736) [-1422.184] (-1421.869) -- 0:00:31 506500 -- (-1422.959) (-1419.511) [-1422.773] (-1420.427) * [-1420.507] (-1424.303) (-1421.637) (-1419.708) -- 0:00:31 507000 -- (-1424.939) (-1420.128) [-1423.049] (-1420.564) * (-1421.547) (-1423.030) [-1420.567] (-1420.876) -- 0:00:31 507500 -- (-1423.245) [-1420.040] (-1421.841) (-1420.943) * [-1421.368] (-1419.887) (-1422.840) (-1421.153) -- 0:00:31 508000 -- (-1422.790) [-1419.432] (-1421.685) (-1420.500) * (-1423.343) (-1419.781) (-1425.425) [-1421.927] -- 0:00:30 508500 -- (-1420.719) (-1421.467) [-1420.579] (-1422.030) * (-1422.665) (-1419.609) (-1420.485) [-1422.190] -- 0:00:30 509000 -- (-1419.936) [-1421.683] (-1420.579) (-1421.808) * (-1421.193) (-1419.731) (-1420.352) [-1421.853] -- 0:00:30 509500 -- (-1420.689) [-1420.774] (-1423.764) (-1423.162) * (-1420.199) (-1420.472) (-1423.109) [-1424.180] -- 0:00:30 510000 -- (-1424.178) [-1419.602] (-1423.943) (-1423.380) * (-1425.015) [-1419.885] (-1423.252) (-1420.478) -- 0:00:30 Average standard deviation of split frequencies: 0.009723 510500 -- (-1420.233) (-1420.954) [-1420.249] (-1421.502) * (-1420.293) [-1419.548] (-1421.676) (-1420.557) -- 0:00:30 511000 -- (-1424.029) [-1421.109] (-1424.707) (-1419.573) * (-1421.505) (-1423.631) [-1422.330] (-1421.297) -- 0:00:31 511500 -- (-1423.057) (-1421.228) [-1423.302] (-1421.242) * (-1420.411) (-1422.953) (-1424.907) [-1421.567] -- 0:00:31 512000 -- (-1419.368) (-1421.620) [-1420.485] (-1421.752) * (-1421.050) (-1425.532) (-1427.327) [-1422.663] -- 0:00:31 512500 -- (-1423.099) (-1425.343) (-1422.004) [-1420.458] * (-1421.326) (-1422.202) (-1426.989) [-1420.015] -- 0:00:31 513000 -- (-1425.340) (-1420.027) (-1424.138) [-1420.237] * (-1422.971) (-1424.742) [-1425.818] (-1421.289) -- 0:00:31 513500 -- (-1421.984) (-1426.185) [-1420.302] (-1419.541) * (-1421.203) [-1424.335] (-1422.884) (-1425.223) -- 0:00:31 514000 -- (-1420.783) (-1422.782) [-1422.564] (-1421.477) * [-1423.612] (-1421.717) (-1422.551) (-1422.327) -- 0:00:31 514500 -- (-1421.109) (-1424.252) [-1420.855] (-1420.257) * (-1424.186) [-1422.785] (-1420.927) (-1423.349) -- 0:00:31 515000 -- (-1420.967) (-1420.968) (-1422.000) [-1419.722] * [-1420.938] (-1426.556) (-1419.921) (-1422.242) -- 0:00:31 Average standard deviation of split frequencies: 0.010232 515500 -- (-1423.935) (-1423.075) (-1419.441) [-1420.348] * [-1420.729] (-1427.633) (-1422.538) (-1422.844) -- 0:00:31 516000 -- (-1421.699) (-1421.730) [-1421.495] (-1423.763) * (-1423.808) [-1423.771] (-1420.694) (-1419.843) -- 0:00:30 516500 -- [-1421.280] (-1422.255) (-1422.909) (-1420.397) * [-1419.640] (-1428.810) (-1421.327) (-1422.576) -- 0:00:30 517000 -- [-1422.245] (-1422.259) (-1420.969) (-1421.507) * [-1420.100] (-1427.683) (-1420.704) (-1420.735) -- 0:00:30 517500 -- (-1419.954) (-1422.494) (-1425.893) [-1425.142] * (-1421.905) (-1426.543) [-1420.600] (-1421.137) -- 0:00:30 518000 -- (-1422.933) (-1420.213) (-1422.246) [-1423.667] * (-1425.320) [-1420.697] (-1421.993) (-1427.275) -- 0:00:30 518500 -- (-1420.036) (-1420.832) (-1421.475) [-1420.258] * (-1420.976) (-1419.250) (-1419.409) [-1423.034] -- 0:00:30 519000 -- (-1422.344) [-1423.054] (-1424.048) (-1423.046) * (-1422.720) [-1419.425] (-1422.543) (-1423.563) -- 0:00:30 519500 -- (-1421.348) (-1420.431) [-1421.534] (-1420.788) * (-1423.862) (-1419.809) [-1421.192] (-1420.647) -- 0:00:30 520000 -- (-1421.087) (-1420.570) (-1423.579) [-1420.142] * (-1424.444) (-1419.347) (-1420.999) [-1423.846] -- 0:00:30 Average standard deviation of split frequencies: 0.010020 520500 -- (-1419.784) [-1422.611] (-1423.677) (-1421.690) * (-1424.028) (-1419.347) [-1423.445] (-1425.545) -- 0:00:30 521000 -- (-1422.404) (-1421.569) [-1425.215] (-1422.143) * (-1422.030) (-1419.275) [-1420.839] (-1421.951) -- 0:00:30 521500 -- (-1420.936) (-1420.900) [-1419.891] (-1427.059) * (-1422.198) [-1420.467] (-1420.851) (-1420.121) -- 0:00:30 522000 -- (-1424.300) (-1422.777) [-1421.310] (-1426.293) * (-1421.416) [-1421.380] (-1421.081) (-1425.530) -- 0:00:30 522500 -- (-1422.198) (-1420.126) [-1421.098] (-1424.039) * (-1423.365) (-1423.004) (-1422.122) [-1424.279] -- 0:00:30 523000 -- (-1421.894) [-1419.972] (-1420.791) (-1422.428) * [-1422.481] (-1421.814) (-1420.800) (-1421.897) -- 0:00:30 523500 -- (-1422.627) (-1421.590) (-1420.949) [-1422.230] * (-1423.646) (-1420.542) (-1420.301) [-1421.116] -- 0:00:30 524000 -- [-1422.120] (-1420.824) (-1421.347) (-1422.524) * (-1424.296) [-1419.726] (-1422.079) (-1419.554) -- 0:00:29 524500 -- (-1425.123) (-1423.127) (-1423.764) [-1423.951] * (-1422.222) (-1419.976) [-1420.469] (-1420.386) -- 0:00:29 525000 -- (-1427.446) (-1422.044) [-1421.961] (-1422.235) * (-1424.207) (-1420.770) [-1420.132] (-1421.991) -- 0:00:29 Average standard deviation of split frequencies: 0.009799 525500 -- [-1426.974] (-1423.930) (-1423.086) (-1421.808) * [-1421.974] (-1423.052) (-1421.193) (-1419.851) -- 0:00:29 526000 -- (-1425.158) (-1423.480) (-1420.140) [-1419.391] * (-1425.201) [-1420.396] (-1422.529) (-1421.451) -- 0:00:29 526500 -- (-1426.958) [-1420.145] (-1422.675) (-1425.917) * (-1429.043) [-1419.706] (-1421.349) (-1430.601) -- 0:00:29 527000 -- (-1425.280) [-1420.234] (-1421.040) (-1420.907) * (-1426.055) [-1422.254] (-1422.613) (-1431.365) -- 0:00:30 527500 -- [-1422.360] (-1421.709) (-1419.838) (-1427.536) * (-1427.772) [-1422.966] (-1421.083) (-1420.474) -- 0:00:30 528000 -- [-1423.285] (-1420.469) (-1419.894) (-1424.216) * (-1422.035) (-1419.873) (-1422.227) [-1422.261] -- 0:00:30 528500 -- [-1423.061] (-1421.581) (-1419.582) (-1424.208) * (-1420.071) (-1421.235) [-1420.928] (-1421.605) -- 0:00:30 529000 -- [-1420.752] (-1424.367) (-1420.800) (-1424.225) * (-1421.007) (-1420.381) (-1423.661) [-1422.460] -- 0:00:30 529500 -- (-1422.546) (-1426.830) [-1421.099] (-1420.758) * [-1421.782] (-1420.517) (-1419.456) (-1420.097) -- 0:00:30 530000 -- (-1422.092) (-1424.908) (-1421.194) [-1420.329] * (-1420.074) (-1419.318) [-1419.673] (-1419.475) -- 0:00:30 Average standard deviation of split frequencies: 0.009535 530500 -- (-1423.845) [-1421.025] (-1423.099) (-1427.022) * (-1420.878) [-1420.203] (-1420.134) (-1420.675) -- 0:00:30 531000 -- (-1423.843) (-1420.451) [-1421.663] (-1423.984) * (-1425.359) [-1423.014] (-1419.840) (-1421.213) -- 0:00:30 531500 -- [-1420.991] (-1424.115) (-1421.727) (-1422.479) * [-1421.399] (-1424.860) (-1420.587) (-1420.516) -- 0:00:29 532000 -- (-1422.807) [-1420.830] (-1421.216) (-1423.457) * (-1426.015) (-1426.210) [-1421.165] (-1420.525) -- 0:00:29 532500 -- [-1421.323] (-1425.001) (-1420.487) (-1419.312) * (-1429.196) [-1424.032] (-1420.858) (-1421.473) -- 0:00:29 533000 -- (-1422.446) (-1420.528) [-1420.996] (-1422.301) * (-1421.550) [-1420.707] (-1420.128) (-1420.235) -- 0:00:29 533500 -- (-1422.690) [-1422.243] (-1420.734) (-1425.830) * (-1421.993) (-1422.426) [-1420.327] (-1421.413) -- 0:00:29 534000 -- [-1419.972] (-1419.359) (-1421.197) (-1421.896) * (-1421.166) [-1420.773] (-1421.001) (-1422.911) -- 0:00:29 534500 -- (-1421.296) (-1424.718) (-1421.316) [-1424.419] * [-1420.130] (-1419.809) (-1421.326) (-1421.849) -- 0:00:29 535000 -- (-1424.302) (-1422.748) [-1421.182] (-1421.603) * (-1421.228) [-1420.253] (-1424.235) (-1424.189) -- 0:00:29 Average standard deviation of split frequencies: 0.009674 535500 -- (-1424.145) (-1424.521) [-1423.733] (-1422.984) * (-1423.241) [-1421.313] (-1422.653) (-1424.567) -- 0:00:29 536000 -- (-1422.119) (-1422.974) (-1421.127) [-1424.220] * (-1421.736) (-1420.885) (-1421.837) [-1423.222] -- 0:00:29 536500 -- (-1422.303) [-1422.028] (-1420.260) (-1421.681) * [-1419.796] (-1421.657) (-1421.508) (-1422.304) -- 0:00:29 537000 -- (-1421.227) (-1422.878) [-1419.719] (-1421.446) * (-1421.900) (-1422.884) (-1420.478) [-1422.345] -- 0:00:29 537500 -- (-1421.644) [-1422.481] (-1419.577) (-1420.731) * (-1422.324) (-1420.509) [-1420.558] (-1421.280) -- 0:00:29 538000 -- (-1422.535) (-1423.743) (-1419.664) [-1420.082] * (-1423.170) (-1423.553) [-1420.724] (-1424.351) -- 0:00:29 538500 -- (-1422.405) [-1421.949] (-1421.422) (-1419.681) * (-1424.443) (-1422.791) [-1420.529] (-1421.199) -- 0:00:29 539000 -- (-1420.518) [-1419.581] (-1419.589) (-1421.044) * (-1422.400) (-1422.086) [-1421.105] (-1421.686) -- 0:00:29 539500 -- (-1422.095) (-1420.908) (-1420.611) [-1424.352] * [-1423.041] (-1423.238) (-1420.744) (-1423.138) -- 0:00:29 540000 -- (-1421.988) [-1421.417] (-1419.829) (-1425.051) * (-1425.322) [-1420.679] (-1423.590) (-1421.389) -- 0:00:28 Average standard deviation of split frequencies: 0.009475 540500 -- (-1420.376) (-1420.124) (-1422.157) [-1421.235] * [-1428.301] (-1420.690) (-1421.939) (-1420.954) -- 0:00:28 541000 -- (-1419.177) [-1420.124] (-1420.113) (-1421.721) * (-1419.995) (-1421.901) [-1420.820] (-1428.787) -- 0:00:28 541500 -- (-1422.721) (-1420.137) [-1425.410] (-1424.670) * (-1422.935) (-1421.127) [-1421.539] (-1426.461) -- 0:00:28 542000 -- (-1420.250) [-1421.095] (-1421.475) (-1421.716) * (-1420.696) (-1421.024) (-1421.860) [-1421.557] -- 0:00:28 542500 -- (-1420.396) (-1421.008) [-1420.083] (-1421.412) * [-1421.339] (-1420.422) (-1423.021) (-1423.634) -- 0:00:28 543000 -- (-1419.720) (-1422.201) (-1426.203) [-1421.355] * (-1424.066) (-1421.666) [-1423.494] (-1423.802) -- 0:00:29 543500 -- (-1421.211) (-1420.918) (-1424.523) [-1421.893] * (-1421.470) [-1421.155] (-1420.970) (-1421.305) -- 0:00:29 544000 -- (-1420.794) (-1424.768) [-1419.688] (-1419.591) * (-1420.750) (-1421.716) [-1420.816] (-1419.783) -- 0:00:29 544500 -- [-1420.572] (-1420.480) (-1420.093) (-1419.551) * (-1426.810) [-1422.111] (-1419.401) (-1421.413) -- 0:00:29 545000 -- (-1421.096) [-1422.056] (-1420.683) (-1422.413) * [-1420.719] (-1420.868) (-1420.687) (-1422.429) -- 0:00:29 Average standard deviation of split frequencies: 0.009094 545500 -- [-1419.145] (-1422.454) (-1420.922) (-1420.425) * (-1422.305) (-1420.196) (-1421.105) [-1424.419] -- 0:00:29 546000 -- (-1420.638) (-1422.469) (-1420.686) [-1424.449] * (-1422.114) (-1422.365) (-1426.716) [-1421.391] -- 0:00:29 546500 -- (-1422.988) [-1420.369] (-1420.735) (-1426.646) * (-1422.691) (-1421.279) [-1423.622] (-1424.670) -- 0:00:29 547000 -- (-1422.860) (-1421.114) [-1421.726] (-1425.004) * [-1419.686] (-1423.010) (-1425.159) (-1423.575) -- 0:00:28 547500 -- [-1421.426] (-1423.014) (-1419.509) (-1424.074) * (-1422.101) [-1420.748] (-1425.782) (-1422.158) -- 0:00:28 548000 -- (-1421.706) (-1423.212) [-1420.091] (-1428.973) * [-1420.692] (-1421.587) (-1421.537) (-1421.310) -- 0:00:28 548500 -- (-1420.128) (-1423.314) [-1420.873] (-1420.459) * [-1421.158] (-1422.243) (-1423.721) (-1422.207) -- 0:00:28 549000 -- (-1420.212) (-1421.153) (-1424.122) [-1420.135] * [-1422.986] (-1422.619) (-1422.268) (-1421.065) -- 0:00:28 549500 -- [-1419.599] (-1421.739) (-1424.678) (-1419.268) * [-1421.633] (-1419.279) (-1419.964) (-1420.535) -- 0:00:28 550000 -- (-1421.586) [-1422.572] (-1426.116) (-1420.642) * (-1421.733) [-1419.280] (-1420.297) (-1420.243) -- 0:00:28 Average standard deviation of split frequencies: 0.009131 550500 -- (-1421.162) (-1420.921) (-1420.966) [-1422.789] * (-1421.598) (-1420.650) (-1419.433) [-1420.897] -- 0:00:28 551000 -- (-1424.663) (-1420.687) (-1422.266) [-1421.624] * (-1420.046) (-1420.913) [-1423.091] (-1425.636) -- 0:00:28 551500 -- (-1424.392) (-1428.429) [-1422.323] (-1419.640) * [-1420.363] (-1427.853) (-1422.099) (-1420.599) -- 0:00:28 552000 -- (-1421.575) (-1421.871) (-1424.590) [-1421.652] * (-1421.519) [-1425.707] (-1423.037) (-1420.827) -- 0:00:28 552500 -- [-1420.045] (-1423.408) (-1420.122) (-1425.573) * (-1423.668) (-1423.634) [-1422.828] (-1422.986) -- 0:00:28 553000 -- (-1421.333) (-1424.138) (-1420.947) [-1423.483] * (-1421.763) (-1420.871) [-1425.016] (-1421.756) -- 0:00:28 553500 -- (-1419.655) [-1425.411] (-1421.459) (-1423.297) * [-1422.774] (-1422.288) (-1427.401) (-1420.512) -- 0:00:28 554000 -- (-1420.265) (-1425.732) [-1422.098] (-1420.743) * (-1420.336) (-1421.656) (-1423.659) [-1421.679] -- 0:00:28 554500 -- (-1420.594) [-1420.486] (-1421.080) (-1420.314) * (-1419.989) (-1423.719) [-1420.693] (-1424.868) -- 0:00:28 555000 -- [-1419.893] (-1420.206) (-1419.566) (-1421.821) * (-1419.983) [-1426.087] (-1422.086) (-1422.919) -- 0:00:28 Average standard deviation of split frequencies: 0.009439 555500 -- (-1420.169) (-1419.645) [-1419.450] (-1422.801) * [-1423.654] (-1419.982) (-1420.907) (-1421.107) -- 0:00:28 556000 -- [-1422.114] (-1420.595) (-1421.226) (-1424.619) * (-1421.912) (-1424.601) [-1420.445] (-1420.662) -- 0:00:27 556500 -- (-1419.817) [-1421.874] (-1421.625) (-1424.627) * [-1426.330] (-1423.551) (-1423.633) (-1421.950) -- 0:00:27 557000 -- (-1419.699) (-1420.325) [-1419.846] (-1424.442) * (-1423.247) (-1423.703) (-1421.225) [-1420.266] -- 0:00:27 557500 -- (-1420.007) [-1422.517] (-1421.709) (-1421.122) * [-1424.420] (-1420.202) (-1423.458) (-1419.685) -- 0:00:27 558000 -- (-1420.088) (-1420.116) (-1421.559) [-1420.396] * (-1421.580) [-1419.875] (-1419.996) (-1423.286) -- 0:00:27 558500 -- (-1419.886) (-1419.812) (-1424.466) [-1421.325] * [-1421.181] (-1423.017) (-1420.466) (-1420.187) -- 0:00:27 559000 -- (-1421.128) (-1423.701) (-1424.023) [-1421.153] * (-1421.212) (-1423.244) [-1424.055] (-1421.947) -- 0:00:28 559500 -- (-1420.559) (-1421.288) (-1421.381) [-1421.545] * (-1424.179) (-1421.899) (-1421.654) [-1420.391] -- 0:00:28 560000 -- (-1420.374) (-1420.947) [-1421.194] (-1422.111) * (-1423.069) [-1420.692] (-1420.782) (-1421.742) -- 0:00:28 Average standard deviation of split frequencies: 0.009305 560500 -- [-1419.852] (-1419.738) (-1424.353) (-1421.498) * (-1421.815) [-1421.044] (-1423.273) (-1425.102) -- 0:00:28 561000 -- (-1422.446) (-1422.417) [-1420.511] (-1421.981) * [-1420.811] (-1419.743) (-1421.363) (-1425.499) -- 0:00:28 561500 -- (-1422.416) (-1421.436) (-1419.442) [-1420.686] * (-1420.567) (-1419.363) [-1422.076] (-1424.734) -- 0:00:28 562000 -- [-1420.948] (-1422.038) (-1419.930) (-1420.634) * (-1420.480) (-1421.838) [-1420.830] (-1422.018) -- 0:00:28 562500 -- (-1421.999) [-1424.016] (-1420.233) (-1423.016) * (-1421.856) [-1421.518] (-1422.505) (-1423.078) -- 0:00:28 563000 -- (-1420.510) [-1421.956] (-1419.888) (-1427.190) * (-1422.819) (-1423.906) [-1423.351] (-1421.968) -- 0:00:27 563500 -- (-1421.793) (-1421.405) [-1419.997] (-1422.133) * (-1420.082) (-1423.781) (-1426.633) [-1420.752] -- 0:00:27 564000 -- [-1422.019] (-1423.124) (-1419.554) (-1422.108) * (-1421.400) (-1425.880) [-1424.046] (-1420.875) -- 0:00:27 564500 -- (-1420.071) [-1421.612] (-1421.912) (-1424.274) * [-1422.281] (-1422.973) (-1426.202) (-1424.860) -- 0:00:27 565000 -- (-1421.888) (-1420.575) (-1420.291) [-1420.717] * (-1423.641) (-1424.778) (-1423.960) [-1425.694] -- 0:00:27 Average standard deviation of split frequencies: 0.009106 565500 -- (-1420.439) (-1423.225) (-1420.478) [-1422.099] * (-1424.551) (-1422.559) [-1420.946] (-1421.249) -- 0:00:27 566000 -- (-1423.326) (-1420.687) [-1420.571] (-1422.468) * [-1422.916] (-1420.141) (-1421.481) (-1420.189) -- 0:00:27 566500 -- (-1421.557) (-1420.277) [-1422.658] (-1425.530) * (-1421.016) [-1419.476] (-1423.422) (-1422.397) -- 0:00:27 567000 -- [-1422.362] (-1422.661) (-1421.397) (-1420.451) * (-1420.192) (-1420.098) [-1421.882] (-1421.093) -- 0:00:27 567500 -- [-1421.326] (-1422.268) (-1423.842) (-1423.108) * (-1421.840) (-1431.498) [-1421.882] (-1422.335) -- 0:00:27 568000 -- (-1422.108) (-1421.138) (-1421.518) [-1422.647] * (-1424.562) (-1421.743) (-1421.763) [-1422.255] -- 0:00:27 568500 -- (-1420.599) (-1422.253) (-1419.686) [-1419.256] * (-1424.756) (-1426.995) [-1420.526] (-1423.273) -- 0:00:27 569000 -- [-1421.402] (-1420.252) (-1420.286) (-1422.707) * (-1421.763) (-1421.765) (-1421.058) [-1422.870] -- 0:00:27 569500 -- (-1423.447) [-1421.345] (-1421.249) (-1420.116) * [-1419.513] (-1422.329) (-1420.480) (-1425.609) -- 0:00:27 570000 -- (-1424.828) (-1420.917) (-1420.441) [-1420.076] * (-1422.538) (-1422.056) [-1424.560] (-1425.333) -- 0:00:27 Average standard deviation of split frequencies: 0.009307 570500 -- (-1420.194) (-1423.877) [-1420.527] (-1423.544) * (-1424.310) (-1431.189) [-1423.924] (-1425.335) -- 0:00:27 571000 -- [-1421.485] (-1422.412) (-1421.364) (-1427.501) * (-1423.888) (-1420.972) (-1423.896) [-1421.891] -- 0:00:27 571500 -- (-1422.876) (-1422.413) [-1420.572] (-1423.402) * (-1420.328) (-1422.291) [-1423.633] (-1421.748) -- 0:00:26 572000 -- [-1428.474] (-1421.397) (-1423.488) (-1421.029) * [-1422.786] (-1420.764) (-1424.963) (-1422.123) -- 0:00:26 572500 -- (-1423.386) [-1419.346] (-1422.279) (-1423.020) * (-1423.068) (-1419.884) [-1423.229] (-1420.586) -- 0:00:26 573000 -- (-1420.080) (-1419.307) (-1421.817) [-1421.992] * (-1422.641) (-1422.188) [-1422.167] (-1420.589) -- 0:00:26 573500 -- (-1425.061) [-1422.630] (-1422.766) (-1422.613) * (-1422.688) (-1420.089) (-1421.312) [-1421.756] -- 0:00:26 574000 -- (-1426.251) (-1420.649) [-1423.837] (-1422.470) * (-1421.338) (-1420.236) (-1420.925) [-1421.226] -- 0:00:26 574500 -- (-1423.586) (-1419.672) [-1423.508] (-1421.533) * (-1421.267) [-1420.050] (-1420.959) (-1421.045) -- 0:00:26 575000 -- (-1425.570) (-1421.864) (-1426.064) [-1422.043] * (-1420.628) (-1424.978) [-1420.247] (-1421.284) -- 0:00:27 Average standard deviation of split frequencies: 0.008730 575500 -- (-1420.552) (-1420.498) [-1419.811] (-1427.062) * (-1420.536) [-1422.099] (-1420.703) (-1423.828) -- 0:00:27 576000 -- [-1421.281] (-1419.891) (-1419.315) (-1425.973) * [-1427.325] (-1423.962) (-1420.799) (-1426.509) -- 0:00:27 576500 -- (-1422.064) (-1422.938) [-1420.676] (-1429.033) * (-1421.533) [-1423.404] (-1422.769) (-1423.772) -- 0:00:27 577000 -- (-1423.092) (-1421.708) (-1421.824) [-1421.720] * (-1425.484) (-1419.407) (-1420.781) [-1419.815] -- 0:00:27 577500 -- (-1429.109) (-1421.172) (-1423.690) [-1422.754] * (-1421.561) [-1420.113] (-1420.085) (-1424.456) -- 0:00:27 578000 -- (-1425.179) [-1420.098] (-1423.666) (-1428.422) * (-1423.912) (-1420.637) [-1422.985] (-1424.558) -- 0:00:27 578500 -- (-1423.122) (-1420.046) [-1424.268] (-1424.389) * (-1421.792) (-1424.243) [-1420.403] (-1422.506) -- 0:00:26 579000 -- [-1423.368] (-1421.270) (-1422.442) (-1423.121) * (-1422.111) (-1423.793) (-1424.989) [-1423.587] -- 0:00:26 579500 -- (-1423.476) (-1420.277) [-1423.049] (-1424.067) * (-1421.643) [-1419.931] (-1420.267) (-1421.126) -- 0:00:26 580000 -- (-1421.702) [-1419.814] (-1422.200) (-1420.257) * (-1423.106) [-1423.692] (-1420.386) (-1420.659) -- 0:00:26 Average standard deviation of split frequencies: 0.008389 580500 -- (-1421.806) [-1420.698] (-1422.905) (-1420.783) * (-1421.690) (-1424.529) [-1423.648] (-1424.514) -- 0:00:26 581000 -- (-1421.191) (-1420.629) [-1419.740] (-1421.751) * (-1419.447) (-1423.727) (-1421.035) [-1419.280] -- 0:00:26 581500 -- (-1420.156) [-1420.917] (-1419.908) (-1421.783) * (-1419.447) (-1421.896) [-1422.009] (-1423.280) -- 0:00:26 582000 -- (-1420.156) [-1419.976] (-1423.124) (-1421.200) * [-1420.763] (-1420.963) (-1420.952) (-1420.293) -- 0:00:26 582500 -- (-1422.512) (-1421.296) [-1419.914] (-1419.687) * (-1420.635) (-1419.993) (-1420.408) [-1421.257] -- 0:00:26 583000 -- (-1419.859) (-1422.553) (-1420.399) [-1421.914] * (-1421.761) (-1420.217) (-1421.033) [-1420.985] -- 0:00:26 583500 -- (-1419.599) (-1424.418) [-1420.447] (-1422.642) * [-1420.786] (-1423.850) (-1422.202) (-1421.362) -- 0:00:26 584000 -- [-1420.068] (-1424.367) (-1421.814) (-1420.801) * (-1421.507) (-1425.085) [-1424.188] (-1422.326) -- 0:00:26 584500 -- (-1419.420) (-1423.928) (-1423.100) [-1421.583] * (-1421.857) (-1423.461) (-1427.411) [-1421.235] -- 0:00:26 585000 -- [-1419.338] (-1427.632) (-1421.182) (-1421.905) * (-1426.134) (-1426.197) (-1422.260) [-1420.689] -- 0:00:26 Average standard deviation of split frequencies: 0.008795 585500 -- (-1420.345) (-1422.937) (-1420.520) [-1419.331] * (-1422.731) (-1422.023) [-1422.826] (-1423.536) -- 0:00:26 586000 -- [-1423.698] (-1420.962) (-1420.126) (-1420.154) * (-1421.050) (-1423.011) (-1420.576) [-1420.539] -- 0:00:26 586500 -- (-1421.354) [-1421.542] (-1421.563) (-1423.842) * (-1424.355) (-1423.302) [-1419.927] (-1420.955) -- 0:00:26 587000 -- (-1422.478) (-1420.905) [-1420.679] (-1420.575) * (-1429.463) [-1420.755] (-1420.646) (-1421.403) -- 0:00:26 587500 -- (-1422.536) (-1420.970) [-1420.422] (-1423.065) * (-1422.130) [-1420.866] (-1420.548) (-1420.807) -- 0:00:25 588000 -- [-1422.288] (-1421.392) (-1425.650) (-1425.017) * (-1421.797) (-1424.957) (-1420.776) [-1420.937] -- 0:00:25 588500 -- (-1419.939) (-1419.992) (-1422.985) [-1420.365] * [-1422.385] (-1423.739) (-1420.076) (-1420.908) -- 0:00:25 589000 -- (-1421.283) (-1420.163) [-1423.141] (-1423.118) * (-1421.979) (-1423.197) (-1422.356) [-1420.191] -- 0:00:25 589500 -- (-1421.612) [-1420.261] (-1421.976) (-1420.084) * [-1421.833] (-1424.765) (-1421.651) (-1421.075) -- 0:00:25 590000 -- (-1422.144) (-1422.021) [-1420.308] (-1419.514) * [-1419.455] (-1421.370) (-1422.905) (-1419.321) -- 0:00:25 Average standard deviation of split frequencies: 0.008673 590500 -- (-1421.289) [-1421.145] (-1420.349) (-1419.986) * (-1423.941) (-1420.103) [-1420.959] (-1421.744) -- 0:00:25 591000 -- (-1421.036) [-1420.938] (-1420.644) (-1424.133) * [-1419.244] (-1420.307) (-1420.088) (-1419.742) -- 0:00:26 591500 -- (-1423.485) (-1420.504) [-1419.714] (-1422.549) * (-1421.766) (-1421.559) [-1421.004] (-1422.456) -- 0:00:26 592000 -- (-1420.698) (-1419.275) (-1421.710) [-1421.542] * (-1421.409) [-1425.265] (-1422.252) (-1421.835) -- 0:00:26 592500 -- [-1424.948] (-1423.986) (-1420.819) (-1425.454) * (-1420.565) (-1420.706) [-1419.810] (-1423.433) -- 0:00:26 593000 -- (-1421.625) [-1422.376] (-1422.039) (-1423.031) * (-1420.851) (-1422.291) (-1419.852) [-1420.613] -- 0:00:26 593500 -- (-1422.065) [-1422.107] (-1420.706) (-1421.127) * (-1420.430) (-1423.502) [-1419.957] (-1421.999) -- 0:00:26 594000 -- (-1421.537) (-1428.742) [-1424.868] (-1421.124) * (-1422.032) (-1421.845) [-1419.883] (-1422.835) -- 0:00:25 594500 -- (-1421.548) [-1425.152] (-1422.540) (-1420.643) * [-1420.917] (-1421.433) (-1420.993) (-1421.121) -- 0:00:25 595000 -- (-1421.240) (-1425.978) (-1427.246) [-1423.022] * (-1423.339) (-1427.974) [-1422.132] (-1420.834) -- 0:00:25 Average standard deviation of split frequencies: 0.008542 595500 -- (-1421.523) [-1423.621] (-1423.516) (-1421.238) * (-1423.040) (-1420.840) (-1421.169) [-1421.565] -- 0:00:25 596000 -- [-1419.843] (-1423.186) (-1424.162) (-1421.567) * (-1423.442) (-1421.200) [-1421.960] (-1423.839) -- 0:00:25 596500 -- (-1421.629) [-1424.140] (-1422.525) (-1422.459) * (-1420.820) [-1420.480] (-1420.448) (-1423.120) -- 0:00:25 597000 -- [-1421.770] (-1422.930) (-1423.305) (-1422.532) * (-1421.397) (-1421.365) (-1421.659) [-1423.855] -- 0:00:25 597500 -- (-1423.818) (-1422.564) (-1421.404) [-1421.237] * (-1420.219) [-1422.425] (-1420.394) (-1423.771) -- 0:00:25 598000 -- [-1421.442] (-1421.789) (-1420.896) (-1421.739) * (-1420.492) (-1421.890) [-1422.655] (-1425.119) -- 0:00:25 598500 -- (-1422.120) [-1423.486] (-1420.603) (-1422.584) * (-1425.127) [-1420.523] (-1421.917) (-1424.700) -- 0:00:25 599000 -- (-1421.904) (-1421.235) (-1419.713) [-1420.980] * (-1423.721) (-1422.277) [-1422.926] (-1420.522) -- 0:00:25 599500 -- (-1419.573) (-1425.923) [-1421.071] (-1422.636) * (-1421.779) (-1420.482) [-1422.067] (-1421.815) -- 0:00:25 600000 -- (-1420.428) (-1420.744) (-1422.074) [-1422.417] * [-1422.335] (-1425.351) (-1419.626) (-1420.484) -- 0:00:25 Average standard deviation of split frequencies: 0.008057 600500 -- (-1420.383) (-1421.003) [-1421.242] (-1423.726) * (-1421.769) [-1424.305] (-1420.678) (-1420.160) -- 0:00:25 601000 -- [-1421.683] (-1420.496) (-1422.687) (-1420.500) * [-1425.092] (-1423.991) (-1419.248) (-1420.120) -- 0:00:25 601500 -- (-1420.458) (-1421.912) [-1421.373] (-1421.036) * (-1425.441) (-1427.018) [-1420.379] (-1424.223) -- 0:00:25 602000 -- [-1420.632] (-1422.661) (-1420.848) (-1420.024) * (-1422.980) (-1423.109) (-1420.317) [-1422.064] -- 0:00:25 602500 -- (-1420.504) (-1420.340) (-1420.196) [-1419.455] * (-1420.378) (-1421.753) [-1420.674] (-1422.014) -- 0:00:25 603000 -- [-1419.661] (-1423.088) (-1422.821) (-1420.280) * (-1421.558) (-1419.624) [-1421.964] (-1424.507) -- 0:00:25 603500 -- [-1419.307] (-1423.765) (-1424.995) (-1421.058) * (-1424.377) (-1420.162) [-1422.886] (-1422.066) -- 0:00:24 604000 -- (-1423.314) (-1421.378) (-1421.834) [-1423.725] * [-1420.192] (-1420.453) (-1423.115) (-1422.495) -- 0:00:24 604500 -- (-1431.747) [-1420.777] (-1426.155) (-1425.630) * (-1420.102) (-1420.544) [-1421.712] (-1430.492) -- 0:00:24 605000 -- [-1419.772] (-1420.029) (-1425.619) (-1420.518) * (-1421.140) (-1422.368) [-1423.361] (-1420.750) -- 0:00:24 Average standard deviation of split frequencies: 0.008246 605500 -- (-1421.341) [-1421.866] (-1424.724) (-1424.211) * (-1421.104) (-1422.073) (-1420.732) [-1419.415] -- 0:00:24 606000 -- (-1421.051) (-1420.742) [-1422.128] (-1421.214) * (-1429.451) (-1421.290) (-1424.641) [-1419.717] -- 0:00:24 606500 -- (-1421.414) (-1422.828) [-1425.450] (-1428.619) * (-1422.096) (-1421.859) [-1424.487] (-1421.833) -- 0:00:24 607000 -- (-1420.277) [-1420.031] (-1422.950) (-1424.382) * (-1421.561) (-1423.081) (-1419.659) [-1420.402] -- 0:00:25 607500 -- (-1423.913) (-1423.292) (-1421.141) [-1421.333] * (-1423.114) (-1420.471) [-1419.803] (-1421.000) -- 0:00:25 608000 -- [-1421.623] (-1421.625) (-1424.420) (-1420.460) * (-1422.604) [-1419.513] (-1420.643) (-1419.839) -- 0:00:25 608500 -- (-1424.107) [-1419.783] (-1421.864) (-1420.703) * (-1419.756) (-1421.636) (-1420.969) [-1419.821] -- 0:00:25 609000 -- [-1420.402] (-1425.254) (-1423.202) (-1420.041) * (-1421.417) (-1422.199) (-1419.857) [-1419.758] -- 0:00:25 609500 -- (-1420.210) (-1425.768) (-1423.184) [-1420.688] * (-1430.260) [-1420.873] (-1420.205) (-1420.735) -- 0:00:24 610000 -- [-1419.778] (-1421.534) (-1423.484) (-1420.469) * (-1427.066) (-1421.846) [-1421.785] (-1421.620) -- 0:00:24 Average standard deviation of split frequencies: 0.008028 610500 -- [-1424.729] (-1420.766) (-1423.452) (-1421.379) * (-1430.495) [-1422.708] (-1423.234) (-1421.242) -- 0:00:24 611000 -- [-1420.595] (-1420.108) (-1420.690) (-1423.852) * (-1422.185) (-1422.296) [-1419.590] (-1419.197) -- 0:00:24 611500 -- (-1420.315) (-1419.427) (-1421.346) [-1419.702] * (-1420.770) (-1419.939) [-1421.959] (-1419.208) -- 0:00:24 612000 -- (-1422.593) (-1421.954) [-1420.963] (-1420.000) * (-1421.580) (-1421.442) [-1424.183] (-1419.807) -- 0:00:24 612500 -- (-1423.147) [-1419.854] (-1420.659) (-1421.249) * [-1423.331] (-1421.087) (-1423.800) (-1422.491) -- 0:00:24 613000 -- (-1423.635) [-1424.990] (-1423.618) (-1422.873) * (-1423.377) (-1420.905) [-1420.431] (-1434.283) -- 0:00:24 613500 -- (-1423.418) (-1422.186) [-1424.254] (-1424.405) * (-1423.154) (-1420.888) [-1419.600] (-1423.019) -- 0:00:24 614000 -- (-1422.886) [-1421.733] (-1422.616) (-1420.045) * [-1424.146] (-1421.309) (-1420.244) (-1420.815) -- 0:00:24 614500 -- (-1421.829) (-1422.577) [-1420.894] (-1420.542) * (-1422.112) (-1422.033) (-1420.655) [-1423.814] -- 0:00:24 615000 -- (-1420.242) [-1421.349] (-1420.984) (-1421.077) * (-1422.701) (-1422.821) [-1420.967] (-1421.155) -- 0:00:24 Average standard deviation of split frequencies: 0.008112 615500 -- (-1422.227) [-1419.803] (-1423.212) (-1420.015) * [-1422.462] (-1421.657) (-1421.852) (-1422.457) -- 0:00:24 616000 -- [-1419.903] (-1419.276) (-1425.016) (-1421.428) * (-1421.796) [-1421.719] (-1423.975) (-1420.001) -- 0:00:24 616500 -- (-1423.565) (-1419.276) (-1425.195) [-1422.359] * [-1422.371] (-1424.050) (-1426.634) (-1419.641) -- 0:00:24 617000 -- (-1423.538) (-1420.334) [-1421.440] (-1424.625) * (-1420.522) [-1429.347] (-1421.135) (-1420.832) -- 0:00:24 617500 -- (-1420.068) (-1429.420) [-1423.777] (-1420.819) * (-1423.446) (-1422.049) (-1425.017) [-1422.339] -- 0:00:24 618000 -- [-1422.991] (-1426.329) (-1424.164) (-1421.034) * (-1420.423) [-1421.841] (-1424.346) (-1420.142) -- 0:00:24 618500 -- (-1424.901) (-1420.274) (-1423.016) [-1420.503] * (-1421.234) [-1421.101] (-1421.519) (-1423.645) -- 0:00:24 619000 -- (-1420.265) [-1419.477] (-1424.171) (-1422.922) * (-1422.180) (-1421.463) (-1420.962) [-1422.186] -- 0:00:24 619500 -- [-1421.056] (-1421.703) (-1423.258) (-1421.694) * (-1427.536) (-1422.477) (-1421.028) [-1424.177] -- 0:00:23 620000 -- [-1420.830] (-1420.350) (-1421.249) (-1420.639) * (-1423.815) [-1421.378] (-1420.297) (-1421.494) -- 0:00:23 Average standard deviation of split frequencies: 0.008760 620500 -- [-1420.247] (-1422.166) (-1422.524) (-1421.781) * (-1421.872) (-1421.524) [-1420.645] (-1422.940) -- 0:00:23 621000 -- (-1421.189) (-1420.855) [-1420.500] (-1423.288) * [-1422.967] (-1420.429) (-1419.309) (-1424.604) -- 0:00:23 621500 -- [-1420.352] (-1424.895) (-1424.597) (-1423.915) * (-1422.791) [-1421.758] (-1421.249) (-1423.947) -- 0:00:23 622000 -- (-1420.352) (-1421.293) (-1420.223) [-1420.124] * (-1429.402) (-1421.343) (-1422.705) [-1420.969] -- 0:00:23 622500 -- (-1422.851) (-1421.144) [-1422.205] (-1420.502) * (-1422.164) (-1424.321) (-1423.066) [-1420.101] -- 0:00:23 623000 -- (-1422.120) (-1425.354) (-1420.869) [-1420.813] * (-1421.651) [-1421.490] (-1421.153) (-1419.913) -- 0:00:24 623500 -- (-1420.232) [-1420.035] (-1421.327) (-1422.725) * (-1420.868) (-1420.071) [-1421.337] (-1420.143) -- 0:00:24 624000 -- (-1423.440) (-1424.343) (-1419.940) [-1422.355] * (-1421.124) (-1424.046) [-1425.050] (-1421.622) -- 0:00:24 624500 -- (-1423.013) [-1422.775] (-1421.002) (-1422.224) * [-1420.125] (-1421.668) (-1425.458) (-1423.629) -- 0:00:24 625000 -- [-1422.179] (-1421.550) (-1423.031) (-1426.664) * (-1421.845) (-1421.492) [-1420.735] (-1421.721) -- 0:00:24 Average standard deviation of split frequencies: 0.008585 625500 -- (-1422.262) (-1425.688) [-1426.679] (-1419.996) * [-1420.604] (-1424.812) (-1422.359) (-1421.221) -- 0:00:23 626000 -- (-1423.885) (-1420.564) [-1420.528] (-1419.553) * (-1420.643) (-1421.835) (-1420.799) [-1419.982] -- 0:00:23 626500 -- [-1421.652] (-1423.619) (-1420.181) (-1421.629) * (-1423.734) [-1421.210] (-1422.688) (-1419.707) -- 0:00:23 627000 -- (-1421.983) [-1420.893] (-1421.740) (-1420.532) * (-1421.348) (-1422.151) [-1421.605] (-1420.562) -- 0:00:23 627500 -- [-1421.965] (-1421.800) (-1421.326) (-1421.540) * [-1420.855] (-1422.353) (-1428.246) (-1419.955) -- 0:00:23 628000 -- (-1419.920) (-1422.284) [-1422.543] (-1420.777) * (-1423.329) (-1420.876) [-1420.974] (-1420.686) -- 0:00:23 628500 -- (-1424.309) [-1421.426] (-1422.487) (-1419.890) * (-1421.197) (-1419.441) [-1421.474] (-1420.470) -- 0:00:23 629000 -- [-1421.085] (-1422.314) (-1420.789) (-1421.357) * [-1421.999] (-1423.781) (-1422.238) (-1424.776) -- 0:00:23 629500 -- [-1420.126] (-1421.731) (-1422.946) (-1419.876) * (-1419.944) (-1422.132) [-1421.003] (-1423.589) -- 0:00:23 630000 -- (-1420.903) [-1421.376] (-1425.193) (-1419.809) * (-1420.720) (-1424.112) [-1419.854] (-1424.604) -- 0:00:23 Average standard deviation of split frequencies: 0.008671 630500 -- (-1421.582) (-1420.526) [-1420.153] (-1422.186) * (-1423.450) (-1422.975) [-1420.931] (-1421.827) -- 0:00:23 631000 -- (-1421.941) [-1423.199] (-1420.782) (-1420.107) * [-1419.548] (-1422.925) (-1421.953) (-1422.780) -- 0:00:23 631500 -- (-1420.707) [-1423.812] (-1424.423) (-1422.154) * (-1425.918) (-1423.153) [-1421.306] (-1422.101) -- 0:00:23 632000 -- [-1420.917] (-1421.234) (-1423.005) (-1419.894) * (-1424.212) [-1422.748] (-1420.650) (-1421.504) -- 0:00:23 632500 -- [-1420.809] (-1421.030) (-1420.524) (-1420.341) * (-1424.291) (-1424.145) (-1422.105) [-1420.501] -- 0:00:23 633000 -- (-1420.050) (-1420.656) (-1423.108) [-1421.764] * (-1426.149) (-1425.075) (-1423.473) [-1419.372] -- 0:00:23 633500 -- (-1419.725) (-1422.472) (-1422.745) [-1422.569] * (-1422.708) (-1427.633) (-1420.883) [-1421.348] -- 0:00:23 634000 -- [-1420.329] (-1424.486) (-1424.592) (-1422.512) * [-1422.463] (-1423.111) (-1420.205) (-1423.223) -- 0:00:23 634500 -- (-1420.534) (-1423.886) [-1422.321] (-1422.631) * (-1426.143) (-1420.186) (-1419.953) [-1420.014] -- 0:00:23 635000 -- [-1420.722] (-1420.793) (-1420.984) (-1423.025) * (-1421.247) (-1421.347) [-1426.342] (-1419.610) -- 0:00:22 Average standard deviation of split frequencies: 0.008647 635500 -- (-1420.469) (-1421.110) (-1419.688) [-1421.084] * (-1422.123) (-1423.880) [-1421.039] (-1421.548) -- 0:00:22 636000 -- [-1421.985] (-1420.746) (-1420.559) (-1420.870) * [-1420.375] (-1424.020) (-1420.437) (-1425.920) -- 0:00:22 636500 -- (-1423.952) [-1425.727] (-1420.088) (-1421.253) * (-1421.505) (-1423.530) (-1423.617) [-1420.407] -- 0:00:22 637000 -- (-1421.829) (-1423.605) [-1419.631] (-1422.167) * (-1420.756) (-1423.946) (-1423.319) [-1424.927] -- 0:00:22 637500 -- (-1420.764) (-1420.462) [-1420.039] (-1420.938) * [-1422.143] (-1421.674) (-1427.810) (-1420.992) -- 0:00:22 638000 -- [-1420.545] (-1420.557) (-1423.415) (-1421.005) * [-1421.318] (-1421.662) (-1425.940) (-1423.127) -- 0:00:22 638500 -- (-1429.510) [-1421.207] (-1422.698) (-1421.862) * [-1420.768] (-1422.124) (-1420.978) (-1420.377) -- 0:00:22 639000 -- (-1422.491) [-1420.921] (-1421.352) (-1425.475) * (-1425.099) (-1422.219) (-1421.625) [-1420.354] -- 0:00:23 639500 -- (-1421.099) [-1423.917] (-1422.236) (-1419.751) * (-1421.774) [-1420.602] (-1421.670) (-1421.318) -- 0:00:23 640000 -- (-1420.742) [-1422.343] (-1419.826) (-1419.556) * (-1422.950) (-1420.593) (-1419.535) [-1422.435] -- 0:00:23 Average standard deviation of split frequencies: 0.009026 640500 -- (-1422.751) (-1423.843) [-1420.586] (-1421.105) * [-1422.547] (-1420.165) (-1426.162) (-1421.388) -- 0:00:23 641000 -- (-1423.912) [-1420.424] (-1421.220) (-1421.525) * (-1421.691) (-1420.242) [-1421.300] (-1421.461) -- 0:00:22 641500 -- [-1424.524] (-1420.885) (-1420.599) (-1420.733) * (-1421.318) [-1421.032] (-1421.411) (-1425.213) -- 0:00:22 642000 -- (-1420.328) (-1425.317) (-1419.561) [-1420.462] * (-1423.008) (-1422.244) [-1420.858] (-1420.857) -- 0:00:22 642500 -- [-1421.304] (-1420.193) (-1422.734) (-1423.460) * (-1425.476) (-1420.196) (-1420.365) [-1421.754] -- 0:00:22 643000 -- (-1420.290) (-1421.890) [-1421.408] (-1424.088) * (-1422.276) (-1421.715) [-1422.894] (-1421.390) -- 0:00:22 643500 -- (-1423.650) (-1424.427) [-1422.613] (-1419.603) * (-1420.091) (-1421.625) (-1425.101) [-1419.501] -- 0:00:22 644000 -- (-1430.350) [-1423.009] (-1425.029) (-1421.302) * (-1420.224) (-1421.441) [-1424.620] (-1420.317) -- 0:00:22 644500 -- (-1427.029) [-1424.196] (-1421.732) (-1423.967) * (-1421.622) [-1420.328] (-1422.463) (-1421.269) -- 0:00:22 645000 -- (-1422.344) [-1423.136] (-1423.346) (-1420.232) * (-1420.095) [-1421.992] (-1421.573) (-1422.063) -- 0:00:22 Average standard deviation of split frequencies: 0.008164 645500 -- (-1421.177) (-1420.815) [-1420.370] (-1422.448) * [-1420.440] (-1422.383) (-1421.398) (-1421.116) -- 0:00:22 646000 -- [-1419.454] (-1421.226) (-1421.301) (-1424.253) * (-1419.978) [-1422.335] (-1420.721) (-1421.055) -- 0:00:22 646500 -- [-1419.432] (-1421.002) (-1420.546) (-1425.600) * (-1421.329) [-1420.258] (-1420.721) (-1421.866) -- 0:00:22 647000 -- (-1422.495) [-1423.363] (-1420.718) (-1423.088) * (-1421.212) [-1420.678] (-1421.489) (-1421.313) -- 0:00:22 647500 -- (-1422.521) (-1420.191) [-1423.061] (-1422.208) * (-1424.582) [-1420.212] (-1419.406) (-1420.439) -- 0:00:22 648000 -- (-1420.524) (-1421.134) [-1421.225] (-1423.047) * (-1424.013) (-1419.724) (-1421.528) [-1422.548] -- 0:00:22 648500 -- (-1424.476) [-1420.044] (-1421.450) (-1421.561) * (-1419.831) (-1420.311) (-1421.811) [-1421.459] -- 0:00:22 649000 -- (-1426.505) (-1422.133) (-1421.207) [-1421.454] * (-1420.240) (-1420.698) (-1421.087) [-1422.628] -- 0:00:22 649500 -- (-1425.668) (-1420.803) [-1420.876] (-1425.519) * (-1431.481) (-1421.113) [-1420.984] (-1421.295) -- 0:00:22 650000 -- (-1422.214) (-1424.633) (-1422.730) [-1422.028] * (-1425.612) (-1420.353) (-1423.478) [-1420.830] -- 0:00:22 Average standard deviation of split frequencies: 0.008286 650500 -- (-1422.937) (-1420.192) (-1422.564) [-1421.348] * (-1421.869) (-1421.411) (-1421.387) [-1421.809] -- 0:00:22 651000 -- (-1421.897) [-1420.191] (-1425.737) (-1419.966) * [-1420.575] (-1423.263) (-1424.375) (-1420.863) -- 0:00:21 651500 -- (-1419.759) [-1420.772] (-1426.439) (-1422.315) * (-1420.888) (-1421.278) (-1424.299) [-1421.210] -- 0:00:21 652000 -- [-1420.669] (-1420.213) (-1422.809) (-1419.770) * (-1423.024) (-1420.869) [-1424.600] (-1419.527) -- 0:00:21 652500 -- (-1422.822) [-1422.415] (-1421.266) (-1419.724) * (-1423.691) (-1421.387) (-1423.673) [-1420.581] -- 0:00:21 653000 -- (-1419.494) (-1425.169) (-1422.446) [-1421.013] * (-1420.638) [-1419.867] (-1423.425) (-1419.930) -- 0:00:21 653500 -- (-1419.986) [-1421.892] (-1419.283) (-1419.769) * (-1421.264) [-1421.325] (-1420.394) (-1424.288) -- 0:00:21 654000 -- [-1419.943] (-1420.820) (-1419.186) (-1420.450) * (-1422.080) [-1420.263] (-1423.448) (-1421.301) -- 0:00:21 654500 -- (-1421.652) (-1421.660) (-1421.245) [-1422.195] * (-1422.220) (-1420.223) [-1421.586] (-1419.572) -- 0:00:21 655000 -- [-1426.167] (-1420.856) (-1420.223) (-1420.613) * (-1421.257) [-1424.549] (-1421.252) (-1423.580) -- 0:00:22 Average standard deviation of split frequencies: 0.009162 655500 -- (-1423.790) [-1421.275] (-1420.605) (-1421.689) * [-1422.424] (-1425.239) (-1421.658) (-1420.201) -- 0:00:22 656000 -- [-1420.215] (-1420.298) (-1423.322) (-1419.558) * (-1421.000) (-1422.495) [-1421.902] (-1421.017) -- 0:00:22 656500 -- (-1420.580) (-1425.096) [-1421.180] (-1420.492) * (-1426.334) [-1422.315] (-1422.599) (-1424.458) -- 0:00:21 657000 -- (-1421.236) (-1423.396) [-1423.373] (-1419.397) * (-1422.268) (-1421.709) (-1421.045) [-1423.539] -- 0:00:21 657500 -- (-1421.258) [-1419.882] (-1421.356) (-1423.488) * [-1428.018] (-1423.554) (-1420.666) (-1424.046) -- 0:00:21 658000 -- [-1421.045] (-1421.472) (-1421.482) (-1420.389) * [-1424.263] (-1422.007) (-1420.642) (-1420.200) -- 0:00:21 658500 -- (-1421.041) (-1421.564) [-1419.668] (-1421.624) * (-1424.113) [-1423.188] (-1422.024) (-1420.257) -- 