--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:05:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/nusB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -779.10 -782.81
2 -779.13 -782.23
--------------------------------------
TOTAL -779.11 -782.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899324 0.091660 0.401275 1.546566 0.865214 1501.00 1501.00 1.000
r(A<->C){all} 0.155684 0.016981 0.000017 0.411864 0.120694 180.97 216.81 1.000
r(A<->G){all} 0.171941 0.020569 0.000109 0.460863 0.134891 158.88 245.51 1.007
r(A<->T){all} 0.178676 0.021870 0.000108 0.475011 0.139289 159.43 194.78 1.000
r(C<->G){all} 0.161240 0.017848 0.000075 0.433202 0.127880 255.77 258.89 1.000
r(C<->T){all} 0.162131 0.018752 0.000081 0.430800 0.127466 228.40 251.63 1.000
r(G<->T){all} 0.170329 0.019726 0.000158 0.449415 0.135381 214.13 263.99 1.006
pi(A){all} 0.195220 0.000276 0.162750 0.228088 0.194646 1319.78 1410.39 1.000
pi(C){all} 0.285208 0.000343 0.248631 0.321133 0.284861 1266.81 1288.42 1.000
pi(G){all} 0.316940 0.000377 0.278038 0.354335 0.316760 1351.69 1364.65 1.000
pi(T){all} 0.202633 0.000275 0.170005 0.234033 0.202213 1325.37 1370.90 1.000
alpha{1,2} 0.430766 0.238047 0.000121 1.413899 0.257750 1036.53 1146.74 1.000
alpha{3} 0.460990 0.232205 0.000818 1.435770 0.304065 1290.70 1327.21 1.000
pinvar{all} 0.997209 0.000013 0.991460 0.999999 0.998349 1171.33 1189.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -744.657125
Model 2: PositiveSelection -744.657036
Model 0: one-ratio -744.657224
Model 7: beta -744.657036
Model 8: beta&w>1 -744.65717
Model 0 vs 1 1.9800000018221908E-4
Model 2 vs 1 1.7800000000534055E-4
Model 8 vs 7 2.6800000000548607E-4
>C1
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C2
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C3
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C4
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C5
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C6
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190
C1 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C2 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C3 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C4 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C5 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C6 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
**************************************************
C1 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C2 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C3 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C4 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C5 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C6 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
**************************************************
C1 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C2 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C3 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C4 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C5 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C6 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
**************************************************
C1 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C2 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C3 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C4 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C5 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C6 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5700]--->[5700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.731 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C2 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C3 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C4 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C5 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
C6 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
**************************************************
C1 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C2 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C3 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C4 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C5 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
C6 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
**************************************************
C1 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C2 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C3 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C4 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C5 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
C6 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
**************************************************
C1 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C2 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C3 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C4 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C5 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
C6 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
C2 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
C3 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