0:00:21 659000 -- (-1422.749) [-1420.675] (-1420.632) (-1420.080) * [-1423.068] (-1425.250) (-1421.080) (-1420.512) -- 0:00:21 659500 -- (-1423.881) [-1422.632] (-1422.717) (-1425.721) * [-1421.468] (-1421.893) (-1419.584) (-1420.895) -- 0:00:21 660000 -- (-1423.080) (-1421.562) [-1421.171] (-1421.397) * (-1421.101) (-1420.895) (-1425.025) [-1420.821] -- 0:00:21 Average standard deviation of split frequencies: 0.009231 660500 -- (-1422.840) (-1421.548) (-1422.594) [-1421.569] * (-1422.758) [-1421.658] (-1420.983) (-1420.236) -- 0:00:21 661000 -- (-1420.869) [-1421.269] (-1425.710) (-1420.611) * (-1420.804) (-1420.424) (-1421.846) [-1419.529] -- 0:00:21 661500 -- (-1419.975) (-1425.098) (-1423.389) [-1422.271] * [-1421.785] (-1421.934) (-1424.196) (-1420.327) -- 0:00:21 662000 -- (-1427.802) [-1420.440] (-1421.042) (-1423.157) * (-1421.321) [-1421.102] (-1419.784) (-1419.402) -- 0:00:21 662500 -- (-1427.667) (-1425.354) (-1422.273) [-1423.581] * [-1420.984] (-1423.253) (-1420.118) (-1420.319) -- 0:00:21 663000 -- [-1421.840] (-1420.089) (-1424.644) (-1427.455) * (-1419.563) (-1423.286) (-1420.153) [-1421.327] -- 0:00:21 663500 -- (-1419.706) [-1420.061] (-1427.168) (-1420.855) * [-1420.263] (-1421.725) (-1420.362) (-1421.025) -- 0:00:21 664000 -- (-1421.679) (-1420.205) (-1419.999) [-1420.835] * (-1422.811) [-1423.578] (-1422.075) (-1420.355) -- 0:00:21 664500 -- (-1419.745) [-1422.211] (-1419.879) (-1420.565) * (-1420.662) (-1420.324) (-1422.589) [-1420.124] -- 0:00:21 665000 -- (-1424.062) (-1423.099) (-1422.820) [-1423.453] * (-1421.908) (-1423.039) (-1423.699) [-1422.367] -- 0:00:21 Average standard deviation of split frequencies: 0.009069 665500 -- (-1421.608) (-1424.975) [-1424.251] (-1420.575) * (-1426.717) (-1428.134) [-1427.622] (-1422.424) -- 0:00:21 666000 -- (-1425.168) (-1421.664) (-1424.819) [-1421.213] * (-1420.730) (-1424.119) (-1426.802) [-1423.085] -- 0:00:21 666500 -- (-1423.566) (-1419.984) [-1421.687] (-1419.963) * (-1422.564) (-1424.417) [-1421.697] (-1421.603) -- 0:00:21 667000 -- (-1420.988) (-1419.875) (-1422.070) [-1420.596] * (-1421.548) (-1421.228) (-1422.399) [-1422.067] -- 0:00:20 667500 -- (-1422.347) (-1419.862) [-1423.202] (-1422.107) * [-1423.367] (-1423.029) (-1421.727) (-1423.579) -- 0:00:20 668000 -- (-1424.879) (-1421.094) (-1422.088) [-1422.210] * (-1422.841) [-1423.103] (-1422.819) (-1422.104) -- 0:00:20 668500 -- (-1429.810) (-1426.116) [-1420.693] (-1421.555) * (-1423.939) (-1422.556) (-1421.350) [-1420.897] -- 0:00:20 669000 -- [-1421.034] (-1424.276) (-1426.618) (-1421.307) * (-1422.576) (-1420.914) [-1420.035] (-1421.159) -- 0:00:20 669500 -- (-1422.015) (-1425.029) (-1424.214) [-1419.815] * (-1420.313) (-1420.396) [-1419.514] (-1420.428) -- 0:00:20 670000 -- [-1421.872] (-1423.963) (-1421.452) (-1420.977) * [-1421.622] (-1421.187) (-1421.694) (-1420.593) -- 0:00:20 Average standard deviation of split frequencies: 0.009269 670500 -- [-1420.081] (-1420.242) (-1420.978) (-1419.828) * (-1421.058) [-1420.953] (-1433.811) (-1419.922) -- 0:00:20 671000 -- (-1422.309) (-1421.069) (-1423.773) [-1419.828] * [-1420.438] (-1421.294) (-1428.178) (-1422.728) -- 0:00:21 671500 -- (-1421.995) [-1419.870] (-1420.515) (-1420.430) * (-1420.599) (-1422.680) (-1424.849) [-1419.864] -- 0:00:21 672000 -- (-1421.575) (-1419.313) (-1420.885) [-1419.834] * (-1420.838) (-1421.249) (-1427.509) [-1420.350] -- 0:00:20 672500 -- (-1419.792) (-1421.528) (-1422.135) [-1421.359] * (-1421.153) [-1420.598] (-1422.800) (-1422.871) -- 0:00:20 673000 -- (-1420.411) [-1420.143] (-1424.932) (-1421.457) * [-1420.915] (-1420.895) (-1420.524) (-1420.983) -- 0:00:20 673500 -- (-1422.855) (-1419.674) (-1421.719) [-1422.103] * [-1420.809] (-1422.356) (-1425.775) (-1423.847) -- 0:00:20 674000 -- (-1425.643) [-1419.660] (-1423.890) (-1424.853) * (-1423.937) [-1420.414] (-1424.451) (-1421.943) -- 0:00:20 674500 -- (-1420.439) [-1420.166] (-1420.092) (-1419.744) * (-1420.234) (-1421.350) [-1422.768] (-1419.681) -- 0:00:20 675000 -- (-1423.863) (-1425.299) (-1421.157) [-1420.657] * (-1426.629) (-1420.638) (-1421.907) [-1425.863] -- 0:00:20 Average standard deviation of split frequencies: 0.009153 675500 -- (-1421.482) (-1425.380) (-1421.949) [-1422.877] * (-1420.330) (-1422.198) [-1421.241] (-1424.357) -- 0:00:20 676000 -- [-1420.958] (-1422.092) (-1423.913) (-1421.949) * (-1420.173) (-1420.331) (-1420.450) [-1421.501] -- 0:00:20 676500 -- (-1421.331) (-1429.650) (-1421.268) [-1421.489] * (-1421.618) [-1420.312] (-1420.884) (-1424.702) -- 0:00:20 677000 -- (-1421.263) [-1422.232] (-1422.626) (-1428.711) * [-1420.581] (-1420.280) (-1420.672) (-1423.147) -- 0:00:20 677500 -- (-1422.928) (-1421.752) (-1422.563) [-1424.976] * [-1420.194] (-1423.996) (-1420.952) (-1421.067) -- 0:00:20 678000 -- (-1424.532) (-1421.205) [-1420.629] (-1422.979) * (-1421.959) (-1423.871) [-1419.818] (-1421.049) -- 0:00:20 678500 -- (-1422.850) (-1419.876) [-1420.627] (-1422.975) * (-1421.496) (-1421.667) [-1419.954] (-1420.889) -- 0:00:20 679000 -- (-1424.650) (-1421.274) [-1419.839] (-1419.977) * [-1421.508] (-1421.887) (-1420.130) (-1426.130) -- 0:00:20 679500 -- (-1422.217) [-1421.225] (-1419.814) (-1419.519) * (-1423.566) (-1421.211) [-1420.679] (-1430.018) -- 0:00:20 680000 -- [-1423.467] (-1419.695) (-1424.471) (-1420.198) * (-1423.670) [-1420.396] (-1423.048) (-1422.978) -- 0:00:20 Average standard deviation of split frequencies: 0.008700 680500 -- [-1419.459] (-1422.941) (-1423.366) (-1421.123) * (-1425.390) [-1421.719] (-1423.095) (-1419.884) -- 0:00:20 681000 -- [-1421.199] (-1424.639) (-1420.771) (-1423.563) * (-1422.115) (-1422.377) [-1422.221] (-1421.140) -- 0:00:20 681500 -- (-1419.996) (-1420.772) [-1420.256] (-1425.036) * (-1422.554) (-1420.480) [-1420.504] (-1421.685) -- 0:00:20 682000 -- (-1420.996) (-1423.768) [-1419.673] (-1419.926) * (-1423.274) (-1421.021) (-1422.800) [-1421.680] -- 0:00:20 682500 -- (-1419.871) (-1425.876) [-1419.976] (-1419.326) * (-1426.734) (-1421.887) (-1421.996) [-1419.966] -- 0:00:20 683000 -- (-1419.905) (-1421.542) (-1419.686) [-1419.390] * (-1422.843) [-1419.781] (-1422.653) (-1421.519) -- 0:00:19 683500 -- [-1419.479] (-1420.368) (-1419.799) (-1419.495) * (-1421.411) (-1419.782) [-1426.411] (-1422.840) -- 0:00:19 684000 -- (-1422.548) [-1425.324] (-1420.553) (-1419.970) * (-1422.742) [-1422.021] (-1426.102) (-1425.362) -- 0:00:19 684500 -- [-1419.670] (-1421.188) (-1421.014) (-1420.646) * (-1421.174) (-1422.530) (-1425.715) [-1421.162] -- 0:00:19 685000 -- (-1419.452) (-1421.650) (-1420.316) [-1423.884] * [-1419.952] (-1420.872) (-1422.303) (-1422.409) -- 0:00:19 Average standard deviation of split frequencies: 0.008933 685500 -- [-1421.446] (-1423.419) (-1420.353) (-1422.899) * (-1422.491) [-1420.009] (-1419.787) (-1423.774) -- 0:00:19 686000 -- (-1421.524) (-1419.725) (-1420.019) [-1423.370] * [-1420.323] (-1422.239) (-1420.656) (-1423.637) -- 0:00:19 686500 -- (-1422.464) (-1419.998) [-1422.250] (-1422.122) * (-1424.331) (-1419.922) [-1420.845] (-1421.252) -- 0:00:19 687000 -- [-1421.916] (-1422.190) (-1423.026) (-1422.145) * (-1421.836) (-1422.542) [-1422.452] (-1424.581) -- 0:00:20 687500 -- (-1422.026) (-1423.359) [-1420.538] (-1422.010) * [-1419.897] (-1421.420) (-1422.688) (-1421.068) -- 0:00:20 688000 -- (-1422.745) (-1424.033) (-1422.869) [-1420.985] * [-1420.344] (-1422.046) (-1427.634) (-1421.556) -- 0:00:19 688500 -- (-1420.695) (-1422.155) (-1421.443) [-1421.418] * [-1419.875] (-1419.850) (-1425.964) (-1423.615) -- 0:00:19 689000 -- (-1421.444) (-1426.528) [-1427.405] (-1422.115) * (-1422.214) (-1420.315) (-1420.956) [-1420.494] -- 0:00:19 689500 -- (-1420.211) (-1421.829) (-1425.616) [-1423.924] * [-1421.981] (-1420.873) (-1421.148) (-1421.453) -- 0:00:19 690000 -- (-1420.211) [-1422.487] (-1422.899) (-1423.840) * (-1419.882) (-1420.490) (-1422.062) [-1422.715] -- 0:00:19 Average standard deviation of split frequencies: 0.009001 690500 -- (-1421.042) (-1421.550) (-1423.405) [-1421.888] * (-1421.783) [-1420.112] (-1420.740) (-1425.884) -- 0:00:19 691000 -- (-1421.404) (-1419.949) (-1419.851) [-1421.696] * (-1423.505) (-1422.448) (-1421.252) [-1423.953] -- 0:00:19 691500 -- (-1420.859) (-1421.928) (-1422.697) [-1420.890] * (-1423.456) [-1420.418] (-1422.803) (-1421.556) -- 0:00:19 692000 -- (-1420.982) (-1420.737) [-1421.287] (-1420.752) * (-1423.809) (-1420.671) [-1420.886] (-1420.623) -- 0:00:19 692500 -- (-1420.994) (-1425.036) [-1421.419] (-1423.634) * (-1423.656) (-1421.847) [-1421.998] (-1422.665) -- 0:00:19 693000 -- (-1419.891) (-1420.307) [-1419.664] (-1424.280) * (-1419.675) [-1421.155] (-1421.541) (-1420.415) -- 0:00:19 693500 -- (-1419.740) (-1419.835) (-1420.420) [-1421.444] * (-1421.803) [-1421.440] (-1420.316) (-1422.651) -- 0:00:19 694000 -- (-1427.107) [-1420.859] (-1421.173) (-1422.334) * (-1421.414) (-1421.396) (-1419.739) [-1420.951] -- 0:00:19 694500 -- (-1420.217) [-1424.830] (-1421.161) (-1421.713) * [-1422.229] (-1421.998) (-1422.636) (-1424.496) -- 0:00:19 695000 -- (-1421.623) [-1422.691] (-1421.197) (-1422.123) * (-1420.830) (-1423.448) [-1421.633] (-1423.666) -- 0:00:19 Average standard deviation of split frequencies: 0.009017 695500 -- (-1424.465) (-1421.507) (-1420.151) [-1421.222] * (-1423.876) [-1424.540] (-1422.368) (-1422.877) -- 0:00:19 696000 -- (-1423.798) [-1420.238] (-1422.380) (-1420.785) * [-1422.684] (-1419.596) (-1421.676) (-1419.835) -- 0:00:19 696500 -- (-1421.794) [-1423.353] (-1424.707) (-1420.909) * (-1426.003) (-1419.834) (-1424.242) [-1419.721] -- 0:00:19 697000 -- [-1423.529] (-1424.385) (-1423.751) (-1419.554) * (-1423.679) [-1421.794] (-1423.707) (-1420.147) -- 0:00:19 697500 -- (-1426.006) (-1424.179) [-1422.048] (-1428.066) * [-1421.874] (-1422.781) (-1424.640) (-1420.396) -- 0:00:19 698000 -- [-1423.651] (-1423.555) (-1419.897) (-1423.485) * (-1424.276) (-1422.968) [-1420.062] (-1421.243) -- 0:00:19 698500 -- (-1424.615) (-1421.267) (-1420.684) [-1421.399] * (-1421.970) [-1425.050] (-1421.862) (-1426.280) -- 0:00:18 699000 -- (-1424.015) (-1422.500) [-1424.632] (-1421.644) * (-1421.962) (-1420.771) (-1420.990) [-1420.514] -- 0:00:18 699500 -- (-1425.840) (-1420.630) (-1420.301) [-1421.959] * (-1421.130) (-1421.752) [-1419.864] (-1421.856) -- 0:00:18 700000 -- (-1424.256) [-1419.734] (-1420.819) (-1420.945) * (-1420.832) [-1421.609] (-1421.609) (-1419.212) -- 0:00:18 Average standard deviation of split frequencies: 0.009798 700500 -- (-1420.464) (-1419.930) [-1423.056] (-1420.904) * (-1419.725) (-1422.859) (-1420.507) [-1423.367] -- 0:00:18 701000 -- (-1421.242) (-1424.802) [-1421.309] (-1421.718) * (-1419.890) [-1423.014] (-1421.089) (-1423.358) -- 0:00:18 701500 -- [-1420.803] (-1423.931) (-1423.199) (-1422.229) * (-1421.980) [-1419.943] (-1427.984) (-1422.334) -- 0:00:18 702000 -- (-1420.772) [-1420.579] (-1422.776) (-1422.257) * (-1420.659) (-1419.935) [-1420.814] (-1424.191) -- 0:00:18 702500 -- (-1423.300) [-1421.186] (-1423.621) (-1421.551) * [-1419.889] (-1420.937) (-1420.670) (-1424.246) -- 0:00:18 703000 -- (-1423.017) (-1423.676) (-1422.179) [-1421.259] * (-1420.167) (-1423.892) [-1421.090] (-1424.242) -- 0:00:19 703500 -- (-1423.035) [-1421.393] (-1425.889) (-1421.305) * (-1420.774) (-1421.194) (-1423.256) [-1424.434] -- 0:00:18 704000 -- (-1420.173) (-1424.601) (-1421.175) [-1420.546] * [-1420.640] (-1425.075) (-1425.530) (-1419.559) -- 0:00:18 704500 -- [-1420.991] (-1424.029) (-1421.222) (-1419.517) * (-1419.577) [-1419.462] (-1423.043) (-1425.720) -- 0:00:18 705000 -- (-1420.505) (-1424.483) [-1420.505] (-1420.460) * [-1420.235] (-1420.945) (-1420.901) (-1423.676) -- 0:00:18 Average standard deviation of split frequencies: 0.009890 705500 -- (-1421.706) (-1420.564) [-1420.627] (-1422.628) * [-1420.088] (-1419.455) (-1421.364) (-1424.149) -- 0:00:18 706000 -- (-1424.439) (-1422.171) (-1421.353) [-1420.813] * (-1419.906) (-1421.393) [-1420.083] (-1423.462) -- 0:00:18 706500 -- [-1422.160] (-1423.346) (-1422.485) (-1421.372) * [-1419.706] (-1421.260) (-1420.786) (-1422.694) -- 0:00:18 707000 -- (-1421.044) [-1423.294] (-1421.507) (-1422.304) * (-1422.008) (-1422.741) [-1422.226] (-1422.024) -- 0:00:18 707500 -- (-1420.170) [-1422.043] (-1421.422) (-1426.822) * (-1422.175) (-1421.586) (-1421.977) [-1420.719] -- 0:00:18 708000 -- (-1419.734) [-1419.493] (-1420.278) (-1423.973) * (-1420.206) (-1420.133) [-1421.268] (-1422.220) -- 0:00:18 708500 -- (-1421.138) (-1423.418) [-1420.998] (-1420.803) * (-1420.561) (-1420.242) (-1428.200) [-1421.941] -- 0:00:18 709000 -- (-1423.214) (-1423.131) (-1420.572) [-1419.743] * (-1424.496) (-1420.191) [-1423.744] (-1421.057) -- 0:00:18 709500 -- (-1421.613) (-1421.854) (-1420.775) [-1420.144] * (-1421.833) [-1420.928] (-1419.936) (-1422.017) -- 0:00:18 710000 -- (-1422.211) (-1426.398) [-1419.685] (-1422.589) * (-1420.150) [-1420.243] (-1420.961) (-1421.534) -- 0:00:18 Average standard deviation of split frequencies: 0.009950 710500 -- (-1420.164) (-1424.624) (-1420.782) [-1419.887] * (-1421.041) (-1421.509) (-1419.871) [-1421.057] -- 0:00:18 711000 -- (-1420.766) (-1423.072) [-1421.294] (-1420.681) * (-1422.882) (-1424.534) [-1419.865] (-1420.981) -- 0:00:18 711500 -- (-1420.766) (-1420.252) [-1424.548] (-1423.245) * (-1425.848) (-1422.288) (-1420.334) [-1421.343] -- 0:00:18 712000 -- (-1420.729) (-1420.042) (-1422.599) [-1423.866] * (-1425.679) (-1423.568) [-1421.153] (-1420.949) -- 0:00:18 712500 -- (-1421.577) [-1420.166] (-1421.711) (-1423.271) * [-1420.853] (-1426.455) (-1419.809) (-1428.902) -- 0:00:18 713000 -- (-1421.223) [-1420.650] (-1424.685) (-1423.076) * (-1421.359) (-1422.478) (-1419.484) [-1419.776] -- 0:00:18 713500 -- [-1423.341] (-1420.128) (-1421.091) (-1420.967) * [-1423.171] (-1422.711) (-1422.554) (-1419.957) -- 0:00:18 714000 -- (-1420.924) [-1420.270] (-1422.227) (-1422.550) * (-1420.210) (-1420.427) (-1421.116) [-1419.458] -- 0:00:18 714500 -- (-1421.832) (-1423.544) [-1422.196] (-1420.291) * [-1421.638] (-1421.827) (-1420.095) (-1420.677) -- 0:00:17 715000 -- [-1421.460] (-1420.509) (-1420.814) (-1421.325) * (-1421.622) (-1420.873) (-1423.626) [-1420.751] -- 0:00:17 Average standard deviation of split frequencies: 0.009752 715500 -- (-1420.604) [-1421.562] (-1421.012) (-1421.606) * (-1423.016) (-1420.744) [-1423.008] (-1421.551) -- 0:00:17 716000 -- (-1422.588) (-1420.619) [-1420.044] (-1420.480) * [-1423.423] (-1419.329) (-1422.096) (-1424.092) -- 0:00:17 716500 -- [-1422.489] (-1421.056) (-1419.588) (-1420.936) * [-1423.723] (-1419.681) (-1421.342) (-1422.382) -- 0:00:17 717000 -- (-1421.704) (-1420.038) (-1420.865) [-1425.012] * (-1424.349) (-1425.587) (-1420.150) [-1427.886] -- 0:00:17 717500 -- [-1421.522] (-1419.562) (-1421.000) (-1420.229) * [-1420.452] (-1422.339) (-1424.880) (-1419.843) -- 0:00:17 718000 -- (-1422.505) [-1420.664] (-1421.618) (-1423.155) * (-1419.893) (-1419.656) [-1421.413] (-1419.328) -- 0:00:17 718500 -- (-1421.928) (-1420.435) (-1421.876) [-1421.022] * (-1425.955) [-1419.866] (-1421.747) (-1419.874) -- 0:00:17 719000 -- (-1419.956) [-1421.029] (-1423.913) (-1420.726) * (-1425.907) (-1423.408) [-1421.038] (-1422.150) -- 0:00:17 719500 -- (-1419.738) [-1420.390] (-1422.748) (-1424.925) * (-1424.168) (-1422.011) [-1420.466] (-1424.743) -- 0:00:17 720000 -- (-1421.846) [-1422.529] (-1428.886) (-1424.091) * (-1423.122) (-1422.134) [-1423.732] (-1427.132) -- 0:00:17 Average standard deviation of split frequencies: 0.009485 720500 -- (-1421.350) [-1420.340] (-1424.500) (-1421.032) * [-1420.634] (-1419.801) (-1421.033) (-1420.844) -- 0:00:17 721000 -- (-1422.886) [-1420.851] (-1423.198) (-1421.336) * (-1421.856) (-1422.693) [-1419.499] (-1422.007) -- 0:00:17 721500 -- (-1422.870) (-1422.462) (-1420.167) [-1421.878] * (-1421.196) (-1423.896) (-1421.722) [-1421.948] -- 0:00:17 722000 -- (-1420.627) (-1421.395) (-1422.437) [-1423.382] * (-1420.581) [-1420.425] (-1421.288) (-1422.612) -- 0:00:17 722500 -- (-1424.830) (-1421.391) [-1419.903] (-1422.879) * (-1420.162) (-1421.674) [-1424.113] (-1422.271) -- 0:00:17 723000 -- (-1420.036) (-1425.088) (-1420.508) [-1420.429] * (-1422.513) [-1420.412] (-1421.890) (-1421.359) -- 0:00:17 723500 -- (-1420.401) (-1421.682) [-1421.890] (-1421.673) * [-1423.363] (-1423.627) (-1424.056) (-1421.594) -- 0:00:17 724000 -- (-1420.423) (-1423.470) (-1422.528) [-1419.586] * (-1424.558) (-1421.275) (-1421.308) [-1421.712] -- 0:00:17 724500 -- (-1426.053) (-1424.683) (-1422.861) [-1421.116] * [-1421.352] (-1420.647) (-1421.982) (-1421.528) -- 0:00:17 725000 -- (-1422.572) (-1421.726) (-1422.152) [-1420.782] * (-1421.730) (-1420.678) (-1422.245) [-1427.191] -- 0:00:17 Average standard deviation of split frequencies: 0.009625 725500 -- (-1422.757) (-1421.740) (-1420.031) [-1419.701] * (-1421.313) [-1421.538] (-1423.315) (-1423.770) -- 0:00:17 726000 -- [-1422.975] (-1420.674) (-1420.373) (-1424.785) * (-1423.480) (-1420.828) (-1423.964) [-1423.758] -- 0:00:17 726500 -- (-1425.972) (-1420.838) (-1419.823) [-1420.263] * (-1424.137) (-1421.744) [-1423.512] (-1421.417) -- 0:00:17 727000 -- [-1420.574] (-1419.636) (-1420.547) (-1420.211) * (-1421.703) (-1420.290) (-1424.574) [-1422.204] -- 0:00:17 727500 -- (-1422.351) (-1421.130) (-1420.534) [-1419.979] * [-1422.582] (-1423.996) (-1420.536) (-1419.608) -- 0:00:17 728000 -- (-1421.237) (-1420.249) [-1420.691] (-1420.460) * (-1420.246) (-1423.448) [-1420.214] (-1420.481) -- 0:00:17 728500 -- [-1421.238] (-1421.439) (-1420.479) (-1425.551) * [-1421.831] (-1424.972) (-1423.238) (-1422.054) -- 0:00:17 729000 -- [-1422.393] (-1422.671) (-1421.931) (-1423.392) * (-1422.474) [-1424.862] (-1421.303) (-1423.835) -- 0:00:17 729500 -- (-1421.235) [-1420.673] (-1427.323) (-1421.552) * (-1419.744) (-1422.882) (-1419.769) [-1420.973] -- 0:00:17 730000 -- (-1424.247) (-1420.690) [-1426.748] (-1420.753) * (-1422.065) [-1420.442] (-1422.410) (-1421.385) -- 0:00:17 Average standard deviation of split frequencies: 0.010057 730500 -- (-1421.472) (-1420.916) (-1420.585) [-1421.296] * (-1421.235) (-1422.814) (-1423.595) [-1421.340] -- 0:00:16 731000 -- (-1421.626) (-1420.507) [-1419.954] (-1422.143) * [-1422.596] (-1421.085) (-1424.915) (-1423.821) -- 0:00:16 731500 -- (-1420.833) (-1420.518) [-1421.920] (-1420.912) * (-1420.908) (-1419.510) [-1420.162] (-1423.198) -- 0:00:16 732000 -- (-1422.615) (-1420.518) (-1422.714) [-1421.306] * (-1420.997) (-1420.155) (-1425.591) [-1422.087] -- 0:00:16 732500 -- (-1425.069) [-1421.091] (-1419.355) (-1422.893) * [-1420.238] (-1419.852) (-1424.223) (-1422.035) -- 0:00:16 733000 -- (-1421.400) (-1428.177) (-1420.430) [-1421.436] * (-1420.168) (-1422.672) [-1423.220] (-1419.757) -- 0:00:16 733500 -- (-1425.526) (-1424.750) [-1422.311] (-1427.028) * (-1422.613) (-1419.973) [-1424.421] (-1419.696) -- 0:00:16 734000 -- (-1421.234) (-1420.872) [-1423.856] (-1425.128) * (-1421.398) [-1422.316] (-1424.275) (-1421.608) -- 0:00:16 734500 -- [-1421.220] (-1425.209) (-1422.784) (-1424.075) * (-1421.882) (-1425.287) (-1421.209) [-1421.470] -- 0:00:16 735000 -- (-1420.976) (-1422.503) (-1423.841) [-1420.171] * (-1422.336) (-1419.888) (-1422.011) [-1421.356] -- 0:00:16 Average standard deviation of split frequencies: 0.010436 735500 -- (-1421.601) (-1423.664) [-1421.898] (-1419.929) * [-1420.655] (-1420.102) (-1424.521) (-1429.063) -- 0:00:16 736000 -- (-1420.075) (-1420.363) (-1423.261) [-1421.645] * (-1419.639) (-1420.235) (-1422.857) [-1421.696] -- 0:00:16 736500 -- (-1424.550) [-1419.890] (-1423.909) (-1420.000) * (-1427.663) (-1422.810) (-1421.809) [-1422.418] -- 0:00:16 737000 -- (-1424.289) (-1420.764) [-1420.903] (-1424.294) * (-1421.062) (-1421.799) [-1420.354] (-1422.551) -- 0:00:16 737500 -- (-1424.944) [-1428.545] (-1421.753) (-1422.272) * (-1425.346) (-1424.817) [-1419.498] (-1424.910) -- 0:00:16 738000 -- [-1424.151] (-1425.980) (-1426.676) (-1419.815) * (-1421.564) (-1425.177) (-1420.289) [-1423.476] -- 0:00:16 738500 -- (-1423.297) [-1421.791] (-1420.259) (-1424.753) * (-1419.873) (-1421.543) (-1421.731) [-1420.593] -- 0:00:16 739000 -- [-1423.630] (-1422.557) (-1422.150) (-1420.937) * (-1419.613) (-1421.166) [-1424.459] (-1419.568) -- 0:00:16 739500 -- (-1420.216) (-1422.709) [-1422.508] (-1420.199) * (-1424.804) [-1419.719] (-1422.520) (-1421.816) -- 0:00:16 740000 -- (-1421.102) [-1421.376] (-1420.845) (-1421.342) * (-1424.718) (-1422.178) [-1419.590] (-1419.477) -- 0:00:16 Average standard deviation of split frequencies: 0.010183 740500 -- [-1422.301] (-1420.690) (-1420.406) (-1420.376) * (-1424.190) (-1422.673) (-1420.826) [-1420.194] -- 0:00:16 741000 -- (-1421.892) (-1419.927) [-1421.754] (-1422.126) * (-1421.107) [-1421.424] (-1419.362) (-1422.500) -- 0:00:16 741500 -- (-1420.923) (-1427.094) (-1421.897) [-1422.722] * (-1422.112) [-1425.317] (-1425.453) (-1422.568) -- 0:00:16 742000 -- (-1422.702) [-1421.031] (-1421.584) (-1424.621) * [-1420.727] (-1419.469) (-1422.064) (-1420.299) -- 0:00:16 742500 -- [-1420.164] (-1421.454) (-1426.415) (-1425.567) * (-1421.331) [-1419.851] (-1422.022) (-1423.370) -- 0:00:16 743000 -- (-1423.860) [-1420.261] (-1426.946) (-1425.100) * [-1420.399] (-1419.805) (-1423.188) (-1420.766) -- 0:00:16 743500 -- (-1420.813) (-1427.503) [-1422.709] (-1425.703) * (-1423.130) (-1421.270) (-1423.195) [-1421.394] -- 0:00:16 744000 -- (-1422.190) (-1428.408) (-1427.784) [-1421.313] * [-1421.383] (-1427.267) (-1430.635) (-1421.909) -- 0:00:16 744500 -- (-1420.876) [-1421.124] (-1420.092) (-1422.886) * (-1422.012) (-1420.869) [-1422.299] (-1425.822) -- 0:00:16 745000 -- (-1421.025) [-1423.422] (-1420.680) (-1422.623) * (-1421.810) [-1420.881] (-1425.604) (-1421.955) -- 0:00:16 Average standard deviation of split frequencies: 0.009999 745500 -- (-1421.892) (-1423.137) [-1420.440] (-1419.855) * [-1420.438] (-1426.451) (-1421.201) (-1421.906) -- 0:00:16 746000 -- (-1421.903) [-1420.650] (-1421.645) (-1422.718) * [-1420.757] (-1422.400) (-1421.462) (-1421.020) -- 0:00:16 746500 -- (-1424.237) (-1420.718) [-1421.647] (-1420.748) * (-1420.891) (-1422.328) [-1422.488] (-1424.654) -- 0:00:15 747000 -- (-1422.014) (-1420.694) (-1420.473) [-1421.102] * (-1421.012) (-1426.927) [-1421.648] (-1423.135) -- 0:00:15 747500 -- [-1421.019] (-1422.226) (-1419.398) (-1421.136) * [-1420.488] (-1424.439) (-1426.713) (-1419.586) -- 0:00:15 748000 -- [-1421.620] (-1422.481) (-1421.371) (-1421.136) * [-1420.926] (-1423.779) (-1426.890) (-1420.178) -- 0:00:15 748500 -- [-1421.058] (-1422.745) (-1423.324) (-1424.321) * (-1423.992) [-1423.878] (-1425.393) (-1423.235) -- 0:00:15 749000 -- (-1423.692) [-1421.578] (-1420.112) (-1422.027) * (-1419.713) (-1425.279) [-1420.515] (-1422.410) -- 0:00:15 749500 -- [-1420.297] (-1421.450) (-1420.623) (-1421.010) * (-1419.381) [-1421.492] (-1421.748) (-1420.286) -- 0:00:15 750000 -- (-1421.641) [-1420.547] (-1421.119) (-1419.885) * (-1419.450) (-1421.614) (-1423.973) [-1419.486] -- 0:00:15 Average standard deviation of split frequencies: 0.010085 750500 -- (-1421.626) (-1421.505) [-1422.211] (-1419.724) * (-1423.188) [-1423.445] (-1422.742) (-1421.793) -- 0:00:15 751000 -- (-1423.442) (-1421.511) (-1421.119) [-1423.839] * (-1424.414) [-1421.035] (-1422.626) (-1422.240) -- 0:00:15 751500 -- (-1423.442) (-1422.776) [-1421.644] (-1420.083) * [-1419.792] (-1421.471) (-1421.560) (-1420.505) -- 0:00:15 752000 -- (-1421.607) [-1422.818] (-1419.714) (-1423.460) * [-1420.810] (-1422.274) (-1421.618) (-1420.692) -- 0:00:15 752500 -- (-1421.163) (-1420.588) [-1419.953] (-1422.506) * [-1422.319] (-1422.286) (-1421.485) (-1420.090) -- 0:00:15 753000 -- [-1420.667] (-1422.551) (-1421.423) (-1419.751) * (-1420.211) (-1421.321) (-1422.135) [-1419.623] -- 0:00:15 753500 -- (-1420.289) (-1421.975) (-1425.950) [-1420.063] * (-1420.119) [-1420.487] (-1420.447) (-1422.844) -- 0:00:15 754000 -- [-1420.471] (-1421.697) (-1423.425) (-1422.677) * [-1420.062] (-1420.117) (-1420.449) (-1428.057) -- 0:00:15 754500 -- (-1422.747) [-1421.322] (-1422.884) (-1425.229) * (-1420.667) [-1421.188] (-1420.488) (-1421.679) -- 0:00:15 755000 -- (-1421.752) (-1421.943) [-1419.983] (-1422.692) * (-1425.015) [-1421.929] (-1420.962) (-1420.089) -- 0:00:15 Average standard deviation of split frequencies: 0.010087 755500 -- (-1423.216) (-1423.727) [-1423.515] (-1421.600) * (-1422.030) (-1422.811) (-1419.793) [-1420.492] -- 0:00:15 756000 -- (-1421.951) (-1423.077) (-1423.496) [-1423.075] * (-1420.544) [-1421.327] (-1420.034) (-1424.304) -- 0:00:15 756500 -- [-1421.292] (-1427.869) (-1419.981) (-1422.677) * (-1420.648) [-1420.245] (-1419.406) (-1421.211) -- 0:00:15 757000 -- (-1423.214) [-1424.669] (-1420.078) (-1422.009) * (-1421.052) [-1420.755] (-1421.978) (-1423.692) -- 0:00:15 757500 -- (-1421.470) (-1423.733) (-1421.872) [-1420.269] * (-1424.203) (-1420.875) [-1420.498] (-1423.020) -- 0:00:15 758000 -- [-1421.318] (-1422.779) (-1419.826) (-1422.113) * (-1420.943) (-1421.387) (-1419.744) [-1420.520] -- 0:00:15 758500 -- [-1422.188] (-1424.412) (-1420.153) (-1420.555) * (-1421.583) (-1421.939) (-1421.094) [-1419.815] -- 0:00:15 759000 -- [-1421.861] (-1421.360) (-1427.108) (-1422.716) * (-1421.575) (-1422.126) (-1422.038) [-1420.268] -- 0:00:15 759500 -- (-1420.682) [-1422.437] (-1424.872) (-1423.412) * (-1421.168) (-1420.219) (-1426.615) [-1422.049] -- 0:00:15 760000 -- (-1420.747) (-1421.625) [-1423.832] (-1421.240) * (-1425.043) [-1421.477] (-1420.680) (-1430.356) -- 0:00:15 Average standard deviation of split frequencies: 0.009952 760500 -- (-1421.625) (-1423.191) (-1424.040) [-1421.449] * (-1422.092) [-1422.550] (-1424.373) (-1424.922) -- 0:00:15 761000 -- (-1422.374) (-1423.665) (-1423.191) [-1421.021] * [-1419.346] (-1419.901) (-1426.692) (-1423.999) -- 0:00:15 761500 -- (-1419.334) (-1420.606) (-1426.302) [-1421.312] * (-1420.965) (-1419.916) (-1427.694) [-1423.035] -- 0:00:15 762000 -- (-1421.774) [-1421.487] (-1423.253) (-1422.533) * (-1421.956) [-1426.531] (-1425.165) (-1420.836) -- 0:00:14 762500 -- (-1423.352) (-1421.956) [-1419.432] (-1422.350) * [-1421.631] (-1426.883) (-1426.258) (-1420.506) -- 0:00:14 763000 -- (-1421.730) (-1421.214) [-1425.820] (-1424.402) * (-1422.351) (-1420.045) [-1421.341] (-1423.842) -- 0:00:14 763500 -- [-1421.984] (-1420.781) (-1425.891) (-1420.542) * (-1423.240) (-1421.314) [-1420.059] (-1421.683) -- 0:00:14 764000 -- (-1422.143) [-1423.006] (-1426.383) (-1422.096) * (-1419.791) [-1420.087] (-1419.167) (-1421.135) -- 0:00:14 764500 -- (-1422.021) [-1422.894] (-1424.507) (-1420.480) * (-1425.354) (-1421.831) (-1421.256) [-1419.570] -- 0:00:14 765000 -- (-1423.273) (-1420.712) [-1420.762] (-1424.887) * [-1424.364] (-1422.011) (-1421.449) (-1423.431) -- 0:00:14 Average standard deviation of split frequencies: 0.009702 765500 -- [-1421.330] (-1424.895) (-1421.219) (-1426.322) * (-1425.956) (-1423.288) (-1422.193) [-1420.687] -- 0:00:14 766000 -- (-1422.190) [-1420.730] (-1419.798) (-1423.969) * (-1422.025) [-1419.179] (-1422.264) (-1422.281) -- 0:00:14 766500 -- (-1420.719) (-1420.565) (-1422.506) [-1419.855] * (-1423.331) [-1419.232] (-1423.669) (-1420.474) -- 0:00:14 767000 -- [-1424.001] (-1427.645) (-1421.086) (-1423.862) * [-1420.479] (-1420.181) (-1424.721) (-1422.301) -- 0:00:14 767500 -- [-1422.143] (-1422.568) (-1422.900) (-1425.064) * (-1422.873) (-1420.262) [-1421.937] (-1421.695) -- 0:00:14 768000 -- (-1419.883) (-1422.982) [-1420.469] (-1424.203) * (-1419.570) (-1420.971) [-1421.226] (-1422.614) -- 0:00:14 768500 -- [-1419.551] (-1422.733) (-1420.657) (-1421.601) * (-1419.899) (-1422.425) (-1420.540) [-1424.213] -- 0:00:14 769000 -- (-1419.340) (-1422.516) [-1419.446] (-1422.588) * (-1419.987) (-1421.230) (-1421.269) [-1425.287] -- 0:00:14 769500 -- (-1420.954) (-1422.105) (-1423.299) [-1422.128] * (-1424.390) (-1420.962) (-1422.060) [-1419.341] -- 0:00:14 770000 -- (-1421.665) (-1425.081) (-1420.887) [-1419.217] * (-1421.241) (-1421.453) [-1421.682] (-1424.362) -- 0:00:14 Average standard deviation of split frequencies: 0.010003 770500 -- (-1427.864) [-1423.066] (-1422.223) (-1423.837) * [-1420.217] (-1421.369) (-1423.589) (-1423.731) -- 0:00:14 771000 -- (-1424.117) [-1421.735] (-1424.050) (-1423.771) * (-1421.543) [-1421.372] (-1419.635) (-1421.476) -- 0:00:14 771500 -- (-1426.313) (-1420.786) (-1422.274) [-1422.700] * (-1426.167) (-1420.540) [-1421.407] (-1423.134) -- 0:00:14 772000 -- (-1420.811) [-1420.718] (-1420.419) (-1420.955) * (-1423.067) (-1422.587) [-1420.432] (-1421.395) -- 0:00:14 772500 -- [-1419.683] (-1421.797) (-1420.765) (-1421.606) * (-1419.933) (-1420.598) (-1420.333) [-1422.539] -- 0:00:14 773000 -- [-1420.558] (-1422.729) (-1419.981) (-1423.743) * (-1420.869) (-1426.719) [-1420.023] (-1419.595) -- 0:00:14 773500 -- [-1420.349] (-1420.442) (-1420.619) (-1419.771) * [-1421.619] (-1421.088) (-1419.551) (-1420.901) -- 0:00:14 774000 -- (-1423.028) [-1421.487] (-1422.775) (-1421.173) * (-1424.995) (-1427.673) (-1419.831) [-1421.061] -- 0:00:14 774500 -- (-1423.679) [-1420.394] (-1419.787) (-1421.134) * [-1422.787] (-1422.807) (-1420.849) (-1425.359) -- 0:00:14 775000 -- (-1423.626) [-1419.866] (-1422.606) (-1421.092) * (-1420.094) [-1419.415] (-1421.299) (-1420.537) -- 0:00:14 Average standard deviation of split frequencies: 0.009827 775500 -- (-1422.347) [-1420.589] (-1421.839) (-1421.101) * (-1423.853) [-1420.307] (-1421.120) (-1420.232) -- 0:00:14 776000 -- (-1421.536) (-1422.934) (-1421.681) [-1424.506] * [-1422.124] (-1421.120) (-1421.702) (-1420.530) -- 0:00:14 776500 -- (-1426.221) [-1420.033] (-1422.544) (-1420.600) * (-1424.261) (-1423.198) (-1421.776) [-1422.284] -- 0:00:14 777000 -- (-1421.562) (-1424.045) [-1422.427] (-1420.093) * [-1422.520] (-1422.387) (-1420.707) (-1421.635) -- 0:00:14 777500 -- (-1420.211) (-1423.043) (-1421.397) [-1421.053] * [-1420.549] (-1423.778) (-1419.221) (-1436.703) -- 0:00:14 778000 -- [-1419.740] (-1422.581) (-1421.549) (-1421.277) * (-1421.956) (-1426.111) (-1420.359) [-1424.550] -- 0:00:13 778500 -- (-1420.239) [-1420.751] (-1428.122) (-1422.461) * (-1423.061) (-1425.385) [-1420.597] (-1423.069) -- 0:00:13 779000 -- (-1419.376) (-1425.296) [-1420.965] (-1424.433) * [-1424.047] (-1421.367) (-1422.049) (-1425.199) -- 0:00:13 779500 -- (-1419.578) [-1420.942] (-1422.651) (-1420.913) * (-1424.359) (-1426.102) [-1420.447] (-1422.654) -- 0:00:13 780000 -- [-1420.131] (-1423.570) (-1427.873) (-1421.849) * (-1422.479) (-1427.699) [-1420.755] (-1421.870) -- 0:00:13 Average standard deviation of split frequencies: 0.009697 780500 -- (-1420.926) (-1422.543) (-1420.699) [-1421.689] * (-1423.506) (-1426.287) (-1420.400) [-1419.696] -- 0:00:13 781000 -- [-1420.693] (-1420.257) (-1420.788) (-1420.661) * (-1421.038) (-1421.346) (-1422.109) [-1419.398] -- 0:00:13 781500 -- [-1423.297] (-1420.101) (-1423.608) (-1421.810) * (-1420.153) [-1420.524] (-1420.950) (-1422.225) -- 0:00:13 782000 -- [-1420.290] (-1420.860) (-1421.771) (-1421.706) * (-1420.579) (-1422.343) [-1422.961] (-1422.183) -- 0:00:13 782500 -- [-1422.606] (-1420.967) (-1419.731) (-1423.624) * (-1420.663) [-1422.041] (-1423.883) (-1420.820) -- 0:00:13 783000 -- (-1423.039) (-1420.560) [-1420.043] (-1420.032) * (-1427.434) (-1421.583) [-1421.227] (-1420.524) -- 0:00:13 783500 -- (-1424.401) [-1419.941] (-1420.632) (-1423.731) * (-1425.371) (-1423.967) (-1421.013) [-1420.150] -- 0:00:13 784000 -- (-1420.628) [-1419.731] (-1420.421) (-1420.351) * (-1423.954) [-1419.437] (-1420.349) (-1420.151) -- 0:00:13 784500 -- (-1419.530) [-1421.342] (-1420.718) (-1420.520) * (-1424.936) [-1419.228] (-1421.208) (-1421.171) -- 0:00:13 785000 -- (-1421.451) (-1420.147) (-1419.926) [-1423.811] * (-1424.301) [-1421.295] (-1420.473) (-1421.704) -- 0:00:13 Average standard deviation of split frequencies: 0.009279 785500 -- (-1420.072) (-1423.072) [-1420.510] (-1420.720) * (-1421.136) (-1424.750) [-1422.014] (-1421.774) -- 0:00:13 786000 -- [-1420.739] (-1420.394) (-1420.474) (-1421.722) * [-1421.034] (-1420.839) (-1422.923) (-1423.309) -- 0:00:13 786500 -- (-1421.969) (-1420.403) (-1420.487) [-1422.288] * (-1420.678) (-1421.570) (-1422.480) [-1422.197] -- 0:00:13 787000 -- [-1421.788] (-1422.147) (-1419.740) (-1421.508) * (-1421.103) (-1422.589) [-1425.198] (-1423.627) -- 0:00:13 787500 -- (-1421.654) (-1420.396) [-1421.000] (-1421.597) * [-1422.754] (-1419.507) (-1420.574) (-1423.330) -- 0:00:13 788000 -- [-1421.664] (-1422.196) (-1421.820) (-1423.405) * (-1423.230) (-1419.391) [-1421.278] (-1422.263) -- 0:00:13 788500 -- [-1420.261] (-1420.393) (-1420.339) (-1420.340) * (-1423.448) [-1420.832] (-1423.667) (-1425.638) -- 0:00:13 789000 -- (-1421.313) [-1420.189] (-1423.278) (-1420.149) * (-1420.544) (-1420.740) (-1420.804) [-1420.048] -- 0:00:13 789500 -- (-1420.203) [-1421.253] (-1420.484) (-1420.500) * (-1422.306) (-1420.140) [-1421.332] (-1422.310) -- 0:00:13 790000 -- (-1421.143) [-1420.114] (-1422.554) (-1420.021) * [-1421.819] (-1422.235) (-1419.967) (-1423.537) -- 0:00:13 Average standard deviation of split frequencies: 0.009048 790500 -- (-1421.446) [-1420.721] (-1424.771) (-1421.050) * [-1421.053] (-1422.990) (-1419.730) (-1421.856) -- 0:00:13 791000 -- (-1419.570) (-1420.139) [-1422.180] (-1424.376) * (-1421.279) [-1420.513] (-1420.261) (-1420.912) -- 0:00:13 791500 -- (-1420.371) (-1419.628) (-1420.900) [-1420.036] * [-1423.749] (-1420.299) (-1420.782) (-1420.801) -- 0:00:13 792000 -- (-1419.508) (-1421.452) [-1427.407] (-1420.171) * [-1421.952] (-1421.537) (-1420.337) (-1421.919) -- 0:00:13 792500 -- (-1419.635) [-1421.660] (-1423.878) (-1421.533) * (-1422.623) (-1421.380) (-1420.568) [-1423.632] -- 0:00:13 793000 -- [-1420.869] (-1423.055) (-1422.981) (-1428.059) * (-1424.908) [-1422.274] (-1423.517) (-1420.782) -- 0:00:13 793500 -- [-1420.177] (-1422.529) (-1421.705) (-1426.258) * [-1421.829] (-1420.746) (-1422.142) (-1420.668) -- 0:00:13 794000 -- (-1419.558) [-1419.517] (-1420.823) (-1422.050) * (-1420.003) (-1422.241) (-1423.255) [-1421.070] -- 0:00:12 794500 -- (-1424.106) (-1419.465) (-1423.606) [-1422.756] * [-1423.229] (-1422.285) (-1422.792) (-1421.764) -- 0:00:12 795000 -- (-1425.453) (-1422.635) (-1421.325) [-1421.072] * [-1423.891] (-1423.518) (-1425.404) (-1423.579) -- 0:00:12 Average standard deviation of split frequencies: 0.008587 795500 -- (-1423.656) [-1422.130] (-1420.687) (-1421.874) * (-1423.810) [-1420.172] (-1428.078) (-1419.834) -- 0:00:12 796000 -- (-1422.357) [-1421.319] (-1422.863) (-1423.813) * [-1422.579] (-1423.757) (-1423.894) (-1419.940) -- 0:00:12 796500 -- (-1422.638) (-1422.048) [-1421.962] (-1420.037) * [-1424.608] (-1422.793) (-1421.375) (-1420.968) -- 0:00:12 797000 -- (-1420.958) (-1428.146) [-1421.265] (-1422.034) * (-1421.555) (-1422.442) (-1422.799) [-1423.333] -- 0:00:12 797500 -- [-1421.517] (-1421.901) (-1420.470) (-1424.402) * (-1420.997) (-1427.045) (-1420.903) [-1421.159] -- 0:00:12 798000 -- (-1420.171) (-1422.523) [-1420.447] (-1425.860) * (-1425.123) (-1421.345) [-1422.847] (-1420.872) -- 0:00:12 798500 -- (-1420.235) (-1420.739) (-1422.140) [-1421.655] * (-1426.637) [-1421.432] (-1420.698) (-1421.320) -- 0:00:12 799000 -- (-1419.776) (-1422.393) [-1421.608] (-1424.143) * [-1419.563] (-1421.264) (-1423.689) (-1420.864) -- 0:00:12 799500 -- (-1421.516) (-1420.113) (-1424.638) [-1422.348] * (-1420.972) [-1420.933] (-1420.065) (-1421.794) -- 0:00:12 800000 -- (-1423.779) [-1419.700] (-1423.080) (-1424.037) * (-1420.829) (-1421.919) (-1422.857) [-1421.548] -- 0:00:12 Average standard deviation of split frequencies: 0.008463 800500 -- [-1424.207] (-1420.712) (-1422.850) (-1423.543) * (-1422.653) (-1419.891) [-1420.301] (-1421.381) -- 0:00:12 801000 -- (-1423.615) (-1419.945) [-1422.967] (-1422.354) * (-1421.959) [-1421.731] (-1420.549) (-1423.760) -- 0:00:12 801500 -- (-1421.275) (-1419.945) (-1428.664) [-1419.633] * (-1421.600) (-1424.138) [-1423.514] (-1420.098) -- 0:00:12 802000 -- (-1422.053) [-1423.283] (-1420.031) (-1421.254) * (-1422.155) (-1420.140) (-1423.939) [-1420.506] -- 0:00:12 802500 -- (-1421.700) (-1422.816) (-1419.608) [-1419.861] * (-1426.880) (-1420.102) (-1424.398) [-1421.809] -- 0:00:12 803000 -- (-1420.567) (-1422.396) [-1420.871] (-1420.525) * (-1421.278) (-1419.940) [-1422.981] (-1426.237) -- 0:00:12 803500 -- (-1419.673) (-1424.702) [-1423.297] (-1423.322) * (-1422.394) [-1422.991] (-1426.113) (-1426.281) -- 0:00:12 804000 -- (-1421.468) [-1422.324] (-1422.824) (-1421.718) * [-1419.890] (-1421.391) (-1425.438) (-1419.999) -- 0:00:12 804500 -- [-1420.780] (-1421.925) (-1426.135) (-1419.972) * (-1419.405) (-1421.396) [-1423.217] (-1420.776) -- 0:00:12 805000 -- (-1421.950) (-1420.977) [-1422.770] (-1420.775) * (-1424.193) (-1421.319) (-1419.720) [-1421.231] -- 0:00:12 Average standard deviation of split frequencies: 0.008846 805500 -- (-1421.402) (-1422.113) [-1423.978] (-1420.233) * (-1421.634) (-1419.955) [-1420.044] (-1421.480) -- 0:00:12 806000 -- (-1420.153) (-1422.040) [-1422.796] (-1423.484) * (-1419.982) (-1422.611) [-1420.167] (-1420.439) -- 0:00:12 806500 -- (-1425.177) (-1420.276) (-1423.026) [-1419.807] * (-1421.103) (-1422.741) [-1420.060] (-1427.214) -- 0:00:12 807000 -- [-1421.325] (-1420.713) (-1421.775) (-1420.141) * (-1421.176) (-1421.790) (-1420.259) [-1422.041] -- 0:00:12 807500 -- (-1423.095) [-1420.286] (-1421.730) (-1421.076) * (-1423.176) (-1421.551) [-1421.239] (-1420.165) -- 0:00:12 808000 -- (-1420.146) (-1420.283) [-1419.826] (-1420.216) * (-1424.396) (-1422.853) (-1422.424) [-1421.097] -- 0:00:12 808500 -- (-1421.089) (-1426.010) [-1419.885] (-1421.317) * (-1424.876) [-1422.131] (-1422.433) (-1421.608) -- 0:00:12 809000 -- (-1424.073) (-1423.938) (-1421.320) [-1423.502] * (-1422.040) (-1421.374) (-1420.575) [-1422.899] -- 0:00:12 809500 -- (-1421.225) (-1422.467) [-1419.902] (-1422.930) * (-1420.514) (-1423.772) [-1420.169] (-1422.888) -- 0:00:12 810000 -- (-1419.551) (-1422.800) [-1421.146] (-1424.256) * (-1425.939) (-1422.373) (-1421.044) [-1420.139] -- 0:00:11 Average standard deviation of split frequencies: 0.008759 810500 -- (-1419.551) [-1421.028] (-1421.143) (-1421.335) * (-1420.773) (-1419.277) [-1422.632] (-1421.337) -- 0:00:11 811000 -- (-1419.627) (-1420.846) [-1419.830] (-1421.678) * (-1424.406) (-1420.429) (-1420.655) [-1421.015] -- 0:00:11 811500 -- (-1420.608) (-1422.375) (-1420.366) [-1421.314] * (-1421.277) [-1424.787] (-1423.474) (-1419.557) -- 0:00:11 812000 -- (-1420.005) (-1420.985) (-1424.043) [-1423.958] * (-1419.587) [-1420.187] (-1421.366) (-1420.678) -- 0:00:11 812500 -- (-1420.603) (-1420.670) (-1420.425) [-1420.624] * (-1420.075) (-1421.686) (-1420.407) [-1421.472] -- 0:00:11 813000 -- (-1423.061) [-1420.163] (-1420.839) (-1420.154) * [-1420.196] (-1422.308) (-1420.737) (-1423.952) -- 0:00:11 813500 -- (-1423.923) (-1420.240) [-1421.953] (-1420.767) * (-1421.871) (-1420.654) (-1421.868) [-1425.968] -- 0:00:11 814000 -- (-1421.854) (-1419.254) (-1420.826) [-1422.013] * (-1422.201) (-1422.325) [-1421.803] (-1420.702) -- 0:00:11 814500 -- [-1423.121] (-1420.524) (-1422.677) (-1423.574) * [-1419.481] (-1422.511) (-1421.647) (-1421.157) -- 0:00:11 815000 -- [-1424.540] (-1421.066) (-1422.549) (-1419.975) * (-1422.502) (-1424.208) (-1422.495) [-1420.320] -- 0:00:11 Average standard deviation of split frequencies: 0.009171 815500 -- (-1424.586) (-1421.670) (-1422.181) [-1422.352] * (-1422.203) (-1420.702) (-1421.372) [-1422.663] -- 0:00:11 816000 -- [-1424.262] (-1423.186) (-1421.569) (-1420.393) * (-1422.904) (-1421.888) (-1420.330) [-1420.554] -- 0:00:11 816500 -- (-1425.726) (-1421.452) (-1422.761) [-1422.417] * [-1422.187] (-1423.224) (-1420.962) (-1421.614) -- 0:00:11 817000 -- (-1421.476) (-1422.265) [-1421.155] (-1419.881) * (-1421.776) (-1420.807) (-1419.820) [-1421.049] -- 0:00:11 817500 -- (-1423.539) [-1420.884] (-1419.994) (-1420.617) * (-1421.682) (-1425.397) [-1419.187] (-1421.061) -- 0:00:11 818000 -- [-1420.382] (-1425.168) (-1424.170) (-1420.481) * (-1423.403) (-1420.503) (-1422.448) [-1421.003] -- 0:00:11 818500 -- (-1420.060) (-1425.557) [-1420.930] (-1420.104) * (-1421.666) (-1422.262) [-1419.355] (-1423.645) -- 0:00:11 819000 -- (-1421.608) [-1421.692] (-1421.388) (-1420.266) * (-1420.490) (-1421.580) (-1419.369) [-1421.115] -- 0:00:11 819500 -- (-1421.378) [-1419.538] (-1422.658) (-1421.908) * (-1423.562) (-1420.192) (-1419.339) [-1422.193] -- 0:00:11 820000 -- [-1421.558] (-1419.949) (-1424.937) (-1421.472) * (-1423.610) (-1420.134) [-1423.128] (-1419.423) -- 0:00:11 Average standard deviation of split frequencies: 0.009630 820500 -- (-1421.644) [-1421.893] (-1421.103) (-1422.923) * (-1424.751) (-1421.618) (-1425.221) [-1419.884] -- 0:00:11 821000 -- (-1420.559) (-1422.507) [-1423.650] (-1422.147) * (-1420.958) (-1420.375) [-1420.897] (-1421.357) -- 0:00:11 821500 -- (-1423.088) (-1423.433) [-1422.402] (-1420.456) * [-1420.496] (-1422.110) (-1425.457) (-1420.248) -- 0:00:11 822000 -- (-1423.035) (-1420.354) [-1421.343] (-1422.498) * [-1421.537] (-1421.797) (-1421.845) (-1421.442) -- 0:00:11 822500 -- [-1421.466] (-1420.336) (-1423.289) (-1421.457) * (-1421.497) [-1420.901] (-1420.530) (-1421.930) -- 0:00:11 823000 -- (-1422.970) [-1420.968] (-1422.497) (-1421.931) * [-1419.934] (-1423.802) (-1423.042) (-1421.643) -- 0:00:11 823500 -- (-1424.099) [-1420.764] (-1421.075) (-1421.392) * (-1420.895) (-1422.189) (-1419.315) [-1422.771] -- 0:00:11 824000 -- (-1425.320) (-1421.652) [-1422.240] (-1420.274) * [-1420.268] (-1425.834) (-1421.126) (-1421.612) -- 0:00:11 824500 -- (-1421.878) [-1421.290] (-1422.020) (-1420.014) * (-1423.615) (-1420.118) (-1420.681) [-1422.015] -- 0:00:11 825000 -- (-1421.102) [-1422.211] (-1419.592) (-1424.263) * (-1423.540) [-1420.579] (-1421.472) (-1420.916) -- 0:00:11 Average standard deviation of split frequencies: 0.009769 825500 -- [-1424.799] (-1421.655) (-1419.780) (-1424.005) * (-1420.210) (-1420.411) (-1424.865) [-1420.538] -- 0:00:10 826000 -- (-1423.219) (-1423.073) [-1421.234] (-1420.179) * (-1420.892) [-1419.857] (-1422.442) (-1420.430) -- 0:00:10 826500 -- (-1425.623) (-1422.428) (-1422.037) [-1419.719] * [-1423.333] (-1420.172) (-1424.148) (-1423.452) -- 0:00:10 827000 -- [-1421.090] (-1422.390) (-1421.867) (-1421.375) * (-1422.237) (-1419.819) (-1422.047) [-1424.435] -- 0:00:10 827500 -- (-1420.486) (-1420.976) [-1420.207] (-1422.242) * [-1422.399] (-1420.928) (-1422.653) (-1422.660) -- 0:00:10 828000 -- [-1421.417] (-1420.948) (-1422.722) (-1424.579) * (-1423.637) (-1421.740) (-1424.924) [-1420.179] -- 0:00:10 828500 -- (-1426.424) [-1419.952] (-1420.928) (-1424.061) * (-1428.098) (-1419.928) (-1421.811) [-1420.245] -- 0:00:10 829000 -- (-1422.440) (-1420.208) [-1422.674] (-1422.405) * (-1425.936) [-1419.921] (-1422.043) (-1428.351) -- 0:00:10 829500 -- (-1424.599) (-1421.772) (-1422.645) [-1423.106] * [-1419.617] (-1420.910) (-1421.470) (-1421.735) -- 0:00:10 830000 -- (-1423.728) (-1425.478) [-1420.226] (-1421.342) * [-1422.951] (-1423.733) (-1421.834) (-1425.131) -- 0:00:10 Average standard deviation of split frequencies: 0.010081 830500 -- (-1422.573) [-1420.137] (-1420.699) (-1419.970) * [-1422.487] (-1424.262) (-1421.038) (-1421.729) -- 0:00:10 831000 -- (-1420.362) [-1422.078] (-1421.103) (-1422.838) * (-1421.776) [-1421.714] (-1422.854) (-1420.748) -- 0:00:10 831500 -- (-1420.910) [-1419.668] (-1421.085) (-1421.622) * (-1419.933) [-1420.344] (-1424.909) (-1423.024) -- 0:00:10 832000 -- (-1420.845) (-1423.697) (-1420.622) [-1420.995] * [-1421.941] (-1421.419) (-1429.698) (-1420.681) -- 0:00:10 832500 -- (-1422.904) (-1425.221) [-1422.050] (-1421.576) * (-1421.603) (-1424.007) (-1425.848) [-1419.361] -- 0:00:10 833000 -- (-1423.906) (-1420.109) [-1422.593] (-1421.376) * [-1420.548] (-1424.713) (-1425.878) (-1419.390) -- 0:00:10 833500 -- (-1422.903) (-1420.110) [-1420.669] (-1421.327) * [-1421.072] (-1421.800) (-1423.887) (-1421.810) -- 0:00:10 834000 -- [-1421.223] (-1424.176) (-1425.207) (-1421.373) * (-1421.375) (-1422.529) (-1422.877) [-1421.145] -- 0:00:10 834500 -- (-1425.219) (-1419.301) [-1422.707] (-1419.723) * (-1420.427) (-1423.253) (-1420.986) [-1420.143] -- 0:00:10 835000 -- [-1420.926] (-1419.360) (-1421.491) (-1419.626) * (-1423.660) (-1422.710) (-1421.361) [-1421.150] -- 0:00:10 Average standard deviation of split frequencies: 0.010382 835500 -- [-1423.214] (-1420.210) (-1420.796) (-1420.159) * (-1420.972) (-1420.981) (-1420.441) [-1422.877] -- 0:00:10 836000 -- (-1422.850) [-1420.149] (-1420.354) (-1421.340) * (-1420.581) [-1420.720] (-1422.566) (-1420.231) -- 0:00:10 836500 -- (-1426.742) (-1422.572) [-1419.120] (-1422.410) * (-1420.433) (-1423.335) [-1422.135] (-1420.982) -- 0:00:10 837000 -- [-1420.073] (-1426.378) (-1419.917) (-1421.200) * (-1423.696) (-1422.851) (-1422.902) [-1420.209] -- 0:00:10 837500 -- (-1424.046) (-1421.836) [-1419.919] (-1420.256) * [-1420.385] (-1423.545) (-1420.153) (-1420.495) -- 0:00:10 838000 -- (-1421.175) (-1423.417) [-1421.598] (-1423.441) * [-1422.304] (-1421.142) (-1423.546) (-1420.166) -- 0:00:10 838500 -- [-1420.792] (-1426.127) (-1420.629) (-1420.798) * (-1420.443) (-1422.727) (-1423.878) [-1423.917] -- 0:00:10 839000 -- [-1420.213] (-1420.987) (-1423.088) (-1422.080) * [-1420.490] (-1423.163) (-1423.372) (-1427.453) -- 0:00:10 839500 -- [-1420.913] (-1420.345) (-1424.157) (-1419.970) * (-1421.640) (-1420.779) (-1420.439) [-1426.119] -- 0:00:10 840000 -- (-1423.558) [-1420.607] (-1430.098) (-1421.287) * (-1419.698) [-1421.920] (-1421.432) (-1421.799) -- 0:00:10 Average standard deviation of split frequencies: 0.010489 840500 -- [-1421.495] (-1424.304) (-1420.531) (-1420.737) * (-1420.363) (-1420.543) [-1420.030] (-1423.315) -- 0:00:10 841000 -- [-1420.616] (-1425.668) (-1421.681) (-1423.741) * (-1421.906) (-1419.686) [-1424.970] (-1422.146) -- 0:00:10 841500 -- (-1421.973) (-1422.824) (-1421.668) [-1424.692] * [-1421.590] (-1425.536) (-1424.709) (-1420.363) -- 0:00:09 842000 -- (-1419.996) (-1421.082) [-1422.821] (-1422.108) * [-1424.008] (-1421.273) (-1421.739) (-1423.331) -- 0:00:09 842500 -- (-1420.776) (-1423.401) (-1421.494) [-1420.688] * (-1419.439) (-1424.193) [-1419.906] (-1425.211) -- 0:00:09 843000 -- [-1422.975] (-1420.573) (-1422.392) (-1420.891) * (-1420.261) (-1420.940) (-1423.409) [-1420.231] -- 0:00:09 843500 -- (-1422.219) (-1423.266) [-1422.228] (-1421.684) * (-1421.445) [-1421.283] (-1427.417) (-1420.282) -- 0:00:09 844000 -- (-1419.612) (-1423.367) [-1422.393] (-1421.769) * (-1422.983) [-1419.545] (-1420.683) (-1421.165) -- 0:00:09 844500 -- [-1419.675] (-1421.550) (-1421.771) (-1422.381) * (-1422.622) (-1419.687) (-1419.580) [-1421.291] -- 0:00:09 845000 -- (-1422.047) (-1420.003) [-1421.527] (-1420.752) * (-1423.107) (-1420.621) [-1419.707] (-1421.883) -- 0:00:09 Average standard deviation of split frequencies: 0.010620 845500 -- [-1421.498] (-1424.366) (-1420.332) (-1419.836) * [-1420.320] (-1420.399) (-1420.688) (-1421.352) -- 0:00:09 846000 -- (-1422.624) (-1420.561) (-1421.367) [-1420.139] * [-1423.228] (-1425.151) (-1425.983) (-1421.799) -- 0:00:09 846500 -- (-1421.447) (-1419.805) (-1420.701) [-1421.764] * (-1424.141) [-1420.201] (-1420.708) (-1421.697) -- 0:00:09 847000 -- (-1422.843) (-1420.955) [-1420.417] (-1419.941) * (-1422.908) [-1423.316] (-1421.174) (-1426.656) -- 0:00:09 847500 -- (-1423.100) (-1419.747) (-1423.088) [-1423.742] * [-1422.051] (-1423.321) (-1421.264) (-1425.215) -- 0:00:09 848000 -- (-1420.813) (-1420.650) (-1421.735) [-1420.236] * (-1423.716) (-1420.643) [-1420.784] (-1428.034) -- 0:00:09 848500 -- (-1421.496) (-1421.028) [-1421.424] (-1420.852) * (-1424.581) [-1421.001] (-1420.100) (-1424.428) -- 0:00:09 849000 -- (-1422.037) [-1419.676] (-1423.622) (-1423.324) * (-1420.500) (-1422.606) [-1419.846] (-1421.488) -- 0:00:09 849500 -- (-1422.242) (-1419.709) [-1425.411] (-1424.495) * (-1421.944) (-1422.822) (-1420.654) [-1423.606] -- 0:00:09 850000 -- [-1421.218] (-1419.353) (-1424.044) (-1426.370) * (-1420.123) (-1422.128) [-1426.611] (-1423.288) -- 0:00:09 Average standard deviation of split frequencies: 0.010692 850500 -- (-1423.030) [-1421.470] (-1422.149) (-1422.623) * (-1420.368) (-1423.192) (-1420.697) [-1422.912] -- 0:00:09 851000 -- [-1423.189] (-1420.115) (-1421.799) (-1421.027) * (-1422.909) (-1421.929) (-1420.657) [-1424.145] -- 0:00:09 851500 -- (-1420.587) (-1420.293) [-1419.626] (-1426.262) * [-1422.078] (-1422.334) (-1421.138) (-1423.234) -- 0:00:09 852000 -- (-1421.150) (-1420.386) (-1420.248) [-1421.003] * (-1428.534) [-1423.451] (-1421.692) (-1422.292) -- 0:00:09 852500 -- (-1422.903) (-1420.241) [-1421.903] (-1421.928) * (-1419.949) (-1424.622) (-1422.838) [-1420.740] -- 0:00:09 853000 -- (-1423.667) (-1421.947) [-1422.149] (-1420.389) * [-1420.604] (-1421.386) (-1422.656) (-1420.785) -- 0:00:09 853500 -- (-1423.933) [-1421.089] (-1424.519) (-1422.295) * (-1425.056) [-1419.939] (-1422.614) (-1421.923) -- 0:00:09 854000 -- (-1422.163) (-1421.585) [-1420.418] (-1426.378) * (-1420.036) [-1423.417] (-1422.991) (-1431.133) -- 0:00:09 854500 -- (-1421.169) [-1421.208] (-1420.242) (-1424.698) * (-1419.291) [-1419.942] (-1425.938) (-1424.070) -- 0:00:09 855000 -- [-1422.922] (-1422.697) (-1420.657) (-1419.484) * (-1421.656) (-1419.664) (-1420.113) [-1420.204] -- 0:00:09 Average standard deviation of split frequencies: 0.010139 855500 -- (-1420.510) (-1421.979) (-1420.107) [-1422.875] * (-1426.209) (-1419.546) [-1420.904] (-1419.964) -- 0:00:09 856000 -- [-1419.698] (-1420.463) (-1422.683) (-1422.124) * (-1422.834) (-1423.049) (-1419.568) [-1420.026] -- 0:00:09 856500 -- (-1419.701) (-1424.396) (-1423.847) [-1420.086] * (-1421.419) [-1420.289] (-1420.508) (-1429.107) -- 0:00:09 857000 -- [-1420.498] (-1422.761) (-1420.776) (-1420.701) * (-1423.527) (-1424.045) [-1420.889] (-1424.532) -- 0:00:09 857500 -- (-1420.925) (-1423.567) [-1420.309] (-1424.194) * (-1425.490) (-1424.339) (-1420.340) [-1426.240] -- 0:00:08 858000 -- (-1421.927) (-1421.127) (-1423.408) [-1422.703] * (-1423.426) (-1420.360) (-1420.229) [-1421.550] -- 0:00:08 858500 -- (-1420.615) (-1419.908) [-1420.801] (-1425.857) * [-1421.522] (-1423.258) (-1419.881) (-1422.173) -- 0:00:08 859000 -- (-1421.843) [-1419.904] (-1421.689) (-1422.897) * (-1421.131) (-1423.568) [-1421.334] (-1422.922) -- 0:00:08 859500 -- (-1422.875) [-1422.036] (-1421.723) (-1419.920) * (-1421.039) (-1423.051) (-1420.817) [-1424.775] -- 0:00:08 860000 -- (-1423.740) (-1420.811) (-1422.111) [-1421.003] * (-1422.306) [-1420.304] (-1419.692) (-1423.754) -- 0:00:08 Average standard deviation of split frequencies: 0.010149 860500 -- (-1427.728) [-1419.847] (-1422.386) (-1420.654) * (-1421.823) (-1423.133) (-1420.860) [-1420.483] -- 0:00:08 861000 -- (-1422.622) (-1423.105) (-1420.103) [-1420.726] * [-1422.552] (-1419.824) (-1423.396) (-1420.232) -- 0:00:08 861500 -- [-1419.918] (-1421.745) (-1419.788) (-1420.811) * (-1419.749) [-1420.719] (-1422.859) (-1422.056) -- 0:00:08 862000 -- (-1419.960) [-1421.158] (-1419.477) (-1423.694) * (-1420.069) (-1419.904) (-1420.689) [-1420.317] -- 0:00:08 862500 -- [-1419.767] (-1420.354) (-1420.234) (-1421.382) * (-1423.553) (-1423.656) [-1422.166] (-1420.701) -- 0:00:08 863000 -- (-1421.825) (-1420.412) [-1419.820] (-1423.183) * (-1425.189) (-1425.793) (-1421.373) [-1422.091] -- 0:00:08 863500 -- (-1421.583) (-1420.358) (-1419.631) [-1420.936] * (-1425.018) (-1424.109) [-1420.465] (-1422.280) -- 0:00:08 864000 -- [-1422.704] (-1420.753) (-1422.069) (-1422.640) * (-1421.534) (-1419.902) (-1423.056) [-1422.824] -- 0:00:08 864500 -- (-1422.472) (-1421.473) [-1423.407] (-1425.088) * (-1419.902) (-1422.932) [-1421.407] (-1421.061) -- 0:00:08 865000 -- (-1421.081) (-1421.341) [-1424.906] (-1420.312) * (-1420.979) (-1421.844) (-1421.811) [-1421.960] -- 0:00:08 Average standard deviation of split frequencies: 0.010247 865500 -- (-1419.975) [-1420.465] (-1421.926) (-1423.338) * (-1420.500) [-1421.632] (-1424.571) (-1421.375) -- 0:00:08 866000 -- [-1421.256] (-1420.549) (-1420.089) (-1428.423) * [-1420.368] (-1420.121) (-1420.018) (-1421.292) -- 0:00:08 866500 -- [-1421.543] (-1421.982) (-1422.534) (-1425.330) * [-1422.925] (-1420.734) (-1420.559) (-1423.164) -- 0:00:08 867000 -- (-1421.062) (-1422.033) [-1420.427] (-1424.012) * (-1426.317) (-1420.564) [-1420.829] (-1425.480) -- 0:00:08 867500 -- (-1421.221) (-1421.630) [-1421.330] (-1423.044) * (-1424.792) (-1420.849) [-1423.737] (-1421.283) -- 0:00:08 868000 -- (-1421.737) (-1421.210) (-1423.373) [-1422.915] * (-1423.093) (-1424.199) (-1422.064) [-1423.715] -- 0:00:08 868500 -- (-1420.710) (-1425.565) (-1420.913) [-1420.029] * (-1421.920) [-1421.834] (-1424.625) (-1421.433) -- 0:00:08 869000 -- (-1420.746) [-1424.880] (-1422.170) (-1420.306) * (-1421.283) (-1422.641) [-1423.908] (-1425.837) -- 0:00:08 869500 -- (-1419.495) (-1426.106) [-1422.500] (-1420.797) * (-1420.385) [-1421.440] (-1423.046) (-1426.663) -- 0:00:08 870000 -- [-1420.214] (-1428.353) (-1421.335) (-1420.775) * [-1420.493] (-1424.732) (-1423.934) (-1422.018) -- 0:00:08 Average standard deviation of split frequencies: 0.010542 870500 -- [-1422.963] (-1425.908) (-1424.174) (-1420.474) * (-1420.902) [-1422.730] (-1420.701) (-1420.189) -- 0:00:08 871000 -- (-1419.983) [-1419.785] (-1423.052) (-1422.524) * (-1421.371) [-1420.980] (-1421.545) (-1420.768) -- 0:00:08 871500 -- (-1421.243) [-1421.025] (-1423.045) (-1419.329) * (-1421.885) (-1422.573) (-1421.319) [-1419.559] -- 0:00:08 872000 -- (-1422.004) [-1419.879] (-1419.670) (-1426.188) * [-1420.862] (-1422.733) (-1424.296) (-1420.017) -- 0:00:08 872500 -- [-1423.413] (-1422.088) (-1419.464) (-1422.285) * (-1421.402) (-1420.867) [-1424.487] (-1420.017) -- 0:00:08 873000 -- [-1419.938] (-1421.912) (-1425.601) (-1426.156) * (-1420.298) (-1422.599) [-1419.919] (-1419.524) -- 0:00:08 873500 -- (-1420.771) (-1419.875) [-1425.107] (-1421.231) * (-1420.330) (-1425.540) (-1420.066) [-1420.412] -- 0:00:07 874000 -- (-1421.021) (-1420.326) [-1421.552] (-1420.071) * (-1421.111) (-1426.373) (-1419.985) [-1422.173] -- 0:00:07 874500 -- [-1420.839] (-1420.606) (-1419.914) (-1420.440) * [-1421.223] (-1422.505) (-1420.826) (-1425.724) -- 0:00:07 875000 -- (-1423.135) (-1420.593) [-1421.948] (-1421.327) * (-1419.833) [-1420.748] (-1422.951) (-1420.777) -- 0:00:07 Average standard deviation of split frequencies: 0.010763 875500 -- (-1421.893) (-1423.207) [-1420.071] (-1421.480) * (-1431.145) (-1422.963) (-1422.768) [-1423.161] -- 0:00:07 876000 -- (-1424.115) (-1420.900) [-1420.071] (-1421.079) * [-1423.839] (-1420.434) (-1421.816) (-1421.736) -- 0:00:07 876500 -- (-1420.321) (-1421.200) [-1420.155] (-1420.546) * (-1425.363) [-1422.031] (-1422.033) (-1421.717) -- 0:00:07 877000 -- [-1424.253] (-1423.871) (-1419.935) (-1421.387) * (-1419.470) (-1420.178) [-1422.428] (-1420.353) -- 0:00:07 877500 -- [-1423.453] (-1425.154) (-1420.355) (-1422.363) * (-1420.301) [-1420.874] (-1423.493) (-1423.781) -- 0:00:07 878000 -- (-1423.344) (-1421.618) [-1423.567] (-1422.056) * [-1422.345] (-1420.287) (-1422.152) (-1421.607) -- 0:00:07 878500 -- [-1421.706] (-1421.660) (-1424.093) (-1421.283) * (-1425.390) (-1422.175) [-1424.405] (-1425.328) -- 0:00:07 879000 -- (-1424.019) (-1421.652) (-1420.864) [-1422.861] * (-1421.761) (-1421.673) (-1423.040) [-1422.792] -- 0:00:07 879500 -- (-1423.401) (-1419.888) [-1422.496] (-1420.947) * (-1422.946) (-1422.966) (-1422.617) [-1422.091] -- 0:00:07 880000 -- (-1422.422) (-1420.983) (-1421.377) [-1423.167] * [-1421.221] (-1422.404) (-1421.227) (-1422.330) -- 0:00:07 Average standard deviation of split frequencies: 0.010233 880500 -- (-1420.772) [-1422.437] (-1422.683) (-1420.335) * (-1422.729) (-1420.809) [-1421.438] (-1420.551) -- 0:00:07 881000 -- (-1420.236) [-1420.880] (-1423.499) (-1422.157) * (-1422.124) [-1423.233] (-1421.884) (-1419.702) -- 0:00:07 881500 -- (-1422.734) [-1422.280] (-1420.452) (-1427.028) * (-1422.980) (-1423.828) (-1421.766) [-1420.490] -- 0:00:07 882000 -- [-1423.174] (-1422.618) (-1425.188) (-1422.062) * (-1421.518) (-1420.605) [-1420.399] (-1419.850) -- 0:00:07 882500 -- [-1422.299] (-1422.508) (-1422.072) (-1420.694) * (-1419.814) (-1421.628) [-1420.274] (-1420.631) -- 0:00:07 883000 -- (-1419.884) (-1425.653) [-1420.157] (-1421.477) * (-1420.644) (-1422.331) [-1420.219] (-1420.675) -- 0:00:07 883500 -- (-1419.994) (-1421.554) [-1421.595] (-1422.420) * (-1423.869) (-1420.020) (-1421.332) [-1420.833] -- 0:00:07 884000 -- (-1423.555) (-1420.682) [-1422.368] (-1423.390) * (-1422.297) (-1420.193) (-1426.463) [-1422.072] -- 0:00:07 884500 -- (-1420.766) [-1424.738] (-1422.290) (-1420.980) * [-1421.388] (-1421.694) (-1422.550) (-1420.368) -- 0:00:07 885000 -- (-1419.923) (-1426.112) (-1422.042) [-1420.609] * (-1422.263) (-1420.011) (-1420.230) [-1421.649] -- 0:00:07 Average standard deviation of split frequencies: 0.009984 885500 -- [-1421.535] (-1421.833) (-1420.205) (-1421.220) * [-1421.394] (-1420.304) (-1420.186) (-1428.957) -- 0:00:07 886000 -- (-1424.233) (-1419.345) [-1420.515] (-1422.185) * (-1419.690) [-1420.639] (-1420.092) (-1423.597) -- 0:00:07 886500 -- (-1421.053) (-1419.714) [-1422.961] (-1423.775) * [-1419.887] (-1420.147) (-1419.409) (-1420.296) -- 0:00:07 887000 -- (-1423.874) [-1420.094] (-1420.875) (-1422.032) * (-1420.387) (-1421.527) (-1419.867) [-1420.395] -- 0:00:07 887500 -- [-1421.460] (-1420.664) (-1420.555) (-1422.662) * (-1420.237) [-1425.107] (-1420.728) (-1420.930) -- 0:00:07 888000 -- (-1421.706) [-1420.978] (-1419.481) (-1424.256) * (-1423.161) [-1422.984] (-1419.534) (-1423.053) -- 0:00:07 888500 -- [-1421.478] (-1427.887) (-1420.276) (-1421.591) * (-1425.136) (-1424.722) (-1419.184) [-1427.223] -- 0:00:07 889000 -- (-1423.308) [-1421.579] (-1419.917) (-1422.092) * (-1424.043) (-1424.148) [-1419.531] (-1425.631) -- 0:00:06 889500 -- (-1423.830) [-1421.061] (-1421.136) (-1421.711) * (-1421.778) [-1420.323] (-1421.037) (-1419.316) -- 0:00:06 890000 -- (-1424.585) (-1420.802) (-1422.678) [-1421.836] * (-1425.589) (-1420.238) [-1420.199] (-1420.840) -- 0:00:06 Average standard deviation of split frequencies: 0.009527 890500 -- (-1421.759) (-1421.344) (-1422.005) [-1420.937] * (-1428.930) (-1422.073) [-1419.334] (-1419.793) -- 0:00:06 891000 -- (-1420.214) [-1420.727] (-1422.047) (-1420.247) * (-1420.873) (-1421.469) (-1420.202) [-1419.833] -- 0:00:06 891500 -- (-1420.212) [-1420.321] (-1419.785) (-1420.130) * (-1421.946) (-1423.041) (-1422.697) [-1421.820] -- 0:00:06 892000 -- (-1422.774) (-1423.180) (-1424.487) [-1420.238] * (-1423.525) (-1419.525) (-1424.559) [-1422.419] -- 0:00:06 892500 -- (-1420.476) [-1424.344] (-1422.394) (-1421.498) * [-1419.232] (-1420.051) (-1421.265) (-1423.422) -- 0:00:06 893000 -- (-1423.222) (-1422.212) (-1420.588) [-1420.596] * (-1420.510) (-1423.139) [-1420.791] (-1419.632) -- 0:00:06 893500 -- [-1419.767] (-1424.839) (-1421.531) (-1421.168) * (-1420.612) (-1420.268) [-1420.531] (-1420.970) -- 0:00:06 894000 -- (-1420.230) [-1423.257] (-1420.930) (-1421.705) * (-1420.973) (-1419.759) (-1420.572) [-1422.500] -- 0:00:06 894500 -- (-1420.736) (-1422.419) [-1420.871] (-1423.102) * (-1421.743) (-1420.736) [-1422.415] (-1421.707) -- 0:00:06 895000 -- (-1419.976) (-1424.685) [-1420.500] (-1420.579) * [-1420.648] (-1421.659) (-1420.524) (-1421.877) -- 0:00:06 Average standard deviation of split frequencies: 0.009656 895500 -- [-1419.853] (-1420.209) (-1420.661) (-1420.747) * (-1420.788) (-1420.916) (-1422.942) [-1422.657] -- 0:00:06 896000 -- (-1420.221) [-1420.680] (-1421.172) (-1419.806) * (-1422.328) (-1420.879) (-1422.913) [-1421.250] -- 0:00:06 896500 -- [-1420.898] (-1421.899) (-1419.678) (-1422.848) * [-1424.610] (-1421.691) (-1420.679) (-1421.570) -- 0:00:06 897000 -- [-1421.869] (-1422.910) (-1422.250) (-1420.875) * (-1420.067) [-1421.834] (-1426.907) (-1423.612) -- 0:00:06 897500 -- (-1419.416) [-1423.140] (-1422.663) (-1424.569) * (-1421.077) (-1419.758) [-1420.250] (-1421.095) -- 0:00:06 898000 -- (-1422.771) [-1420.350] (-1420.435) (-1422.922) * (-1421.897) (-1424.892) (-1420.683) [-1425.670] -- 0:00:06 898500 -- (-1421.236) (-1420.452) (-1420.496) [-1421.026] * (-1420.454) [-1421.291] (-1422.802) (-1423.228) -- 0:00:06 899000 -- (-1425.932) [-1421.566] (-1421.310) (-1424.992) * (-1419.920) (-1421.505) (-1423.521) [-1421.440] -- 0:00:06 899500 -- [-1420.205] (-1420.866) (-1420.676) (-1420.693) * (-1420.334) (-1420.047) (-1425.768) [-1420.185] -- 0:00:06 900000 -- (-1420.266) [-1420.452] (-1421.656) (-1422.003) * [-1420.295] (-1420.752) (-1422.176) (-1421.326) -- 0:00:06 Average standard deviation of split frequencies: 0.009390 900500 -- (-1424.366) [-1421.695] (-1424.011) (-1419.832) * [-1420.427] (-1421.010) (-1421.350) (-1424.778) -- 0:00:06 901000 -- (-1425.022) (-1422.243) (-1424.108) [-1420.048] * (-1419.845) (-1421.866) [-1420.565] (-1423.076) -- 0:00:06 901500 -- (-1423.899) (-1421.592) (-1424.188) [-1420.561] * (-1423.307) [-1422.034] (-1422.442) (-1422.739) -- 0:00:06 902000 -- (-1421.148) (-1424.456) (-1424.955) [-1423.035] * (-1420.370) (-1421.571) [-1422.196] (-1424.725) -- 0:00:06 902500 -- (-1419.830) (-1425.191) [-1419.617] (-1420.652) * [-1419.787] (-1421.373) (-1422.577) (-1423.582) -- 0:00:06 903000 -- (-1421.383) (-1422.042) (-1421.347) [-1421.959] * [-1419.650] (-1428.236) (-1420.523) (-1422.297) -- 0:00:06 903500 -- (-1421.921) (-1420.821) [-1420.985] (-1423.609) * (-1422.105) (-1419.663) [-1421.702] (-1423.388) -- 0:00:06 904000 -- (-1422.270) (-1420.126) [-1425.838] (-1420.249) * (-1420.590) (-1421.063) [-1419.546] (-1419.913) -- 0:00:06 904500 -- (-1421.698) (-1422.022) [-1424.414] (-1422.391) * (-1421.653) [-1426.683] (-1420.034) (-1420.769) -- 0:00:06 905000 -- (-1421.076) (-1422.608) [-1420.355] (-1424.463) * (-1425.035) (-1421.181) [-1420.183] (-1419.928) -- 0:00:05 Average standard deviation of split frequencies: 0.008968 905500 -- (-1422.221) (-1423.233) (-1422.420) [-1422.114] * (-1420.344) (-1421.856) (-1421.839) [-1420.839] -- 0:00:05 906000 -- [-1423.392] (-1423.140) (-1422.893) (-1421.600) * (-1421.864) [-1421.656] (-1420.841) (-1428.360) -- 0:00:05 906500 -- [-1420.356] (-1428.510) (-1422.503) (-1420.825) * [-1422.576] (-1420.998) (-1422.449) (-1423.347) -- 0:00:05 907000 -- (-1424.030) (-1423.005) [-1419.812] (-1420.673) * [-1421.820] (-1422.445) (-1426.849) (-1421.975) -- 0:00:05 907500 -- (-1424.030) (-1420.398) (-1421.064) [-1422.367] * (-1422.711) (-1419.576) (-1419.948) [-1419.975] -- 0:00:05 908000 -- [-1421.491] (-1420.902) (-1419.681) (-1424.161) * (-1423.503) (-1421.203) (-1429.231) [-1424.067] -- 0:00:05 908500 -- (-1421.378) (-1421.275) (-1421.622) [-1422.233] * [-1423.344] (-1422.766) (-1424.209) (-1422.104) -- 0:00:05 909000 -- (-1421.955) (-1422.154) [-1423.028] (-1425.427) * (-1420.832) (-1421.062) (-1421.023) [-1423.028] -- 0:00:05 909500 -- (-1421.086) (-1424.025) (-1421.815) [-1423.180] * (-1420.828) [-1420.982] (-1421.828) (-1422.480) -- 0:00:05 910000 -- (-1424.465) (-1421.341) (-1420.543) [-1421.357] * (-1420.803) (-1420.450) [-1420.188] (-1422.576) -- 0:00:05 Average standard deviation of split frequencies: 0.008861 910500 -- [-1422.447] (-1420.146) (-1423.174) (-1420.995) * (-1422.284) [-1425.363] (-1420.590) (-1423.818) -- 0:00:05 911000 -- (-1421.872) [-1423.115] (-1423.052) (-1421.114) * [-1423.637] (-1430.118) (-1420.699) (-1421.967) -- 0:00:05 911500 -- (-1421.782) (-1424.932) [-1420.815] (-1423.317) * [-1420.703] (-1424.162) (-1420.397) (-1421.710) -- 0:00:05 912000 -- [-1423.672] (-1424.259) (-1420.699) (-1423.679) * (-1423.409) (-1421.111) (-1422.215) [-1421.359] -- 0:00:05 912500 -- (-1419.945) (-1423.113) [-1419.920] (-1419.964) * (-1422.718) (-1419.884) (-1419.363) [-1423.823] -- 0:00:05 913000 -- (-1421.745) (-1421.018) [-1420.283] (-1421.973) * (-1422.271) [-1420.458] (-1420.842) (-1420.688) -- 0:00:05 913500 -- (-1429.242) [-1421.004] (-1423.206) (-1421.009) * (-1425.956) (-1420.289) (-1420.532) [-1420.553] -- 0:00:05 914000 -- (-1426.943) [-1419.563] (-1420.355) (-1421.965) * (-1420.932) [-1419.545] (-1420.568) (-1425.988) -- 0:00:05 914500 -- [-1421.559] (-1421.099) (-1421.022) (-1423.126) * (-1420.739) (-1419.423) (-1422.097) [-1420.889] -- 0:00:05 915000 -- (-1425.368) (-1424.533) (-1423.165) [-1421.744] * (-1422.668) [-1420.524] (-1422.339) (-1420.357) -- 0:00:05 Average standard deviation of split frequencies: 0.008840 915500 -- (-1420.551) (-1422.242) (-1422.355) [-1422.160] * [-1420.094] (-1422.147) (-1421.692) (-1420.022) -- 0:00:05 916000 -- (-1424.043) (-1419.853) (-1424.331) [-1419.558] * [-1424.870] (-1422.156) (-1419.446) (-1420.111) -- 0:00:05 916500 -- (-1424.736) (-1419.889) (-1423.773) [-1426.848] * [-1423.733] (-1421.198) (-1420.566) (-1421.441) -- 0:00:05 917000 -- [-1420.334] (-1420.409) (-1421.846) (-1421.185) * (-1422.911) (-1420.323) (-1420.967) [-1421.385] -- 0:00:05 917500 -- (-1420.981) (-1420.192) (-1425.347) [-1421.551] * (-1421.693) [-1419.572] (-1421.971) (-1421.479) -- 0:00:05 918000 -- [-1421.291] (-1420.192) (-1421.671) (-1424.251) * (-1420.637) (-1421.419) [-1421.502] (-1420.964) -- 0:00:05 918500 -- (-1419.677) (-1421.121) [-1422.194] (-1420.733) * (-1419.777) [-1421.089] (-1425.840) (-1422.238) -- 0:00:05 919000 -- (-1419.399) (-1421.727) (-1430.993) [-1421.505] * (-1419.759) (-1419.842) (-1423.420) [-1423.175] -- 0:00:05 919500 -- (-1420.443) [-1421.855] (-1425.434) (-1421.806) * (-1423.957) (-1419.817) [-1421.281] (-1425.276) -- 0:00:05 920000 -- (-1421.114) (-1420.856) (-1424.316) [-1421.654] * (-1424.102) [-1419.618] (-1420.027) (-1422.608) -- 0:00:05 Average standard deviation of split frequencies: 0.008463 920500 -- [-1420.457] (-1423.957) (-1420.443) (-1421.225) * [-1420.235] (-1420.111) (-1421.438) (-1423.699) -- 0:00:05 921000 -- [-1420.486] (-1422.957) (-1420.902) (-1423.601) * (-1424.521) (-1422.997) [-1421.876] (-1420.367) -- 0:00:04 921500 -- [-1421.901] (-1421.409) (-1420.360) (-1423.893) * (-1420.157) [-1419.440] (-1420.465) (-1420.408) -- 0:00:04 922000 -- (-1423.456) [-1421.266] (-1426.688) (-1426.462) * (-1423.035) (-1419.691) [-1421.171] (-1419.280) -- 0:00:04 922500 -- (-1422.292) [-1423.507] (-1425.510) (-1422.854) * (-1424.243) [-1422.035] (-1421.702) (-1419.866) -- 0:00:04 923000 -- (-1426.568) (-1419.853) [-1423.958] (-1420.618) * (-1421.115) [-1420.709] (-1420.245) (-1421.265) -- 0:00:04 923500 -- (-1420.626) (-1426.726) (-1420.526) [-1422.015] * [-1421.087] (-1420.433) (-1419.778) (-1421.030) -- 0:00:04 924000 -- (-1424.519) (-1432.297) (-1422.163) [-1421.182] * (-1419.842) (-1419.943) (-1423.428) [-1420.087] -- 0:00:04 924500 -- (-1425.567) [-1428.014] (-1420.783) (-1423.326) * (-1423.229) [-1424.652] (-1420.555) (-1420.505) -- 0:00:04 925000 -- (-1424.032) (-1422.098) [-1421.887] (-1422.557) * (-1425.900) (-1421.683) (-1421.065) [-1422.602] -- 0:00:04 Average standard deviation of split frequencies: 0.008894 925500 -- (-1425.356) (-1421.331) [-1420.877] (-1420.687) * (-1419.714) (-1428.545) (-1421.287) [-1421.247] -- 0:00:04 926000 -- [-1421.562] (-1422.703) (-1420.981) (-1424.831) * [-1421.209] (-1421.517) (-1423.947) (-1419.982) -- 0:00:04 926500 -- (-1427.996) (-1420.923) (-1420.744) [-1424.519] * [-1421.730] (-1419.224) (-1422.432) (-1424.913) -- 0:00:04 927000 -- (-1423.652) [-1419.561] (-1426.406) (-1426.461) * (-1421.984) [-1419.785] (-1421.447) (-1420.412) -- 0:00:04 927500 -- [-1422.265] (-1420.546) (-1426.339) (-1421.662) * (-1422.858) [-1419.710] (-1422.532) (-1422.344) -- 0:00:04 928000 -- (-1421.752) (-1419.862) [-1423.743] (-1422.803) * [-1420.489] (-1426.377) (-1423.355) (-1432.836) -- 0:00:04 928500 -- [-1420.917] (-1420.828) (-1422.445) (-1427.142) * (-1422.779) (-1421.523) [-1422.008] (-1430.567) -- 0:00:04 929000 -- [-1422.202] (-1422.222) (-1420.835) (-1422.126) * (-1420.530) [-1427.524] (-1420.784) (-1423.786) -- 0:00:04 929500 -- (-1421.016) [-1423.647] (-1421.618) (-1422.125) * (-1420.366) (-1420.609) (-1420.024) [-1420.606] -- 0:00:04 930000 -- (-1421.307) [-1420.698] (-1419.964) (-1425.021) * (-1422.350) (-1420.549) (-1424.213) [-1423.895] -- 0:00:04 Average standard deviation of split frequencies: 0.008670 930500 -- (-1422.273) (-1422.789) [-1419.505] (-1423.150) * (-1423.603) (-1420.470) [-1424.887] (-1422.562) -- 0:00:04 931000 -- [-1421.139] (-1421.821) (-1421.970) (-1419.426) * (-1422.419) (-1421.979) (-1419.438) [-1420.414] -- 0:00:04 931500 -- [-1420.999] (-1419.976) (-1422.591) (-1419.709) * (-1420.628) [-1420.583] (-1420.494) (-1421.246) -- 0:00:04 932000 -- (-1420.344) (-1422.222) (-1421.313) [-1419.709] * (-1421.327) (-1422.799) (-1428.903) [-1422.271] -- 0:00:04 932500 -- (-1422.130) [-1421.336] (-1422.622) (-1419.494) * (-1421.283) (-1419.816) (-1420.133) [-1421.450] -- 0:00:04 933000 -- (-1421.348) [-1420.499] (-1420.212) (-1419.447) * (-1426.515) (-1420.559) [-1420.437] (-1424.211) -- 0:00:04 933500 -- [-1421.853] (-1423.389) (-1421.387) (-1419.956) * [-1421.380] (-1421.317) (-1421.674) (-1421.373) -- 0:00:04 934000 -- [-1429.472] (-1424.465) (-1420.777) (-1423.021) * (-1421.994) [-1421.405] (-1420.631) (-1420.340) -- 0:00:04 934500 -- (-1424.764) [-1420.319] (-1419.650) (-1429.217) * (-1426.436) [-1419.803] (-1421.761) (-1420.704) -- 0:00:04 935000 -- [-1420.248] (-1420.746) (-1421.575) (-1427.257) * (-1421.902) (-1421.089) [-1420.224] (-1420.370) -- 0:00:04 Average standard deviation of split frequencies: 0.008473 935500 -- [-1420.817] (-1423.368) (-1424.475) (-1423.479) * [-1420.070] (-1425.493) (-1421.562) (-1419.867) -- 0:00:04 936000 -- (-1422.598) (-1426.156) [-1425.273] (-1420.945) * [-1421.052] (-1420.515) (-1426.407) (-1429.163) -- 0:00:04 936500 -- (-1421.783) (-1424.335) (-1422.548) [-1420.901] * [-1421.687] (-1420.262) (-1426.088) (-1420.738) -- 0:00:04 937000 -- (-1420.258) [-1420.277] (-1420.176) (-1423.488) * [-1421.958] (-1420.069) (-1424.610) (-1421.921) -- 0:00:03 937500 -- (-1422.561) (-1421.807) [-1419.503] (-1422.222) * [-1421.140] (-1422.532) (-1421.398) (-1419.597) -- 0:00:03 938000 -- (-1421.008) (-1420.815) (-1419.692) [-1421.211] * [-1421.839] (-1424.161) (-1419.546) (-1419.492) -- 0:00:03 938500 -- [-1420.565] (-1420.816) (-1420.964) (-1423.136) * (-1420.725) (-1420.629) (-1419.447) [-1419.177] -- 0:00:03 939000 -- (-1420.276) [-1421.351] (-1423.184) (-1426.254) * (-1420.080) [-1421.558] (-1419.752) (-1423.382) -- 0:00:03 939500 -- (-1421.037) (-1423.312) (-1422.106) [-1421.446] * (-1424.796) (-1420.763) (-1420.887) [-1425.123] -- 0:00:03 940000 -- (-1420.622) (-1421.061) (-1421.676) [-1420.961] * (-1421.447) (-1420.816) [-1420.871] (-1428.880) -- 0:00:03 Average standard deviation of split frequencies: 0.008755 940500 -- (-1421.819) (-1421.981) (-1419.716) [-1422.081] * (-1423.087) [-1420.605] (-1421.686) (-1419.567) -- 0:00:03 941000 -- (-1421.091) [-1422.410] (-1419.792) (-1422.769) * (-1424.889) (-1420.589) [-1422.304] (-1420.289) -- 0:00:03 941500 -- [-1425.097] (-1423.188) (-1421.413) (-1422.013) * [-1425.874] (-1420.215) (-1422.187) (-1422.027) -- 0:00:03 942000 -- (-1422.428) (-1419.919) (-1420.821) [-1423.213] * (-1420.549) (-1420.269) [-1424.171] (-1421.894) -- 0:00:03 942500 -- (-1423.293) (-1421.507) [-1420.755] (-1420.646) * (-1424.437) [-1424.560] (-1424.005) (-1423.525) -- 0:00:03 943000 -- [-1424.035] (-1426.215) (-1423.362) (-1423.220) * [-1421.514] (-1420.537) (-1420.249) (-1420.677) -- 0:00:03 943500 -- [-1422.762] (-1421.508) (-1424.224) (-1422.006) * [-1419.814] (-1420.715) (-1426.158) (-1421.089) -- 0:00:03 944000 -- (-1420.487) (-1421.642) (-1423.128) [-1421.162] * (-1426.583) (-1419.957) (-1420.857) [-1420.076] -- 0:00:03 944500 -- (-1427.115) (-1422.140) (-1422.193) [-1423.302] * (-1424.754) [-1421.367] (-1425.729) (-1422.185) -- 0:00:03 945000 -- (-1427.669) (-1420.167) (-1420.491) [-1420.432] * (-1421.241) [-1420.578] (-1423.671) (-1422.643) -- 0:00:03 Average standard deviation of split frequencies: 0.008677 945500 -- (-1421.511) [-1422.857] (-1420.142) (-1420.596) * [-1421.449] (-1420.932) (-1421.112) (-1427.119) -- 0:00:03 946000 -- (-1422.573) (-1424.685) [-1424.739] (-1419.610) * (-1420.336) [-1421.555] (-1421.117) (-1423.079) -- 0:00:03 946500 -- (-1420.972) (-1424.388) (-1424.360) [-1419.619] * (-1421.590) (-1420.206) (-1421.100) [-1421.291] -- 0:00:03 947000 -- (-1419.498) (-1420.105) (-1421.488) [-1421.864] * [-1422.208] (-1420.372) (-1422.182) (-1423.143) -- 0:00:03 947500 -- (-1420.162) (-1419.715) (-1424.764) [-1423.664] * (-1420.389) (-1422.657) (-1421.309) [-1422.921] -- 0:00:03 948000 -- [-1423.259] (-1420.325) (-1420.621) (-1420.104) * (-1421.167) (-1424.710) (-1420.646) [-1421.978] -- 0:00:03 948500 -- (-1423.566) [-1421.358] (-1421.618) (-1422.138) * [-1421.769] (-1421.696) (-1421.054) (-1427.219) -- 0:00:03 949000 -- [-1421.793] (-1420.863) (-1423.159) (-1422.069) * (-1423.822) (-1423.851) (-1423.083) [-1421.581] -- 0:00:03 949500 -- (-1423.002) (-1421.237) (-1421.071) [-1424.184] * (-1423.165) (-1422.343) (-1421.111) [-1421.599] -- 0:00:03 950000 -- (-1422.961) (-1420.298) (-1420.778) [-1420.604] * (-1422.135) (-1422.414) [-1419.473] (-1423.761) -- 0:00:03 Average standard deviation of split frequencies: 0.009217 950500 -- (-1426.524) [-1420.263] (-1421.915) (-1423.219) * (-1420.042) (-1422.954) (-1419.434) [-1420.083] -- 0:00:03 951000 -- (-1420.045) (-1424.857) [-1421.166] (-1423.962) * (-1422.064) (-1423.777) (-1423.062) [-1420.547] -- 0:00:03 951500 -- (-1422.580) [-1420.214] (-1421.307) (-1422.644) * [-1419.261] (-1422.567) (-1421.458) (-1421.891) -- 0:00:03 952000 -- (-1422.228) [-1420.642] (-1420.123) (-1423.265) * (-1419.859) (-1422.848) [-1419.844] (-1424.412) -- 0:00:03 952500 -- (-1420.695) (-1419.935) [-1425.176] (-1425.738) * [-1419.835] (-1419.987) (-1420.357) (-1420.964) -- 0:00:02 953000 -- [-1419.344] (-1420.738) (-1422.466) (-1421.822) * (-1430.707) [-1424.226] (-1424.890) (-1421.621) -- 0:00:02 953500 -- (-1420.236) [-1422.028] (-1419.668) (-1420.649) * [-1422.677] (-1421.748) (-1420.770) (-1421.216) -- 0:00:02 954000 -- (-1420.779) (-1422.301) [-1423.046] (-1423.591) * (-1420.283) (-1421.678) [-1422.176] (-1421.928) -- 0:00:02 954500 -- (-1420.480) (-1422.966) (-1425.093) [-1420.339] * (-1421.026) (-1422.325) [-1420.028] (-1420.355) -- 0:00:02 955000 -- (-1426.434) (-1420.027) (-1422.707) [-1420.245] * (-1420.793) (-1421.309) (-1419.846) [-1421.829] -- 0:00:02 Average standard deviation of split frequencies: 0.008673 955500 -- [-1419.781] (-1420.254) (-1424.366) (-1419.477) * (-1419.620) (-1422.018) (-1422.424) [-1421.274] -- 0:00:02 956000 -- (-1422.075) (-1424.914) [-1421.480] (-1421.626) * [-1420.825] (-1420.482) (-1421.793) (-1421.092) -- 0:00:02 956500 -- (-1419.725) [-1421.203] (-1423.380) (-1421.185) * (-1419.654) (-1422.538) [-1419.723] (-1423.330) -- 0:00:02 957000 -- (-1421.064) (-1419.654) [-1421.935] (-1420.548) * (-1424.389) (-1424.124) (-1424.494) [-1426.314] -- 0:00:02 957500 -- [-1419.844] (-1420.065) (-1420.829) (-1420.324) * (-1427.490) [-1419.819] (-1423.013) (-1420.475) -- 0:00:02 958000 -- (-1422.552) (-1420.314) (-1421.783) [-1421.859] * (-1426.105) [-1422.887] (-1420.893) (-1421.598) -- 0:00:02 958500 -- [-1420.458] (-1422.499) (-1421.296) (-1422.902) * (-1420.357) (-1423.753) [-1419.812] (-1420.641) -- 0:00:02 959000 -- [-1419.762] (-1421.740) (-1422.993) (-1426.769) * (-1420.133) (-1422.800) (-1424.401) [-1420.462] -- 0:00:02 959500 -- (-1419.974) (-1422.281) [-1419.818] (-1425.471) * (-1422.554) (-1419.944) (-1422.122) [-1420.744] -- 0:00:02 960000 -- (-1420.923) (-1430.915) (-1421.960) [-1420.917] * (-1420.676) [-1420.408] (-1421.808) (-1419.885) -- 0:00:02 Average standard deviation of split frequencies: 0.008486 960500 -- (-1421.959) (-1421.263) [-1422.784] (-1425.513) * (-1421.243) (-1421.326) [-1423.352] (-1422.741) -- 0:00:02 961000 -- (-1423.341) (-1422.649) (-1421.879) [-1426.392] * (-1421.864) [-1421.264] (-1424.223) (-1423.176) -- 0:00:02 961500 -- (-1427.764) (-1422.983) [-1420.593] (-1421.481) * [-1419.823] (-1420.973) (-1423.452) (-1420.115) -- 0:00:02 962000 -- (-1422.092) (-1420.608) (-1420.861) [-1427.809] * [-1420.002] (-1421.832) (-1423.676) (-1420.327) -- 0:00:02 962500 -- (-1420.345) [-1421.930] (-1421.222) (-1425.918) * (-1421.161) [-1419.353] (-1425.669) (-1422.098) -- 0:00:02 963000 -- (-1420.700) (-1422.769) [-1419.998] (-1421.918) * (-1420.303) [-1419.554] (-1422.128) (-1423.340) -- 0:00:02 963500 -- (-1421.113) [-1420.233] (-1420.111) (-1421.439) * (-1424.833) (-1421.031) [-1420.819] (-1421.823) -- 