C4 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
C5 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
C6 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
**************************************************
C1 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
C2 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
C3 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
C4 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
C5 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
C6 CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
**************************************************
C1 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
C2 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
C3 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
C4 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
C5 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
C6 AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
**************************************************
C1 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
C2 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
C3 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
C4 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
C5 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
C6 CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
**************************************************
C1 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
C2 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
C3 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
C4 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
C5 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
C6 TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
**************************************************
C1 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
C2 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
C3 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
C4 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
C5 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
C6 CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
**************************************************
C1 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
C2 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
C3 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
C4 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
C5 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
C6 GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
**************************************************
C1 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
C2 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
C3 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
C4 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
C5 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
C6 CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
**************************************************
C1 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
C2 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
C3 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
C4 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
C5 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
C6 GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
**************************************************
C1 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
C2 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
C3 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
C4 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
C5 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
C6 CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
**************************************************
C1 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
C2 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
C3 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
C4 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
C5 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
C6 GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
**************************************************
C1 AAGTCGCTGCTGTCTGCCGG
C2 AAGTCGCTGCTGTCTGCCGG
C3 AAGTCGCTGCTGTCTGCCGG
C4 AAGTCGCTGCTGTCTGCCGG
C5 AAGTCGCTGCTGTCTGCCGG
C6 AAGTCGCTGCTGTCTGCCGG
********************
>C1
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C2
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C3
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C4
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C5
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C6
ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA
CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG
AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT
CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT
TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC
CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC
GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC
CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG
GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC
CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA
GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC
AAGTCGCTGCTGTCTGCCGG
>C1
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C2
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C3
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C4
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C5
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
>C6
MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 570 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784631
Setting output file names to "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1057691789
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9114536287
Seed = 1656457244
Swapseed = 1579784631
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1275.687325 -- -24.965149
Chain 2 -- -1275.687325 -- -24.965149
Chain 3 -- -1275.687325 -- -24.965149
Chain 4 -- -1275.687325 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1275.687131 -- -24.965149
Chain 2 -- -1275.687325 -- -24.965149
Chain 3 -- -1275.687325 -- -24.965149
Chain 4 -- -1275.687325 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1275.687] (-1275.687) (-1275.687) (-1275.687) * [-1275.687] (-1275.687) (-1275.687) (-1275.687)
500 -- (-796.507) (-806.113) [-785.685] (-790.353) * (-785.544) (-793.487) (-799.740) [-790.799] -- 0:00:00
1000 -- (-796.783) (-783.708) [-788.111] (-791.340) * (-786.451) (-786.688) [-786.523] (-786.564) -- 0:00:00
1500 -- (-785.086) [-788.460] (-802.548) (-789.956) * (-794.020) (-794.041) (-784.591) [-791.278] -- 0:00:00
2000 -- [-788.796] (-789.997) (-786.783) (-789.135) * (-790.417) (-790.745) [-787.648] (-791.403) -- 0:00:00
2500 -- (-794.367) [-787.108] (-788.296) (-787.607) * (-792.114) (-788.154) [-784.883] (-795.064) -- 0:00:00
3000 -- [-794.188] (-787.235) (-787.726) (-787.051) * (-792.485) (-785.863) (-791.827) [-790.988] -- 0:00:00
3500 -- [-788.228] (-800.449) (-787.000) (-788.756) * (-796.947) (-788.495) [-784.883] (-788.068) -- 0:00:00
4000 -- [-787.119] (-792.290) (-788.741) (-785.297) * (-789.056) [-790.103] (-790.541) (-789.984) -- 0:00:00
4500 -- (-786.168) (-790.339) [-783.928] (-794.402) * [-787.371] (-790.462) (-789.351) (-790.481) -- 0:00:00
5000 -- (-796.100) (-788.240) [-791.336] (-784.873) * (-787.811) (-792.170) [-795.517] (-797.430) -- 0:00:00
Average standard deviation of split frequencies: 0.097274
5500 -- (-788.757) (-791.074) [-785.688] (-787.777) * [-786.471] (-786.564) (-785.483) (-793.428) -- 0:00:00
6000 -- (-788.827) (-788.593) (-784.838) [-787.489] * [-785.646] (-794.349) (-789.847) (-797.357) -- 0:00:00
6500 -- (-790.667) (-790.845) [-783.541] (-790.427) * (-789.647) [-783.068] (-788.718) (-788.740) -- 0:00:00
7000 -- (-792.444) (-787.334) [-787.259] (-787.137) * (-787.658) (-791.629) (-787.238) [-792.507] -- 0:00:00
7500 -- [-787.143] (-792.574) (-792.538) (-788.010) * (-791.252) (-789.835) (-794.202) [-781.109] -- 0:00:00
8000 -- [-791.674] (-800.621) (-790.633) (-790.626) * (-792.355) (-786.881) [-789.505] (-789.317) -- 0:00:00
8500 -- [-789.898] (-785.443) (-785.308) (-798.273) * (-790.695) (-784.957) [-791.414] (-788.697) -- 0:00:00
9000 -- (-790.051) (-784.440) (-793.074) [-787.195] * (-790.514) (-787.606) [-788.546] (-786.299) -- 0:00:00
9500 -- (-790.142) (-789.462) [-787.855] (-788.567) * (-797.837) (-793.944) [-793.469] (-784.623) -- 0:00:00
10000 -- [-799.992] (-790.861) (-788.020) (-793.375) * (-798.789) (-789.213) (-787.199) [-789.339] -- 0:00:00
Average standard deviation of split frequencies: 0.068300
10500 -- [-797.112] (-788.771) (-786.399) (-788.852) * [-785.052] (-788.649) (-789.140) (-786.080) -- 0:00:00
11000 -- [-787.277] (-796.823) (-791.078) (-795.739) * [-787.144] (-790.557) (-796.649) (-784.247) -- 0:00:00
11500 -- (-790.242) (-784.119) (-786.487) [-787.612] * [-792.801] (-785.193) (-783.550) (-788.541) -- 0:00:00
12000 -- (-787.693) [-789.074] (-787.870) (-792.472) * (-792.153) (-789.690) (-779.837) [-787.200] -- 0:00:00
12500 -- [-784.360] (-788.982) (-806.620) (-792.111) * (-796.236) (-801.426) (-778.857) [-785.101] -- 0:00:00
13000 -- (-786.748) [-787.402] (-796.688) (-788.231) * (-788.302) [-783.588] (-779.740) (-789.422) -- 0:00:00
13500 -- [-791.525] (-793.197) (-797.688) (-787.100) * (-783.302) [-794.933] (-778.277) (-787.758) -- 0:00:00
14000 -- (-783.878) (-785.153) (-786.865) [-785.729] * [-795.210] (-794.707) (-782.007) (-791.839) -- 0:00:00
14500 -- [-793.173] (-792.052) (-790.436) (-790.238) * (-786.461) [-785.576] (-781.189) (-787.622) -- 0:01:07
15000 -- (-794.234) [-790.104] (-790.555) (-790.399) * [-782.759] (-795.672) (-782.186) (-790.485) -- 0:01:05
Average standard deviation of split frequencies: 0.071331
15500 -- (-798.777) (-790.372) (-786.322) [-794.322] * (-789.068) (-791.515) [-782.152] (-789.526) -- 0:01:03
16000 -- (-800.453) [-786.807] (-794.375) (-791.950) * (-794.862) [-790.257] (-784.794) (-793.581) -- 0:01:01
16500 -- (-780.732) (-791.975) (-782.377) [-789.545] * [-785.842] (-783.795) (-779.517) (-786.719) -- 0:00:59
17000 -- (-778.968) (-784.404) [-791.600] (-788.349) * [-785.380] (-796.709) (-778.732) (-791.358) -- 0:00:57
17500 -- (-778.115) (-800.112) [-785.785] (-784.024) * [-790.905] (-792.465) (-779.289) (-790.667) -- 0:00:56
18000 -- (-778.786) (-786.019) [-785.949] (-793.758) * (-795.288) (-788.277) [-778.420] (-783.902) -- 0:00:54
18500 -- (-780.787) (-785.600) (-793.960) [-789.935] * (-792.048) (-786.501) [-777.965] (-786.225) -- 0:00:53
19000 -- (-778.635) (-791.923) (-797.185) [-787.177] * [-791.258] (-787.831) (-779.598) (-793.791) -- 0:00:51
19500 -- [-778.971] (-784.044) (-795.663) (-789.578) * (-791.729) [-783.783] (-777.947) (-796.588) -- 0:00:50
20000 -- [-778.918] (-780.182) (-795.978) (-785.577) * (-787.568) [-789.466] (-778.001) (-784.420) -- 0:00:49
Average standard deviation of split frequencies: 0.052329
20500 -- (-780.699) (-778.870) [-779.711] (-793.666) * (-787.145) (-795.393) [-779.949] (-792.504) -- 0:00:47
21000 -- (-777.813) (-780.584) [-781.025] (-794.574) * [-792.311] (-782.736) (-782.449) (-791.216) -- 0:00:46
21500 -- (-778.832) (-779.973) (-781.658) [-788.603] * [-797.847] (-780.579) (-782.585) (-788.785) -- 0:00:45
22000 -- (-777.999) (-779.073) [-780.207] (-791.188) * (-787.031) (-780.321) (-781.663) [-792.407] -- 0:00:44
22500 -- (-777.655) (-785.937) (-780.667) [-786.298] * (-791.042) (-783.002) [-780.631] (-786.022) -- 0:00:43
23000 -- (-778.063) (-778.752) [-781.291] (-789.086) * [-788.849] (-781.355) (-779.622) (-797.886) -- 0:00:42
23500 -- (-779.300) (-778.871) [-779.761] (-785.014) * [-790.159] (-784.153) (-780.264) (-797.619) -- 0:00:41
24000 -- [-778.788] (-780.635) (-783.608) (-793.119) * (-789.080) [-780.460] (-778.501) (-782.085) -- 0:00:40
24500 -- (-781.345) (-779.734) (-784.224) [-787.431] * (-789.435) (-778.527) [-779.038] (-782.205) -- 0:00:39
25000 -- (-781.648) [-780.433] (-778.810) (-788.119) * [-788.693] (-779.401) (-779.714) (-780.703) -- 0:00:39
Average standard deviation of split frequencies: 0.052816
25500 -- (-780.961) (-781.293) [-780.471] (-793.784) * [-791.006] (-778.960) (-778.589) (-780.735) -- 0:00:38
26000 -- (-780.399) (-783.575) (-779.633) [-786.222] * [-788.111] (-782.821) (-778.591) (-782.385) -- 0:00:37
26500 -- (-781.984) (-778.995) (-779.272) [-790.539] * [-784.660] (-778.238) (-779.665) (-785.109) -- 0:00:36
27000 -- (-780.959) [-778.913] (-780.541) (-783.593) * [-783.598] (-780.606) (-778.950) (-782.876) -- 0:00:36
27500 -- (-780.097) [-780.419] (-782.175) (-792.515) * (-782.160) (-778.664) [-778.732] (-779.016) -- 0:00:35
28000 -- (-779.131) [-779.922] (-783.043) (-791.584) * (-788.307) (-780.929) (-782.707) [-781.441] -- 0:00:34
28500 -- (-779.974) (-779.345) (-782.637) [-790.228] * (-796.712) (-778.847) [-779.926] (-779.704) -- 0:00:34
29000 -- (-781.796) [-782.410] (-784.544) (-786.034) * (-785.452) [-779.808] (-782.306) (-779.259) -- 0:00:33
29500 -- (-781.552) (-780.570) [-778.679] (-786.090) * (-785.511) [-782.630] (-778.632) (-778.500) -- 0:00:32
30000 -- [-780.191] (-780.610) (-778.271) (-784.846) * (-785.745) (-780.787) (-779.241) [-780.543] -- 0:00:32
Average standard deviation of split frequencies: 0.049776
30500 -- (-782.712) (-778.675) [-780.254] (-785.229) * (-785.247) [-780.083] (-781.538) (-778.934) -- 0:01:03
31000 -- (-778.444) (-779.094) (-778.754) [-782.100] * (-791.463) [-782.721] (-782.005) (-779.515) -- 0:01:02
31500 -- (-782.202) (-779.769) (-779.779) [-786.397] * (-789.686) [-778.764] (-778.612) (-779.524) -- 0:01:01
32000 -- (-782.698) (-783.950) [-780.737] (-786.463) * (-788.046) [-778.903] (-779.285) (-780.166) -- 0:01:00
32500 -- (-779.567) (-778.083) (-779.838) [-787.443] * (-784.120) (-779.456) [-779.992] (-778.994) -- 0:00:59
33000 -- [-778.790] (-780.676) (-781.521) (-792.867) * (-786.561) (-781.702) (-780.339) [-778.287] -- 0:00:58
33500 -- (-780.278) (-781.028) (-779.672) [-787.423] * (-789.573) [-780.527] (-779.791) (-780.338) -- 0:00:57
34000 -- (-778.794) (-779.583) (-782.032) [-796.794] * (-790.687) (-780.907) [-779.254] (-777.882) -- 0:00:56
34500 -- (-778.979) [-778.321] (-781.983) (-792.596) * (-789.020) (-781.218) (-780.328) [-777.659] -- 0:00:55
35000 -- (-780.191) (-778.285) (-783.993) [-787.814] * (-799.875) (-778.763) [-781.547] (-778.162) -- 0:00:55
Average standard deviation of split frequencies: 0.045236
35500 -- (-778.686) (-779.534) [-781.487] (-789.415) * (-792.272) [-783.474] (-780.620) (-779.380) -- 0:00:54
36000 -- (-778.823) [-782.189] (-779.815) (-785.666) * (-783.822) (-780.521) (-779.442) [-779.998] -- 0:00:53
36500 -- [-778.731] (-786.141) (-782.932) (-797.770) * (-786.821) [-782.297] (-781.622) (-778.414) -- 0:00:52
37000 -- (-779.429) [-783.015] (-778.833) (-788.896) * (-788.115) (-778.096) [-780.805] (-779.350) -- 0:00:52
37500 -- (-780.339) (-780.931) [-778.358] (-794.471) * (-800.903) (-778.052) [-784.795] (-780.232) -- 0:00:51
38000 -- (-779.777) (-779.102) (-778.514) [-786.175] * (-781.739) [-779.963] (-781.034) (-779.783) -- 0:00:50
38500 -- (-780.399) (-779.914) [-779.923] (-791.418) * (-781.094) (-777.759) [-778.409] (-779.931) -- 0:00:49
39000 -- (-781.375) (-781.614) [-782.561] (-790.212) * [-778.648] (-778.205) (-779.994) (-782.130) -- 0:00:49
39500 -- (-778.982) [-781.675] (-781.478) (-795.964) * [-780.133] (-779.411) (-779.889) (-780.710) -- 0:00:48
40000 -- (-782.164) (-779.014) [-780.779] (-787.574) * (-780.777) (-779.559) (-778.748) [-780.325] -- 0:00:48