0:00:02 964000 -- (-1420.201) [-1421.965] (-1420.187) (-1419.703) * (-1424.924) (-1426.061) [-1419.861] (-1422.940) -- 0:00:02 964500 -- (-1424.683) (-1422.594) [-1420.441] (-1420.839) * [-1425.259] (-1424.276) (-1421.832) (-1421.995) -- 0:00:02 965000 -- (-1421.971) [-1419.989] (-1423.245) (-1421.092) * (-1423.609) [-1422.456] (-1420.489) (-1422.428) -- 0:00:02 Average standard deviation of split frequencies: 0.008727 965500 -- (-1423.550) (-1419.639) (-1422.998) [-1422.337] * (-1420.746) [-1421.775] (-1421.800) (-1420.566) -- 0:00:02 966000 -- (-1423.304) (-1423.294) (-1423.642) [-1422.430] * (-1421.808) [-1422.108] (-1420.598) (-1420.651) -- 0:00:02 966500 -- (-1422.875) (-1420.726) (-1420.498) [-1421.450] * (-1427.797) (-1419.892) [-1424.527] (-1421.116) -- 0:00:02 967000 -- [-1420.789] (-1420.383) (-1420.789) (-1419.743) * (-1421.235) (-1419.533) [-1421.535] (-1423.566) -- 0:00:02 967500 -- (-1420.985) (-1425.773) (-1420.764) [-1422.532] * (-1422.022) [-1421.223] (-1421.378) (-1420.518) -- 0:00:02 968000 -- (-1428.541) (-1420.539) [-1420.261] (-1422.067) * [-1420.261] (-1422.273) (-1420.309) (-1420.297) -- 0:00:02 968500 -- (-1421.157) (-1421.665) [-1421.382] (-1421.698) * (-1419.422) (-1420.663) (-1419.696) [-1420.230] -- 0:00:01 969000 -- (-1421.747) (-1421.705) [-1421.003] (-1422.816) * (-1420.202) (-1422.237) [-1420.320] (-1422.476) -- 0:00:01 969500 -- (-1420.367) [-1422.374] (-1420.218) (-1426.197) * (-1419.817) (-1421.011) [-1421.663] (-1424.901) -- 0:00:01 970000 -- [-1420.832] (-1422.990) (-1423.096) (-1426.574) * (-1423.691) [-1425.321] (-1421.215) (-1423.511) -- 0:00:01 Average standard deviation of split frequencies: 0.008685 970500 -- [-1421.421] (-1419.749) (-1424.100) (-1420.773) * (-1422.651) (-1420.534) [-1421.374] (-1421.756) -- 0:00:01 971000 -- (-1420.784) (-1419.789) [-1420.764] (-1420.562) * [-1422.272] (-1420.164) (-1421.631) (-1424.594) -- 0:00:01 971500 -- (-1423.269) [-1419.960] (-1422.562) (-1421.808) * (-1424.953) (-1421.686) (-1421.949) [-1420.656] -- 0:00:01 972000 -- (-1422.464) (-1420.121) (-1421.492) [-1419.773] * (-1422.650) (-1424.528) (-1422.013) [-1425.265] -- 0:00:01 972500 -- (-1419.591) [-1420.085] (-1422.715) (-1420.246) * (-1425.764) [-1421.398] (-1419.681) (-1424.073) -- 0:00:01 973000 -- (-1421.564) (-1420.246) [-1423.140] (-1422.145) * (-1421.337) (-1419.981) (-1421.598) [-1419.468] -- 0:00:01 973500 -- (-1421.459) [-1420.580] (-1420.289) (-1421.736) * [-1421.739] (-1419.770) (-1421.496) (-1422.365) -- 0:00:01 974000 -- [-1421.699] (-1422.696) (-1420.422) (-1423.512) * (-1422.086) (-1421.186) (-1420.756) [-1421.039] -- 0:00:01 974500 -- (-1422.651) [-1422.593] (-1420.203) (-1428.203) * (-1427.735) (-1420.147) (-1421.290) [-1422.883] -- 0:00:01 975000 -- (-1424.658) (-1422.991) (-1420.326) [-1421.102] * (-1420.416) (-1420.872) [-1422.802] (-1425.391) -- 0:00:01 Average standard deviation of split frequencies: 0.008779 975500 -- (-1423.182) [-1422.071] (-1420.929) (-1423.055) * [-1422.946] (-1419.600) (-1422.223) (-1421.531) -- 0:00:01 976000 -- (-1421.124) (-1422.523) [-1419.852] (-1420.840) * (-1423.950) [-1420.022] (-1421.892) (-1422.125) -- 0:00:01 976500 -- (-1420.831) [-1421.881] (-1423.784) (-1420.783) * (-1424.728) (-1420.568) [-1421.591] (-1421.582) -- 0:00:01 977000 -- (-1422.719) (-1425.198) [-1422.382] (-1421.379) * (-1424.388) [-1422.708] (-1423.125) (-1422.009) -- 0:00:01 977500 -- (-1421.316) (-1422.088) [-1420.732] (-1422.860) * (-1420.712) (-1421.812) [-1423.511] (-1426.540) -- 0:00:01 978000 -- (-1422.586) (-1422.425) (-1423.717) [-1423.478] * (-1421.707) [-1422.624] (-1423.995) (-1428.040) -- 0:00:01 978500 -- (-1422.378) (-1426.010) [-1421.889] (-1421.383) * [-1421.001] (-1423.022) (-1421.631) (-1420.512) -- 0:00:01 979000 -- (-1421.832) [-1424.463] (-1424.093) (-1422.553) * [-1421.268] (-1421.860) (-1419.298) (-1421.309) -- 0:00:01 979500 -- (-1422.990) (-1420.367) (-1423.232) [-1422.119] * (-1420.710) (-1421.963) (-1421.437) [-1420.018] -- 0:00:01 980000 -- (-1420.757) (-1420.465) [-1420.739] (-1421.804) * (-1421.138) [-1420.580] (-1423.580) (-1422.162) -- 0:00:01 Average standard deviation of split frequencies: 0.008568 980500 -- [-1420.624] (-1420.055) (-1419.707) (-1421.422) * (-1420.995) [-1420.699] (-1425.032) (-1420.501) -- 0:00:01 981000 -- (-1420.994) [-1420.068] (-1420.209) (-1420.818) * (-1419.884) [-1422.805] (-1423.914) (-1423.244) -- 0:00:01 981500 -- (-1419.908) (-1420.114) (-1421.923) [-1421.065] * (-1420.012) (-1423.820) [-1421.065] (-1422.809) -- 0:00:01 982000 -- (-1420.534) [-1419.258] (-1422.672) (-1422.464) * (-1420.759) (-1423.607) (-1420.334) [-1420.449] -- 0:00:01 982500 -- (-1419.864) (-1420.683) (-1422.342) [-1421.864] * (-1420.943) [-1421.999] (-1422.078) (-1422.308) -- 0:00:01 983000 -- (-1422.895) (-1421.259) (-1424.378) [-1420.986] * (-1422.386) (-1421.543) (-1421.955) [-1425.126] -- 0:00:01 983500 -- (-1422.127) [-1422.057] (-1422.013) (-1426.874) * (-1423.928) (-1421.337) [-1421.365] (-1424.459) -- 0:00:01 984000 -- [-1421.267] (-1421.930) (-1424.107) (-1421.901) * [-1420.507] (-1420.902) (-1419.963) (-1422.747) -- 0:00:01 984500 -- (-1421.754) [-1426.124] (-1422.520) (-1425.900) * [-1421.929] (-1426.046) (-1422.798) (-1419.816) -- 0:00:00 985000 -- (-1421.756) (-1430.262) [-1422.089] (-1419.722) * (-1423.562) [-1423.288] (-1422.326) (-1419.524) -- 0:00:00 Average standard deviation of split frequencies: 0.008578 985500 -- (-1423.566) (-1424.994) (-1419.838) [-1423.177] * (-1421.437) [-1420.517] (-1420.845) (-1419.158) -- 0:00:00 986000 -- (-1423.384) [-1420.040] (-1420.686) (-1422.574) * (-1421.806) (-1420.584) [-1421.575] (-1423.482) -- 0:00:00 986500 -- (-1422.440) [-1421.583] (-1420.731) (-1423.813) * (-1424.280) [-1421.752] (-1421.540) (-1423.618) -- 0:00:00 987000 -- [-1421.735] (-1420.984) (-1420.741) (-1426.886) * [-1424.966] (-1421.286) (-1420.723) (-1424.949) -- 0:00:00 987500 -- (-1424.713) [-1420.004] (-1423.890) (-1419.354) * [-1425.236] (-1422.171) (-1420.676) (-1424.327) -- 0:00:00 988000 -- (-1421.881) (-1420.844) [-1421.447] (-1419.877) * (-1422.354) (-1420.001) [-1422.154] (-1421.582) -- 0:00:00 988500 -- (-1420.575) (-1420.410) (-1421.130) [-1420.310] * (-1425.885) (-1420.160) [-1422.536] (-1422.904) -- 0:00:00 989000 -- (-1421.133) (-1432.786) (-1422.738) [-1419.902] * (-1424.194) (-1423.092) [-1423.009] (-1423.857) -- 0:00:00 989500 -- (-1422.727) (-1425.874) (-1419.639) [-1420.121] * [-1420.978] (-1420.995) (-1419.679) (-1420.944) -- 0:00:00 990000 -- [-1422.957] (-1421.858) (-1421.755) (-1422.582) * (-1420.360) (-1422.747) [-1419.791] (-1427.961) -- 0:00:00 Average standard deviation of split frequencies: 0.008621 990500 -- [-1422.390] (-1422.944) (-1421.966) (-1423.689) * (-1421.638) (-1423.912) (-1422.493) [-1422.745] -- 0:00:00 991000 -- (-1421.094) (-1421.621) [-1420.171] (-1421.180) * [-1423.132] (-1420.882) (-1421.889) (-1422.201) -- 0:00:00 991500 -- (-1422.230) (-1422.825) (-1420.826) [-1421.400] * [-1421.495] (-1421.291) (-1421.438) (-1422.035) -- 0:00:00 992000 -- (-1426.784) [-1420.709] (-1424.056) (-1422.680) * (-1420.473) (-1420.700) (-1424.561) [-1423.978] -- 0:00:00 992500 -- (-1421.282) (-1420.785) (-1420.640) [-1420.900] * (-1419.261) [-1421.210] (-1421.839) (-1425.224) -- 0:00:00 993000 -- (-1420.693) [-1419.474] (-1420.111) (-1420.815) * [-1422.369] (-1423.545) (-1421.026) (-1423.192) -- 0:00:00 993500 -- (-1420.826) (-1420.377) [-1424.106] (-1421.855) * (-1422.057) (-1420.317) [-1420.672] (-1420.478) -- 0:00:00 994000 -- (-1421.977) (-1421.405) [-1421.720] (-1424.676) * [-1420.106] (-1420.065) (-1422.356) (-1420.794) -- 0:00:00 994500 -- (-1419.930) (-1421.035) [-1421.815] (-1423.167) * (-1422.289) [-1420.332] (-1420.108) (-1420.464) -- 0:00:00 995000 -- (-1419.898) [-1420.464] (-1422.460) (-1421.622) * (-1422.092) [-1420.130] (-1425.495) (-1421.345) -- 0:00:00 Average standard deviation of split frequencies: 0.008519 995500 -- (-1420.239) (-1422.516) [-1420.241] (-1423.472) * [-1419.435] (-1421.255) (-1421.269) (-1421.326) -- 0:00:00 996000 -- (-1423.117) (-1422.118) (-1421.450) [-1423.334] * [-1421.681] (-1420.050) (-1422.081) (-1421.641) -- 0:00:00 996500 -- (-1421.850) [-1421.286] (-1428.337) (-1425.122) * (-1421.471) (-1420.356) (-1422.238) [-1420.259] -- 0:00:00 997000 -- (-1422.841) (-1420.809) (-1419.579) [-1419.791] * [-1420.984] (-1421.145) (-1419.685) (-1419.743) -- 0:00:00 997500 -- (-1422.817) [-1420.259] (-1419.352) (-1422.500) * (-1423.868) (-1419.905) [-1421.078] (-1420.635) -- 0:00:00 998000 -- [-1421.845] (-1420.678) (-1422.469) (-1421.884) * (-1421.887) (-1420.748) [-1421.121] (-1423.736) -- 0:00:00 998500 -- (-1420.191) (-1421.173) [-1419.566] (-1424.287) * (-1419.940) (-1419.816) (-1423.841) [-1423.373] -- 0:00:00 999000 -- [-1422.499] (-1420.677) (-1422.502) (-1421.076) * (-1422.627) (-1422.245) [-1420.158] (-1421.763) -- 0:00:00 999500 -- (-1420.662) (-1432.031) [-1420.233] (-1421.261) * (-1423.716) [-1419.929] (-1425.955) (-1421.185) -- 0:00:00 1000000 -- [-1420.279] (-1430.412) (-1420.790) (-1421.419) * [-1422.264] (-1422.756) (-1424.323) (-1423.207) -- 0:00:00 Average standard deviation of split frequencies: 0.008230 Analysis completed in 1 mins 3 seconds Analysis used 61.31 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1419.11 Likelihood of best state for "cold" chain of run 2 was -1419.11 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.4 % ( 71 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 24.8 % ( 25 %) Dirichlet(Pi{all}) 27.9 % ( 27 %) Slider(Pi{all}) 77.8 % ( 54 %) Multiplier(Alpha{1,2}) 77.7 % ( 57 %) Multiplier(Alpha{3}) 16.9 % ( 19 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 27 %) Multiplier(V{all}) 97.3 % ( 99 %) Nodeslider(V{all}) 30.6 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.1 % ( 67 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 25.2 % ( 28 %) Dirichlet(Pi{all}) 27.7 % ( 26 %) Slider(Pi{all}) 79.4 % ( 56 %) Multiplier(Alpha{1,2}) 78.1 % ( 42 %) Multiplier(Alpha{3}) 16.6 % ( 15 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 70 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 25 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.9 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 165937 0.82 0.67 3 | 167010 166812 0.84 4 | 165766 168021 166454 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167061 0.82 0.67 3 | 166516 166406 0.84 4 | 166758 166638 166621 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1420.82 | 1 | | 1 1| | 1 2 1 1 2 2 1 1 2 | | 1 22 2 1 2 12 1 21 2* 1 | | 22 222 11 1 1 2 2 1 1 112 121 2 | | 1 1 1 1 * 1 2 12 * 1 2 1 | | 1 2 2 2 2 1 2 2 2| | 1 2 11 2 2 1 1 2 * 22 1 21 | |2 2 1 2 222 2 1 1 2 1 2 2 | | 1 1 1 2 1 1 | |1 2 1 2 2 | | 2 1 22 2 1 1 | | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1422.62 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1420.79 -1425.13 2 -1420.80 -1423.81 -------------------------------------- TOTAL -1420.79 -1424.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.906132 0.089958 0.346014 1.498441 0.871133 1468.19 1484.60 1.000 r(A<->C){all} 0.171779 0.020016 0.000030 0.447066 0.137692 240.49 248.95 1.002 r(A<->G){all} 0.158744 0.017660 0.000228 0.431435 0.127745 179.08 180.16 1.000 r(A<->T){all} 0.168728 0.020311 0.000025 0.454520 0.130604 201.12 246.69 1.001 r(C<->G){all} 0.166525 0.018588 0.000199 0.431068 0.134617 233.69 438.02 1.000 r(C<->T){all} 0.161523 0.019160 0.000119 0.445028 0.123431 224.73 251.32 1.014 r(G<->T){all} 0.172701 0.020332 0.000067 0.471857 0.136291 145.70 214.99 1.001 pi(A){all} 0.197048 0.000147 0.173946 0.221976 0.196931 1156.55 1232.80 1.000 pi(C){all} 0.273477 0.000190 0.246386 0.300061 0.273429 1044.37 1181.35 1.000 pi(G){all} 0.327252 0.000207 0.297164 0.354976 0.326898 1210.04 1300.91 1.000 pi(T){all} 0.202223 0.000160 0.176765 0.226826 0.202156 1060.36 1202.34 1.000 alpha{1,2} 0.422758 0.236418 0.000149 1.419422 0.252236 1209.69 1224.48 1.000 alpha{3} 0.470568 0.262473 0.000186 1.514822 0.298842 949.26 1137.24 1.000 pinvar{all} 0.998587 0.000003 0.995497 0.999999 0.999119 1160.83 1228.96 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .***.* 8 -- .*.*.. 9 -- .*...* 10 -- ....** 11 -- ..*..* 12 -- .*..*. 13 -- ...*.* 14 -- .*.*** 15 -- .**.** 16 -- ..*.*. 17 -- .****. 18 -- .**... 19 -- ..**.. 20 -- ..**** 21 -- ...**. 22 -- .*.*.* 23 -- .***.. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 470 0.156562 0.004711 0.153231 0.159893 2 8 463 0.154231 0.003298 0.151899 0.156562 2 9 445 0.148235 0.008951 0.141905 0.154564 2 10 442 0.147235 0.005653 0.143238 0.151233 2 11 440 0.146569 0.018844 0.133245 0.159893 2 12 438 0.145903 0.002827 0.143904 0.147901 2 13 435 0.144903 0.004240 0.141905 0.147901 2 14 426 0.141905 0.013191 0.132578 0.151233 2 15 421 0.140240 0.014604 0.129913 0.150566 2 16 420 0.139907 0.001884 0.138574 0.141239 2 17 413 0.137575 0.004240 0.134577 0.140573 2 18 412 0.137242 0.021670 0.121919 0.152565 2 19 406 0.135243 0.006595 0.130580 0.139907 2 20 393 0.130913 0.001413 0.129913 0.131912 2 21 379 0.126249 0.008009 0.120586 0.131912 2 22 299 0.099600 0.008951 0.093271 0.105929 2 23 279 0.092938 0.010835 0.085276 0.100600 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099883 0.009395 0.000047 0.295639 0.071412 1.000 2 length{all}[2] 0.101357 0.009991 0.000071 0.300752 0.069951 1.000 2 length{all}[3] 0.101820 0.010784 0.000018 0.294588 0.071914 1.000 2 length{all}[4] 0.098107 0.009335 0.000038 0.291275 0.067704 1.000 2 length{all}[5] 0.101579 0.009881 0.000048 0.295650 0.070494 1.000 2 length{all}[6] 0.102103 0.010662 0.000002 0.301658 0.069764 1.000 2 length{all}[7] 0.108661 0.014703 0.000142 0.373963 0.073199 1.002 2 length{all}[8] 0.109217 0.012171 0.000060 0.343066 0.078434 0.998 2 length{all}[9] 0.106433 0.012685 0.000478 0.317398 0.070280 1.001 2 length{all}[10] 0.092053 0.009407 0.000120 0.260899 0.067312 1.007 2 length{all}[11] 0.098717 0.009148 0.000044 0.279022 0.069517 1.001 2 length{all}[12] 0.098111 0.007841 0.000160 0.284576 0.076432 0.999 2 length{all}[13] 0.098448 0.010517 0.000315 0.291310 0.068363 1.003 2 length{all}[14] 0.096174 0.010073 0.000002 0.271417 0.075281 0.999 2 length{all}[15] 0.091866 0.007849 0.000405 0.275148 0.064976 0.999 2 length{all}[16] 0.096487 0.008752 0.000017 0.271094 0.071935 1.000 2 length{all}[17] 0.103446 0.009785 0.000025 0.293805 0.078247 0.998 2 length{all}[18] 0.101245 0.010597 0.000045 0.309665 0.068392 1.006 2 length{all}[19] 0.102261 0.009931 0.000047 0.326318 0.070354 1.002 2 length{all}[20] 0.100298 0.009260 0.000797 0.317316 0.073677 0.998 2 length{all}[21] 0.095885 0.008318 0.000061 0.286105 0.071544 1.005 2 length{all}[22] 0.104224 0.011071 0.000177 0.322099 0.073670 1.001 2 length{all}[23] 0.104173 0.011026 0.000477 0.321368 0.070529 1.005 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008230 Maximum standard deviation of split frequencies = 0.021670 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.007 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |-------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1041 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 347 / 347 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 347 / 347 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.029426 0.054112 0.088973 0.015913 0.101406 0.050652 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1485.975760 Iterating by ming2 Initial: fx= 1485.975760 x= 0.02943 0.05411 0.08897 0.01591 0.10141 0.05065 0.30000 1.30000 1 h-m-p 0.0000 0.0000 833.4022 ++ 1453.691305 m 0.0000 13 | 1/8 2 h-m-p 0.0004 0.0038 99.5582 ++ 1451.614210 m 0.0038 24 | 2/8 3 h-m-p 0.0011 0.0056 175.2364 ++ 1443.106960 m 0.0056 35 | 3/8 4 h-m-p 0.0000 0.0001 169.4090 ++ 1438.670339 m 0.0001 46 | 4/8 5 h-m-p 0.0001 0.0012 88.0217 ++ 1400.598009 m 0.0012 57 | 5/8 6 h-m-p 0.0001 0.0003 56.4952 ++ 1398.508102 m 0.0003 68 | 6/8 7 h-m-p 0.0160 8.0000 1.1946 -------------.. | 6/8 8 h-m-p 0.0000 0.0003 319.2653 +++ 1369.714743 m 0.0003 102 | 7/8 9 h-m-p 1.6000 8.0000 0.0000 ++ 1369.714743 m 8.0000 113 | 7/8 10 h-m-p 0.0160 8.0000 0.0011 -------------.. | 7/8 11 h-m-p 0.0160 8.0000 0.0008 +++++ 1369.714738 m 8.0000 151 | 7/8 12 h-m-p 0.0309 8.0000 0.2110 ------------Y 1369.714738 0 0.0000 175 | 7/8 13 h-m-p 0.0160 8.0000 0.0000 +++++ 1369.714738 m 8.0000 190 | 7/8 14 h-m-p 0.0160 8.0000 0.2428 ----------C 1369.714738 0 0.0000 212 | 7/8 15 h-m-p 0.0160 8.0000 0.0002 +++++ 1369.714737 m 8.0000 227 | 7/8 16 h-m-p 0.0160 8.0000 0.2056 ------------N 1369.714737 0 0.0000 251 | 7/8 17 h-m-p 0.0160 8.0000 0.0000 ------Y 1369.714737 0 0.0000 269 | 7/8 18 h-m-p 0.0160 8.0000 0.0000 +++++ 1369.714737 m 8.0000 284 | 7/8 19 h-m-p 0.0160 8.0000 0.0611 ----------Y 1369.714737 0 0.0000 306 | 7/8 20 h-m-p 0.0160 8.0000 0.0000 ------------Y 1369.714737 0 0.0000 330 | 7/8 21 h-m-p 0.0160 8.0000 0.0000 Y 1369.714737 0 0.0040 342 Out.. lnL = -1369.714737 343 lfun, 343 eigenQcodon, 2058 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.078496 0.045405 0.090969 0.034254 0.088683 0.063989 0.000100 0.754412 0.560866 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 11.689606 np = 9 lnL0 = -1504.285388 Iterating by ming2 Initial: fx= 1504.285388 x= 0.07850 0.04540 0.09097 0.03425 0.08868 0.06399 0.00011 0.75441 0.56087 1 h-m-p 0.0000 0.0000 807.7106 ++ 1502.938633 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 658.4273 +++ 1435.378734 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0001 409.8575 ++ 1419.058114 m 0.0001 39 | 3/9 4 h-m-p 0.0001 0.0010 189.1993 ++ 1377.659268 m 0.0010 51 | 4/9 5 h-m-p 0.0000 0.0000 16008.1625 ++ 1371.883157 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0000 2998.2298 ++ 1369.886248 m 0.0000 75 | 6/9 7 h-m-p 0.0000 0.0000 2384.7691 ++ 1369.714852 m 0.0000 87 | 7/9 8 h-m-p 1.6000 8.0000 0.0001 ++ 1369.714852 m 8.0000 99 | 7/9 9 h-m-p 0.0133 6.6667 0.1373 -------------.. | 7/9 10 h-m-p 0.0160 8.0000 0.0004 +++++ 1369.714850 m 8.0000 141 | 7/9 11 h-m-p 0.0160 4.9160 0.2173 ---------Y 1369.714850 0 0.0000 164 | 7/9 12 h-m-p 0.0160 8.0000 0.0001 +++++ 1369.714850 m 8.0000 181 | 7/9 13 h-m-p 0.0060 3.0007 0.2688 ----------C 1369.714850 0 0.0000 205 | 7/9 14 h-m-p 0.0160 8.0000 0.0001 ---------Y 1369.714850 0 0.0000 228 | 7/9 15 h-m-p 0.0160 8.0000 0.0010 +++++ 1369.714847 m 8.0000 245 | 7/9 16 h-m-p 0.0210 2.1753 0.3908 ----------C 1369.714847 0 0.0000 269 | 7/9 17 h-m-p 0.0001 0.0258 5.8004 +++++ 1369.714790 m 0.0258 286 | 8/9 18 h-m-p 0.4484 8.0000 0.0000 ----Y 1369.714790 0 0.0004 302 | 8/9 19 h-m-p 0.0160 8.0000 0.0000 +++++ 1369.714790 m 8.0000 318 | 8/9 20 h-m-p 0.0037 1.8713 0.4187 ------------.. | 8/9 21 h-m-p 0.0160 8.0000 0.0006 +++++ 1369.714787 m 8.0000 357 | 8/9 22 h-m-p 0.0200 3.2470 0.2428 -----------C 1369.714787 0 0.0000 381 | 8/9 23 h-m-p 0.0160 8.0000 0.0000 -----Y 1369.714787 0 0.0000 399 | 8/9 24 h-m-p 0.0160 8.0000 0.0000 +++++ 1369.714787 m 8.0000 415 | 8/9 25 h-m-p 0.0061 3.0724 0.2566 -----------Y 1369.714787 0 0.0000 439 | 8/9 26 h-m-p 0.0160 8.0000 0.0000 --------C 1369.714787 0 0.0000 460 | 8/9 27 h-m-p 0.0160 8.0000 0.0000 ---Y 1369.714787 0 0.0001 476 Out.. lnL = -1369.714787 477 lfun, 1431 eigenQcodon, 5724 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M2:NSpselection reset. 