Average standard deviation of split frequencies: 0.035996
40500 -- (-779.076) (-781.380) [-779.623] (-792.921) * [-782.011] (-777.674) (-778.234) (-779.538) -- 0:00:47
41000 -- [-777.929] (-778.657) (-782.266) (-790.649) * [-780.567] (-777.901) (-779.338) (-779.096) -- 0:00:46
41500 -- (-778.280) [-778.092] (-780.673) (-786.489) * (-782.672) (-781.533) [-780.191] (-780.180) -- 0:00:46
42000 -- (-780.033) (-777.818) (-782.716) [-788.428] * [-778.655] (-781.697) (-778.771) (-780.051) -- 0:00:45
42500 -- (-781.951) (-779.385) [-778.678] (-784.237) * (-781.250) (-784.700) (-782.535) [-779.511] -- 0:00:45
43000 -- (-783.376) [-779.425] (-780.474) (-790.599) * [-777.888] (-782.160) (-778.373) (-782.487) -- 0:00:44
43500 -- (-780.947) [-778.861] (-779.071) (-788.104) * (-780.606) (-781.759) (-778.544) [-779.897] -- 0:00:43
44000 -- (-781.381) (-779.881) [-778.850] (-789.466) * (-779.627) (-780.822) (-783.779) [-778.252] -- 0:00:43
44500 -- [-781.501] (-779.013) (-780.675) (-811.454) * [-780.705] (-779.990) (-779.603) (-781.403) -- 0:00:42
45000 -- (-780.275) (-780.437) (-783.050) [-780.787] * (-782.938) [-778.725] (-779.036) (-781.619) -- 0:00:42
Average standard deviation of split frequencies: 0.031720
45500 -- (-777.656) (-779.850) [-778.718] (-779.593) * [-785.195] (-780.294) (-779.831) (-778.668) -- 0:00:41
46000 -- [-779.087] (-779.246) (-779.808) (-780.429) * [-779.008] (-778.436) (-781.937) (-780.878) -- 0:00:41
46500 -- (-779.078) (-779.422) (-780.100) [-785.116] * (-781.505) (-779.178) (-779.109) [-781.173] -- 0:00:41
47000 -- (-779.381) (-780.151) (-778.680) [-779.448] * [-785.283] (-779.195) (-785.065) (-781.298) -- 0:00:40
47500 -- (-779.506) (-779.672) (-778.777) [-777.596] * (-781.228) (-778.359) (-783.048) [-777.824] -- 0:01:00
48000 -- [-778.122] (-781.486) (-779.315) (-779.332) * (-777.824) [-778.581] (-778.483) (-778.256) -- 0:00:59
48500 -- [-778.253] (-779.513) (-781.137) (-779.309) * (-781.096) [-780.530] (-779.846) (-778.440) -- 0:00:58
49000 -- (-778.711) (-778.243) [-779.655] (-778.917) * (-779.467) (-778.972) [-778.588] (-780.228) -- 0:00:58
49500 -- (-782.740) (-780.076) (-784.174) [-779.398] * (-779.362) [-781.563] (-778.943) (-781.961) -- 0:00:57
50000 -- (-778.254) [-780.647] (-781.779) (-779.691) * (-779.118) (-779.009) (-779.257) [-781.609] -- 0:00:57
Average standard deviation of split frequencies: 0.028843
50500 -- [-777.655] (-783.262) (-778.180) (-780.699) * (-784.608) (-781.535) (-784.919) [-780.084] -- 0:00:56
51000 -- [-777.872] (-780.235) (-778.992) (-778.977) * (-781.759) [-783.492] (-783.341) (-779.185) -- 0:00:55
51500 -- (-778.719) [-779.110] (-781.784) (-779.645) * (-778.424) (-778.835) (-779.725) [-779.758] -- 0:00:55
52000 -- (-781.133) (-779.823) (-779.134) [-780.682] * (-778.821) (-780.266) [-779.882] (-777.964) -- 0:00:54
52500 -- (-779.862) (-779.789) [-785.161] (-779.266) * (-779.551) (-778.908) [-780.192] (-779.003) -- 0:00:54
53000 -- (-779.657) [-781.397] (-791.885) (-778.307) * [-779.650] (-781.989) (-784.603) (-778.874) -- 0:00:53
53500 -- (-779.976) (-780.374) (-787.987) [-779.324] * (-779.485) (-779.004) (-781.495) [-777.981] -- 0:00:53
54000 -- [-778.929] (-780.131) (-782.150) (-781.742) * (-781.857) (-778.561) [-778.256] (-779.874) -- 0:00:52
54500 -- [-780.381] (-779.991) (-780.407) (-779.761) * [-780.121] (-778.950) (-780.156) (-783.295) -- 0:00:52
55000 -- (-782.660) (-779.199) (-780.605) [-782.037] * (-778.642) [-783.629] (-781.018) (-782.951) -- 0:00:51
Average standard deviation of split frequencies: 0.025620
55500 -- [-778.646] (-781.892) (-781.233) (-779.316) * (-780.113) [-780.892] (-783.302) (-781.221) -- 0:00:51
56000 -- (-778.776) (-778.903) (-781.033) [-778.812] * (-778.790) [-780.836] (-779.028) (-780.227) -- 0:00:50
56500 -- (-786.610) [-779.979] (-778.900) (-778.303) * [-781.666] (-783.610) (-779.141) (-783.452) -- 0:00:50
57000 -- (-783.151) (-779.187) [-780.584] (-784.501) * (-782.235) [-777.639] (-778.208) (-785.964) -- 0:00:49
57500 -- (-784.300) [-780.416] (-780.243) (-780.610) * (-780.049) (-778.215) [-778.779] (-779.996) -- 0:00:49
58000 -- (-782.013) (-788.912) (-784.500) [-779.648] * (-778.336) (-779.121) (-780.234) [-779.533] -- 0:00:48
58500 -- (-777.676) (-783.757) (-779.207) [-780.477] * (-777.906) [-777.863] (-781.309) (-779.521) -- 0:00:48
59000 -- (-778.454) (-778.309) [-778.330] (-778.788) * (-778.396) (-779.437) [-779.557] (-781.769) -- 0:00:47
59500 -- (-777.997) [-782.880] (-780.016) (-782.092) * (-779.296) (-779.894) [-778.986] (-785.832) -- 0:00:47
60000 -- (-777.616) (-779.512) [-780.850] (-783.642) * (-780.033) (-779.050) (-780.101) [-779.590] -- 0:00:47
Average standard deviation of split frequencies: 0.029528
60500 -- (-778.768) (-778.626) [-781.512] (-783.266) * (-779.780) (-783.911) (-778.137) [-780.362] -- 0:00:46
61000 -- (-784.611) (-781.767) [-783.255] (-780.429) * [-779.216] (-782.424) (-778.098) (-779.671) -- 0:00:46
61500 -- (-779.338) [-783.049] (-780.060) (-779.834) * (-778.859) (-785.306) (-786.555) [-779.186] -- 0:00:45
62000 -- [-781.095] (-781.292) (-780.180) (-782.553) * (-781.838) (-780.158) [-777.996] (-780.317) -- 0:00:45
62500 -- (-779.323) (-780.789) [-779.136] (-782.695) * [-780.824] (-779.883) (-778.401) (-777.903) -- 0:00:45
63000 -- (-780.360) (-781.192) [-779.566] (-779.302) * (-779.228) (-778.169) (-780.062) [-777.504] -- 0:00:44
63500 -- (-779.596) (-782.606) (-784.136) [-780.144] * [-779.794] (-779.026) (-779.342) (-780.067) -- 0:00:44
64000 -- (-778.479) (-788.281) (-783.095) [-781.270] * (-782.887) (-780.987) (-779.982) [-778.474] -- 0:00:58
64500 -- [-778.553] (-782.221) (-779.763) (-786.227) * (-779.291) (-779.437) [-780.325] (-779.451) -- 0:00:58
65000 -- (-780.278) [-779.440] (-779.098) (-784.467) * (-782.154) (-778.319) (-781.042) [-779.083] -- 0:00:57
Average standard deviation of split frequencies: 0.029502
65500 -- (-779.846) (-780.513) [-778.225] (-781.259) * (-779.278) (-781.857) [-780.346] (-779.796) -- 0:00:57
66000 -- (-783.169) (-781.750) (-780.231) [-778.940] * (-783.626) [-780.361] (-784.333) (-779.398) -- 0:00:56
66500 -- (-783.081) (-779.338) (-781.981) [-778.406] * (-780.485) [-779.727] (-780.893) (-782.684) -- 0:00:56
67000 -- (-780.859) (-780.157) [-778.119] (-778.399) * (-778.985) (-779.289) (-777.982) [-779.839] -- 0:00:55
67500 -- [-778.516] (-779.892) (-781.013) (-781.441) * (-779.342) [-778.989] (-777.632) (-781.067) -- 0:00:55
68000 -- (-781.049) (-781.907) (-783.399) [-781.338] * (-782.269) [-780.334] (-777.929) (-780.364) -- 0:00:54
68500 -- (-778.997) (-784.794) (-781.191) [-778.498] * (-780.541) (-780.546) [-778.019] (-781.865) -- 0:00:54
69000 -- (-778.119) (-784.042) (-780.225) [-778.786] * [-779.028] (-780.647) (-778.799) (-781.661) -- 0:00:53
69500 -- (-779.177) (-780.557) (-782.398) [-780.650] * (-778.033) [-781.683] (-777.907) (-781.878) -- 0:00:53
70000 -- (-778.493) [-780.727] (-778.881) (-779.175) * (-780.011) [-778.946] (-780.457) (-778.586) -- 0:00:53
Average standard deviation of split frequencies: 0.023507
70500 -- (-777.695) (-779.118) [-777.598] (-781.475) * (-780.202) [-779.411] (-781.990) (-780.109) -- 0:00:52
71000 -- (-779.702) (-780.429) (-777.837) [-778.978] * (-779.694) (-781.087) (-779.427) [-779.585] -- 0:00:52
71500 -- [-779.278] (-782.580) (-777.523) (-779.787) * (-781.132) (-779.943) (-780.087) [-780.504] -- 0:00:51
72000 -- (-780.110) [-783.345] (-778.743) (-779.292) * (-780.434) (-783.161) [-780.071] (-780.204) -- 0:00:51
72500 -- [-778.081] (-781.399) (-780.487) (-779.711) * (-778.070) [-780.498] (-778.555) (-778.461) -- 0:00:51
73000 -- [-779.339] (-780.287) (-780.482) (-782.562) * (-778.226) (-784.959) (-780.146) [-779.086] -- 0:00:50
73500 -- (-778.600) [-778.084] (-779.942) (-780.184) * [-778.425] (-778.496) (-777.522) (-779.232) -- 0:00:50
74000 -- (-779.862) (-777.448) [-778.384] (-779.383) * [-778.057] (-779.132) (-778.517) (-780.288) -- 0:00:50
74500 -- (-779.782) (-786.177) [-780.326] (-779.934) * (-778.084) [-779.198] (-780.144) (-783.819) -- 0:00:49
75000 -- (-779.752) [-779.591] (-783.542) (-778.033) * [-777.636] (-777.816) (-778.978) (-781.524) -- 0:00:49
Average standard deviation of split frequencies: 0.022526
75500 -- (-778.365) (-778.488) (-787.466) [-778.619] * (-777.630) [-778.784] (-779.407) (-779.900) -- 0:00:48
76000 -- (-778.866) (-778.479) (-788.958) [-780.902] * (-778.201) (-782.207) (-780.896) [-781.808] -- 0:00:48
76500 -- (-779.181) (-778.347) [-780.793] (-785.517) * (-784.669) (-781.914) [-779.368] (-783.883) -- 0:00:48
77000 -- (-779.808) [-778.868] (-781.080) (-783.871) * [-782.443] (-782.149) (-780.576) (-781.940) -- 0:00:47
77500 -- (-778.393) (-781.312) (-782.360) [-778.990] * (-783.553) (-782.154) (-782.487) [-779.357] -- 0:00:47
78000 -- (-777.771) (-781.578) (-785.749) [-778.370] * (-782.302) (-780.602) (-779.086) [-781.663] -- 0:00:47
78500 -- [-777.771] (-782.578) (-778.745) (-781.822) * [-783.426] (-779.569) (-781.485) (-783.598) -- 0:00:46
79000 -- (-778.276) (-782.086) [-778.758] (-779.534) * [-778.665] (-778.612) (-781.754) (-780.478) -- 0:00:46
79500 -- [-778.884] (-780.035) (-778.761) (-780.813) * (-779.397) (-781.966) (-780.667) [-781.100] -- 0:00:46
80000 -- (-778.546) (-782.120) [-778.233] (-781.998) * (-781.241) (-781.846) (-780.793) [-778.170] -- 0:00:46
Average standard deviation of split frequencies: 0.017239
80500 -- (-779.573) (-780.352) (-783.665) [-778.434] * [-782.065] (-782.390) (-778.933) (-785.032) -- 0:00:45
81000 -- (-783.486) (-778.714) (-781.106) [-783.095] * [-782.879] (-779.118) (-781.852) (-780.901) -- 0:00:56
81500 -- (-777.996) [-777.834] (-781.337) (-779.130) * (-779.921) (-783.882) [-780.363] (-781.777) -- 0:00:56
82000 -- (-779.450) [-779.810] (-777.946) (-779.972) * (-779.663) (-780.499) [-782.176] (-783.571) -- 0:00:55
82500 -- (-780.070) (-781.190) [-778.198] (-782.433) * [-779.730] (-780.968) (-779.260) (-781.437) -- 0:00:55
83000 -- (-780.647) (-781.799) (-779.531) [-779.660] * (-780.920) (-778.884) [-779.905] (-777.964) -- 0:00:55
83500 -- (-780.899) (-784.594) (-779.249) [-780.355] * (-780.249) (-778.011) (-782.261) [-779.482] -- 0:00:54
84000 -- (-779.297) (-780.570) (-778.995) [-777.798] * (-781.351) (-783.905) [-780.439] (-779.658) -- 0:00:54
84500 -- (-781.708) [-780.360] (-779.861) (-778.345) * (-780.580) (-779.976) [-779.751] (-780.766) -- 0:00:54
85000 -- (-781.076) (-779.107) [-783.497] (-780.322) * (-779.737) [-782.491] (-777.992) (-779.713) -- 0:00:53