0.019605 0.098240 0.075624 0.091811 0.080356 0.035738 0.000100 0.963872 0.341711 0.292084 2.289224 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.478117 np = 11 lnL0 = -1493.569199 Iterating by ming2 Initial: fx= 1493.569199 x= 0.01960 0.09824 0.07562 0.09181 0.08036 0.03574 0.00011 0.96387 0.34171 0.29208 2.28922 1 h-m-p 0.0000 0.0000 688.4916 ++ 1492.937333 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 326.8337 +++ 1454.957022 m 0.0004 31 | 2/11 3 h-m-p 0.0000 0.0001 311.6058 ++ 1434.381555 m 0.0001 45 | 3/11 4 h-m-p 0.0002 0.0012 144.3026 ++ 1406.708542 m 0.0012 59 | 4/11 5 h-m-p 0.0005 0.0024 68.6847 ++ 1398.480680 m 0.0024 73 | 5/11 6 h-m-p 0.0000 0.0000 17790.8294 ++ 1387.776292 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0001 4507.2882 ++ 1376.279034 m 0.0001 101 | 7/11 8 h-m-p 0.0525 0.2623 8.5102 --------------.. | 7/11 9 h-m-p 0.0000 0.0001 329.0101 ++ 1369.714926 m 0.0001 141 | 8/11 10 h-m-p 0.1902 8.0000 0.0000 +++ 1369.714926 m 8.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.4836 ---------N 1369.714926 0 0.0000 182 | 8/11 12 h-m-p 0.0160 8.0000 0.0001 +++++ 1369.714926 m 8.0000 202 | 8/11 13 h-m-p 0.0160 8.0000 3.2449 ------------N 1369.714926 0 0.0000 231 | 8/11 14 h-m-p 0.0160 8.0000 0.0048 +++++ 1369.714925 m 8.0000 248 | 8/11 15 h-m-p 0.0160 8.0000 3.5415 -----------N 1369.714925 0 0.0000 276 | 8/11 16 h-m-p 0.0160 8.0000 0.0000 -Y 1369.714925 0 0.0010 291 | 8/11 17 h-m-p 0.0160 8.0000 0.0000 -N 1369.714925 0 0.0005 309 Out.. lnL = -1369.714925 310 lfun, 1240 eigenQcodon, 5580 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1369.732189 S = -1369.709547 -0.008689 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:03 did 20 / 57 patterns 0:03 did 30 / 57 patterns 0:03 did 40 / 57 patterns 0:03 did 50 / 57 patterns 0:03 did 57 / 57 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.053035 0.101772 0.044723 0.061173 0.050682 0.051797 0.000100 1.187853 1.050260 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 13.703970 np = 9 lnL0 = -1489.006418 Iterating by ming2 Initial: fx= 1489.006418 x= 0.05304 0.10177 0.04472 0.06117 0.05068 0.05180 0.00011 1.18785 1.05026 1 h-m-p 0.0000 0.0000 778.6224 ++ 1487.975086 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0102 106.2401 +++++ 1392.595812 m 0.0102 29 | 2/9 3 h-m-p 0.0000 0.0000 2293.0114 ++ 1386.390605 m 0.0000 41 | 3/9 4 h-m-p 0.0000 0.0002 611.7570 ++ 1374.802171 m 0.0002 53 | 4/9 5 h-m-p 0.0000 0.0001 307.1755 ++ 1371.156598 m 0.0001 65 | 5/9 6 h-m-p 0.0000 0.0000 645.0274 ++ 1369.965375 m 0.0000 77 | 6/9 7 h-m-p 0.0000 0.0000 289.1717 ++ 1369.714611 m 0.0000 89 | 7/9 8 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 7/9 9 h-m-p 0.0160 8.0000 0.0010 +++++ 1369.714603 m 8.0000 132 | 7/9 10 h-m-p 0.0486 8.0000 0.1656 -------------N 1369.714603 0 0.0000 159 | 7/9 11 h-m-p 0.0160 8.0000 0.0006 +++++ 1369.714600 m 8.0000 176 | 7/9 12 h-m-p 0.0191 8.0000 0.2510 ------------Y 1369.714600 0 0.0000 202 | 7/9 13 h-m-p 0.0160 8.0000 0.0000 ---------N 1369.714600 0 0.0000 225 | 7/9 14 h-m-p 0.0160 8.0000 0.0001 ------------N 1369.714600 0 0.0000 251 Out.. lnL = -1369.714600 252 lfun, 2772 eigenQcodon, 15120 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M8:NSbetaw>1 reset. 0.049594 0.017732 0.067095 0.015328 0.042593 0.086299 0.000100 0.900000 0.490655 1.260641 2.224341 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.773152 np = 11 lnL0 = -1454.085731 Iterating by ming2 Initial: fx= 1454.085731 x= 0.04959 0.01773 0.06710 0.01533 0.04259 0.08630 0.00011 0.90000 0.49066 1.26064 2.22434 1 h-m-p 0.0000 0.0000 673.5056 ++ 1453.488114 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 323.4429 +++ 1426.251917 m 0.0003 31 | 2/11 3 h-m-p 0.0000 0.0000 680.6167 ++ 1422.743939 m 0.0000 45 | 3/11 4 h-m-p 0.0001 0.0045 109.3361 +++ 1385.247079 m 0.0045 60 | 4/11 5 h-m-p 0.0000 0.0000 7882809.7262 ++ 1384.829037 m 0.0000 74 | 5/11 6 h-m-p 0.0001 0.0006 21.1457 ++ 1384.338402 m 0.0006 88 | 6/11 7 h-m-p 0.0000 0.0001 239.6661 ++ 1379.994157 m 0.0001 102 | 7/11 8 h-m-p 0.0001 0.0013 174.6558 +++ 1369.714702 m 0.0013 117 | 8/11 9 h-m-p 1.6000 8.0000 0.0004 ++ 1369.714695 m 8.0000 131 | 8/11 10 h-m-p 0.0403 8.0000 0.0773 --------------.. | 8/11 11 h-m-p 0.0160 8.0000 0.0026 +++++ 1369.714630 m 8.0000 180 | 8/11 12 h-m-p 0.2636 8.0000 0.0798 -------------Y 1369.714630 0 0.0000 210 | 8/11 13 h-m-p 0.0030 1.4763 0.0143 +++++ 1369.714553 m 1.4763 230 | 9/11 14 h-m-p 1.6000 8.0000 0.0000 Y 1369.714553 0 0.4000 247 | 9/11 15 h-m-p 0.1281 8.0000 0.0000 --C 1369.714553 0 0.0020 265 | 9/11 16 h-m-p 0.0456 8.0000 0.0000 C 1369.714553 0 0.0456 281 | 9/11 17 h-m-p 0.0856 8.0000 0.0000 ---------N 1369.714553 0 0.0000 306 Out.. lnL = -1369.714553 307 lfun, 3684 eigenQcodon, 20262 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1369.813079 S = -1369.716106 -0.043516 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:12 did 20 / 57 patterns 0:12 did 30 / 57 patterns 0:13 did 40 / 57 patterns 0:13 did 50 / 57 patterns 0:13 did 57 / 57 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=347 NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR NC_002677_1_NP_302083_1_955_nusA MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR NZ_AP014567_1_WP_010908404_1_1723_nusA MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN NC_002677_1_NP_302083_1_955_nusA KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN NZ_AP014567_1_WP_010908404_1_1723_nusA KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE NC_002677_1_NP_302083_1_955_nusA ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE NZ_AP014567_1_WP_010908404_1_1723_nusA ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI NC_002677_1_NP_302083_1_955_nusA QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI NZ_AP014567_1_WP_010908404_1_1723_nusA QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL NC_002677_1_NP_302083_1_955_nusA ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL NZ_AP014567_1_WP_010908404_1_1723_nusA ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS NC_002677_1_NP_302083_1_955_nusA SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS NZ_AP014567_1_WP_010908404_1_1723_nusA SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS ************************************************** NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER NC_002677_1_NP_302083_1_955_nusA LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER NZ_AP014567_1_WP_010908404_1_1723_nusA LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER ***********************************************
>NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >NC_002677_1_NP_302083_1_955_nusA ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC >NZ_AP014567_1_WP_010908404_1_1723_nusA ATGAACATCGACATGGCTGCGCTACATGCGATCGAGATGGATCGGGGTAT CTCGGTCAATGAGTTGCTCGACACGATTAGGTCCGCCCTGCTAACTGCTT ACCGGCATACCCAGGGGCATCAGATAGACGCGCGTATTGACATCGACCGC AAAACTGGCGTTGTGAAAGTGATCGCCCGCGAAGTCGATGACGATGGCAA TGTCATTAGCGAATGGGATGACACGCCAGAGGGTTTTGGCCGGATCGCGG CTACTACCGCGCGGCAGGTGATGCTGCAACGATTTCGCGACGCCGAAAAT GAGCGCACTTACGGAGAGTTTTCCACCCGCGAGGGTGAGATCGTCGCGGG TGTGATCCAGCGCGACAGCCGGGCCAACGCCCGTGGATTAGTCGTCGTCC GGATGGGTAGTGAGACCAAGGCTTCCGAAGGAGTGATCCCGGCGGCTGAA CAGGTCCTTGGCGAGAGCTACGAACATGGCAACCGTTTGCGGTGCTATGT GGTCGGTGTGACTCGTGGGGCGCGTGAGCCGCTGATCACCTTGTCGCGTA CCCACCCCAACTTGGTACGCAAGCTTTTCTCGTTGGAAGTCCCGGAGATC GCCGACGGGTCGGTGGAGATTGTGTCGGTGGCCCGGGAGGCCGGCCATCG TTCCAAGATTGCGGTGGCCTCCCGCGTTCCCGGTTTGAATGCCAAAGGGG CCTGTATCGGTCCGATGGGCCAACGGGTCCGAAATGTGATGAGCGAACTT TCCGGAGAAAAGATCGACATCATCGATTACGATGAGGACCCGGCCCGTTT CGTCGCCAACGCATTATCGCCCGCGAAGGTGGTCTCGGTGTCGGTTATCG ATCAGACTGCCCGGGCAGCCCGCGTAGTGGTTCCCGACTTTCAGTTGTCT CTGGCCATCGGCAAGGAGGGCCAGAACGCGCGGCTAGCCGCTCGGCTTAC CGGGTGGCGTATCGATATACGCGGTGATTCGCCGCCATGCTCGGCTGGCC AGTCGGAACAGAATGCCAGCCATGGGATGGCCCACGAACGC
>NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >NC_002677_1_NP_302083_1_955_nusA MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER >NZ_AP014567_1_WP_010908404_1_1723_nusA MNIDMAALHAIEMDRGISVNELLDTIRSALLTAYRHTQGHQIDARIDIDR KTGVVKVIAREVDDDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGSETKASEGVIPAAE QVLGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI ADGSVEIVSVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS LAIGKEGQNARLAARLTGWRIDIRGDSPPCSAGQSEQNASHGMAHER
#NEXUS [ID: 9389811390] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 NC_002677_1_NP_302083_1_955_nusA NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 NZ_AP014567_1_WP_010908404_1_1723_nusA ; end; begin trees; translate 1 NC_011896_1_WP_010908404_1_1648_MLBR_RS07835, 2 NC_002677_1_NP_302083_1_955_nusA, 3 NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550, 4 NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145, 5 NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555, 6 NZ_AP014567_1_WP_010908404_1_1723_nusA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07141208,2:0.06995055,3:0.07191394,4:0.06770364,5:0.07049412,6:0.0697638); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07141208,2:0.06995055,3:0.07191394,4:0.06770364,5:0.07049412,6:0.0697638); end;
Estimated marginal likelihoods for runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1420.79 -1425.13 2 -1420.80 -1423.81 -------------------------------------- TOTAL -1420.79 -1424.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/nusA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.906132 0.089958 0.346014 1.498441 0.871133 1468.19 1484.60 1.000 r(A<->C){all} 0.171779 0.020016 0.000030 0.447066 0.137692 240.49 248.95 1.002 r(A<->G){all} 0.158744 0.017660 0.000228 0.431435 0.127745 179.08 180.16 1.000 r(A<->T){all} 0.168728 0.020311 0.000025 0.454520 0.130604 201.12 246.69 1.001 r(C<->G){all} 0.166525 0.018588 0.000199 0.431068 0.134617 233.69 438.02 1.000 r(C<->T){all} 0.161523 0.019160 0.000119 0.445028 0.123431 224.73 251.32 1.014 r(G<->T){all} 0.172701 0.020332 0.000067 0.471857 0.136291 145.70 214.99 1.001 pi(A){all} 0.197048 0.000147 0.173946 0.221976 0.196931 1156.55 1232.80 1.000 pi(C){all} 0.273477 0.000190 0.246386 0.300061 0.273429 1044.37 1181.35 1.000 pi(G){all} 0.327252 0.000207 0.297164 0.354976 0.326898 1210.04 1300.91 1.000 pi(T){all} 0.202223 0.000160 0.176765 0.226826 0.202156 1060.36 1202.34 1.000 alpha{1,2} 0.422758 0.236418 0.000149 1.419422 0.252236 1209.69 1224.48 1.000 alpha{3} 0.470568 0.262473 0.000186 1.514822 0.298842 949.26 1137.24 1.000 pinvar{all} 0.998587 0.000003 0.995497 0.999999 0.999119 1160.83 1228.96 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/nusA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 347 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 4 4 4 4 4 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1 TTC 2 2 2 2 2 2 | TCC 6 6 6 6 6 6 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2 Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 7 7 7 7 7 | TCG 11 11 11 11 11 11 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 4 4 4 4 4 4 | Pro CCT 0 0 0 0 0 0 | His CAT 6 6 6 6 6 6 | Arg CGT 9 9 9 9 9 9 CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 11 11 11 11 11 11 CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2 CTG 4 4 4 4 4 4 | CCG 6 6 6 6 6 6 | CAG 10 10 10 10 10 10 | CGG 12 12 12 12 12 12 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 6 6 6 6 6 6 | Asn AAT 6 6 6 6 6 6 | Ser AGT 1 1 1 1 1 1 ATC 18 18 18 18 18 18 | ACC 7 7 7 7 7 7 | AAC 6 6 6 6 6 6 | AGC 5 5 5 5 5 5 ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 8 8 8 8 8 8 | ACG 2 2 2 2 2 2 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 4 4 4 4 4 4 | Ala GCT 7 7 7 7 7 7 | Asp GAT 9 9 9 9 9 9 | Gly GGT 9 9 9 9 9 9 GTC 13 13 13 13 13 13 | GCC 19 19 19 19 19 19 | GAC 13 13 13 13 13 13 | GGC 10 10 10 10 10 10 GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 11 11 11 11 11 11 | GGA 4 4 4 4 4 4 GTG 15 15 15 15 15 15 | GCG 11 11 11 11 11 11 | GAG 15 15 15 15 15 15 | GGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908404_1_1648_MLBR_RS07835 position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 #2: NC_002677_1_NP_302083_1_955_nusA position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 #3: NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550 position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 #4: NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145 position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 #5: NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555 position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 #6: NZ_AP014567_1_WP_010908404_1_1723_nusA position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 24 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6 TTC 12 | TCC 36 | TAC 24 | TGC 12 Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 42 | TCG 66 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 24 | Pro P CCT 0 | His H CAT 36 | Arg R CGT 54 CTC 6 | CCC 24 | CAC 12 | CGC 66 CTA 18 | CCA 12 | Gln Q CAA 12 | CGA 12 CTG 24 | CCG 36 | CAG 60 | CGG 72 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 36 | Asn N AAT 36 | Ser S AGT 6 ATC 108 | ACC 42 | AAC 36 | AGC 30 ATA 12 | ACA 0 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 48 | ACG 12 | AAG 36 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 24 | Ala A GCT 42 | Asp D GAT 54 | Gly G GGT 54 GTC 78 | GCC 114 | GAC 78 | GGC 60 GTA 12 | GCA 12 | Glu E GAA 66 | GGA 24 GTG 90 | GCG 66 | GAG 90 | GGG 36 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12392 C:0.22478 A:0.21902 G:0.43228 position 2: T:0.27089 C:0.24207 A:0.27089 G:0.21614 position 3: T:0.21037 C:0.35447 A:0.10086 G:0.33429 Average T:0.20173 C:0.27378 A:0.19693 G:0.32757 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1369.714737 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.141845 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908404_1_1648_MLBR_RS07835: 0.000004, NC_002677_1_NP_302083_1_955_nusA: 0.000004, NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550: 0.000004, NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145: 0.000004, NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555: 0.000004, NZ_AP014567_1_WP_010908404_1_1723_nusA: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 0.14184 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 7..2 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 7..3 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 7..4 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 7..5 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 7..6 0.000 820.9 220.1 0.1418 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1369.714787 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.211698 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908404_1_1648_MLBR_RS07835: 0.000004, NC_002677_1_NP_302083_1_955_nusA: 0.000004, NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550: 0.000004, NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145: 0.000004, NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555: 0.000004, NZ_AP014567_1_WP_010908404_1_1723_nusA: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.21170 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 7..2 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 7..3 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 7..4 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 7..5 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 7..6 0.000 820.9 220.1 0.2117 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1369.714925 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.628510 0.196904 0.000001 2.473517 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908404_1_1648_MLBR_RS07835: 0.000004, NC_002677_1_NP_302083_1_955_nusA: 0.000004, NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550: 0.000004, NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145: 0.000004, NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555: 0.000004, NZ_AP014567_1_WP_010908404_1_1723_nusA: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.62851 0.19690 0.17459 w: 0.00000 1.00000 2.47352 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 7..2 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 7..3 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 7..4 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 7..5 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 7..6 0.000 820.9 220.1 0.6287 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908404_1_1648_MLBR_RS07835) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908404_1_1648_MLBR_RS07835) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1369.714600 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.054158 1.540741 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908404_1_1648_MLBR_RS07835: 0.000004, NC_002677_1_NP_302083_1_955_nusA: 0.000004, NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550: 0.000004, NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145: 0.000004, NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555: 0.000004, NZ_AP014567_1_WP_010908404_1_1723_nusA: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.05416 q = 1.54074 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00019 0.00263 0.02682 0.23336 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 7..2 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 7..3 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 7..4 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 7..5 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 7..6 0.000 820.9 220.1 0.0263 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1369.714553 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.435280 2.469795 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908404_1_1648_MLBR_RS07835: 0.000004, NC_002677_1_NP_302083_1_955_nusA: 0.000004, NZ_LVXE01000006_1_WP_010908404_1_2272_A3216_RS03550: 0.000004, NZ_LYPH01000002_1_WP_010908404_1_240_A8144_RS01145: 0.000004, NZ_CP029543_1_WP_010908404_1_1681_DIJ64_RS08555: 0.000004, NZ_AP014567_1_WP_010908404_1_1723_nusA: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.43528 (p1 = 0.00001) w = 2.46980 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.46980 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 820.9 220.1 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908404_1_1648_MLBR_RS07835) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.093 0.094 0.096 0.097 0.099 0.101 0.102 0.104 0.106 0.108 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.107 0.105 0.104 0.102 0.101 0.099 0.098 0.096 0.095 0.093 Time used: 0:13
Model 1: NearlyNeutral -1369.714787 Model 2: PositiveSelection -1369.714925 Model 0: one-ratio -1369.714737 Model 7: beta -1369.7146 Model 8: beta&w>1 -1369.714553 Model 0 vs 1 9.999999974752427E-5 Model 2 vs 1 2.760000002126617E-4 Model 8 vs 7 9.399999999004649E-5