Average standard deviation of split frequencies: 0.016444
85500 -- (-781.795) (-779.541) [-778.754] (-780.305) * (-782.476) (-780.215) [-779.612] (-783.037) -- 0:00:53
86000 -- (-781.291) [-777.597] (-779.900) (-781.307) * [-782.565] (-778.931) (-780.771) (-782.758) -- 0:00:53
86500 -- (-780.864) (-779.322) [-778.724] (-781.735) * (-778.622) [-779.050] (-778.613) (-787.359) -- 0:00:52
87000 -- (-779.391) [-779.512] (-778.021) (-781.588) * (-778.832) (-778.262) (-779.570) [-783.510] -- 0:00:52
87500 -- (-779.196) (-778.374) (-780.384) [-780.385] * (-780.381) (-778.081) [-778.881] (-780.639) -- 0:00:52
88000 -- (-779.300) [-778.518] (-780.521) (-780.768) * (-780.872) (-778.827) [-781.054] (-779.070) -- 0:00:51
88500 -- (-778.047) [-778.518] (-780.278) (-781.223) * [-779.260] (-778.947) (-780.091) (-777.598) -- 0:00:51
89000 -- [-778.686] (-778.613) (-780.000) (-780.046) * (-778.108) (-778.428) (-780.472) [-779.333] -- 0:00:51
89500 -- (-780.064) (-782.010) (-779.935) [-779.562] * (-782.805) [-777.851] (-783.198) (-779.031) -- 0:00:50
90000 -- (-781.539) (-781.585) [-778.759] (-779.215) * (-780.913) (-779.301) (-782.255) [-779.189] -- 0:00:50
Average standard deviation of split frequencies: 0.017787
90500 -- (-781.878) [-778.073] (-779.072) (-781.617) * (-781.702) (-778.923) (-782.953) [-777.614] -- 0:00:50
91000 -- [-779.923] (-780.422) (-778.444) (-779.199) * (-780.525) (-782.120) [-778.403] (-777.888) -- 0:00:49
91500 -- (-781.854) (-779.076) [-780.064] (-780.426) * [-780.061] (-779.750) (-781.202) (-780.999) -- 0:00:49
92000 -- (-780.996) (-779.373) (-780.231) [-781.150] * (-779.495) [-779.925] (-779.670) (-779.901) -- 0:00:49
92500 -- (-783.697) (-781.381) [-779.738] (-786.673) * (-779.880) (-779.848) [-780.589] (-779.750) -- 0:00:49
93000 -- [-780.081] (-779.974) (-782.722) (-779.860) * (-780.382) [-778.743] (-780.026) (-781.020) -- 0:00:48
93500 -- [-781.626] (-778.246) (-782.712) (-780.060) * [-779.914] (-779.173) (-781.056) (-783.315) -- 0:00:48
94000 -- (-778.491) [-785.380] (-779.286) (-779.551) * (-778.652) [-778.864] (-782.048) (-780.594) -- 0:00:48
94500 -- (-778.742) (-781.015) (-779.494) [-779.311] * [-778.644] (-782.213) (-780.561) (-782.785) -- 0:00:47
95000 -- [-779.558] (-778.860) (-780.862) (-781.968) * (-778.747) (-785.106) [-779.621] (-780.688) -- 0:00:47
Average standard deviation of split frequencies: 0.015550
95500 -- (-779.558) [-779.050] (-779.794) (-780.116) * (-783.034) (-780.284) [-780.554] (-778.841) -- 0:00:47
96000 -- (-780.434) [-782.984] (-780.200) (-779.207) * [-778.742] (-778.790) (-782.278) (-780.255) -- 0:00:47
96500 -- [-781.172] (-780.751) (-780.859) (-779.204) * (-780.544) (-778.134) (-779.910) [-780.455] -- 0:00:46
97000 -- [-779.140] (-780.991) (-780.849) (-779.750) * (-779.306) [-778.589] (-781.235) (-781.342) -- 0:00:46
97500 -- [-778.947] (-781.519) (-780.389) (-779.152) * [-780.066] (-778.305) (-779.329) (-782.556) -- 0:00:46
98000 -- [-778.719] (-778.671) (-778.552) (-782.701) * [-781.121] (-779.603) (-779.614) (-780.812) -- 0:00:55
98500 -- (-780.221) [-779.964] (-780.283) (-785.228) * (-778.987) (-779.697) (-781.223) [-779.492] -- 0:00:54
99000 -- (-778.985) (-779.910) (-779.988) [-778.625] * [-782.149] (-780.903) (-780.385) (-779.849) -- 0:00:54
99500 -- (-778.703) (-778.578) (-779.433) [-779.592] * (-778.661) (-778.922) [-783.541] (-780.165) -- 0:00:54
100000 -- [-778.463] (-779.130) (-780.655) (-780.489) * (-778.774) [-780.784] (-784.091) (-781.972) -- 0:00:54
Average standard deviation of split frequencies: 0.017170
100500 -- (-778.000) [-779.181] (-781.667) (-780.449) * [-779.839] (-779.132) (-789.192) (-782.342) -- 0:00:53
101000 -- (-778.236) (-781.659) (-778.640) [-779.149] * [-779.356] (-777.905) (-778.997) (-781.909) -- 0:00:53
101500 -- (-778.218) (-780.066) (-782.815) [-779.327] * (-779.596) (-777.909) (-779.007) [-778.703] -- 0:00:53
102000 -- (-778.636) (-778.451) [-778.500] (-780.064) * (-778.739) (-779.504) (-779.946) [-778.761] -- 0:00:52
102500 -- (-779.518) (-778.637) [-781.606] (-783.018) * [-778.785] (-778.297) (-781.151) (-778.766) -- 0:00:52
103000 -- (-781.129) (-780.395) [-778.799] (-780.256) * (-778.250) [-777.725] (-779.304) (-783.066) -- 0:00:52
103500 -- (-780.561) (-780.842) (-779.872) [-786.372] * [-779.464] (-778.418) (-781.431) (-781.559) -- 0:00:51
104000 -- (-780.336) [-779.163] (-778.816) (-780.923) * (-778.246) (-779.379) (-779.310) [-779.422] -- 0:00:51
104500 -- (-779.402) [-779.627] (-778.092) (-778.321) * (-778.394) (-781.490) (-779.366) [-778.996] -- 0:00:51
105000 -- (-781.504) (-781.164) (-782.064) [-779.361] * (-780.088) (-779.242) [-779.382] (-778.289) -- 0:00:51
Average standard deviation of split frequencies: 0.019695
105500 -- [-779.140] (-778.670) (-778.294) (-779.118) * (-778.809) (-783.792) [-778.910] (-777.969) -- 0:00:50
106000 -- (-779.173) (-778.691) (-779.093) [-785.062] * [-777.956] (-781.647) (-778.653) (-779.190) -- 0:00:50
106500 -- (-779.841) (-781.493) (-782.309) [-780.114] * [-780.045] (-779.239) (-779.313) (-778.268) -- 0:00:50
107000 -- (-779.696) (-782.508) [-780.356] (-782.783) * (-781.170) (-779.942) (-780.781) [-783.257] -- 0:00:50
107500 -- (-781.177) [-777.902] (-779.487) (-779.810) * (-781.849) [-778.111] (-779.293) (-778.175) -- 0:00:49
108000 -- (-780.734) (-780.561) [-779.736] (-779.312) * (-779.501) (-779.095) (-780.060) [-780.582] -- 0:00:49
108500 -- (-778.931) (-781.153) (-778.345) [-778.415] * (-782.251) [-778.532] (-781.531) (-777.981) -- 0:00:49
109000 -- (-779.328) (-778.673) [-780.549] (-779.245) * (-780.420) (-778.849) (-783.284) [-781.338] -- 0:00:49
109500 -- (-779.376) (-778.498) [-783.081] (-782.717) * [-780.750] (-779.919) (-780.040) (-782.128) -- 0:00:48
110000 -- [-777.856] (-777.795) (-783.756) (-780.325) * (-781.888) (-779.793) (-780.587) [-780.195] -- 0:00:48
Average standard deviation of split frequencies: 0.021747
110500 -- (-778.233) (-777.504) [-780.670] (-779.102) * [-778.724] (-782.358) (-780.464) (-779.056) -- 0:00:48
111000 -- [-779.452] (-781.322) (-781.003) (-779.678) * (-779.668) [-779.447] (-779.320) (-781.078) -- 0:00:48
111500 -- (-780.873) [-784.542] (-783.689) (-780.296) * (-779.749) (-779.008) (-780.833) [-780.612] -- 0:00:47
112000 -- (-779.836) (-783.504) (-779.836) [-778.596] * (-780.321) (-779.499) (-780.041) [-780.200] -- 0:00:47
112500 -- [-782.016] (-785.685) (-778.253) (-778.392) * (-780.586) (-780.250) [-777.872] (-780.661) -- 0:00:47
113000 -- (-780.908) (-778.919) (-780.344) [-778.787] * [-778.556] (-780.117) (-778.881) (-778.484) -- 0:00:47
113500 -- (-780.778) (-777.973) [-777.925] (-779.642) * (-778.638) (-780.072) (-780.697) [-779.121] -- 0:00:46
114000 -- (-779.083) (-780.533) [-779.033] (-778.895) * (-778.442) [-778.764] (-780.363) (-778.141) -- 0:00:46
114500 -- (-779.186) (-780.696) (-780.557) [-778.435] * (-779.447) [-778.374] (-779.770) (-778.593) -- 0:00:46
115000 -- [-781.106] (-779.494) (-779.308) (-778.853) * (-779.114) (-779.816) [-782.522] (-781.098) -- 0:00:53
Average standard deviation of split frequencies: 0.022886
115500 -- (-780.610) (-777.868) (-779.446) [-781.659] * (-784.286) [-784.625] (-777.943) (-783.847) -- 0:00:53
116000 -- [-783.046] (-779.844) (-778.704) (-783.115) * [-783.720] (-782.546) (-778.090) (-778.778) -- 0:00:53
116500 -- (-778.824) (-778.206) (-779.684) [-780.090] * (-780.800) [-780.032] (-779.243) (-782.367) -- 0:00:53
117000 -- (-780.600) (-779.283) (-778.548) [-780.236] * (-781.389) [-778.457] (-779.017) (-779.019) -- 0:00:52
117500 -- [-778.241] (-778.549) (-780.359) (-781.563) * (-779.827) (-780.426) [-778.268] (-780.149) -- 0:00:52
118000 -- [-779.397] (-778.472) (-780.103) (-782.968) * [-779.002] (-778.313) (-784.338) (-778.340) -- 0:00:52
118500 -- (-787.533) [-778.342] (-780.345) (-781.421) * (-780.197) [-778.400] (-781.409) (-777.916) -- 0:00:52
119000 -- (-784.180) (-781.041) (-778.286) [-781.485] * (-778.605) (-781.443) (-781.943) [-780.020] -- 0:00:51
119500 -- (-783.608) [-784.351] (-779.113) (-781.116) * [-779.579] (-778.370) (-783.047) (-780.242) -- 0:00:51
120000 -- (-783.613) (-782.325) [-779.477] (-780.989) * (-778.354) [-781.297] (-779.552) (-779.512) -- 0:00:51
Average standard deviation of split frequencies: 0.024879
120500 -- (-782.367) [-780.646] (-782.093) (-778.759) * (-779.029) (-780.632) (-779.802) [-778.861] -- 0:00:51
121000 -- [-778.778] (-778.151) (-782.734) (-777.865) * (-779.355) [-779.203] (-778.650) (-784.792) -- 0:00:50
121500 -- (-780.102) [-778.655] (-780.576) (-781.710) * [-780.900] (-777.594) (-778.403) (-780.316) -- 0:00:50
122000 -- (-781.261) (-783.045) (-779.210) [-781.376] * (-778.249) [-777.615] (-778.666) (-780.498) -- 0:00:50
122500 -- (-780.831) [-779.337] (-780.681) (-779.912) * (-782.649) (-779.049) (-778.281) [-782.827] -- 0:00:50
123000 -- (-783.076) (-779.797) (-779.851) [-778.193] * (-782.160) [-782.809] (-780.417) (-781.619) -- 0:00:49
123500 -- [-780.813] (-780.407) (-779.463) (-781.761) * (-778.813) (-780.928) (-778.698) [-779.207] -- 0:00:49
124000 -- (-778.686) [-779.236] (-778.664) (-781.091) * [-778.825] (-780.811) (-780.412) (-780.003) -- 0:00:49
124500 -- (-779.416) [-780.270] (-779.964) (-780.789) * (-779.097) (-782.590) (-779.915) [-780.909] -- 0:00:49
125000 -- (-779.979) (-778.412) (-779.855) [-781.414] * (-779.761) [-779.504] (-779.148) (-781.669) -- 0:00:49
Average standard deviation of split frequencies: 0.023383
125500 -- (-780.189) (-784.170) (-779.670) [-778.770] * (-778.445) (-780.259) [-783.040] (-779.495) -- 0:00:48
126000 -- [-780.445] (-781.273) (-778.639) (-781.407) * (-779.395) (-782.261) [-780.774] (-780.162) -- 0:00:48
126500 -- (-780.034) (-779.153) [-779.567] (-781.661) * (-780.312) (-780.016) [-782.104] (-780.767) -- 0:00:48
127000 -- (-779.463) (-779.718) [-778.811] (-781.253) * (-779.590) (-780.243) (-783.100) [-779.095] -- 0:00:48
127500 -- (-779.747) (-780.660) (-780.139) [-779.299] * (-784.926) (-778.506) [-782.501] (-778.324) -- 0:00:47
128000 -- [-785.349] (-778.825) (-779.554) (-778.985) * (-778.820) (-778.423) (-779.656) [-781.817] -- 0:00:47
128500 -- (-781.845) (-781.407) [-777.866] (-781.044) * (-781.004) [-779.438] (-779.654) (-778.780) -- 0:00:47
129000 -- (-781.454) (-779.025) [-779.816] (-783.714) * (-780.465) [-777.966] (-779.152) (-782.902) -- 0:00:47
129500 -- (-780.320) (-778.976) [-779.217] (-780.454) * [-777.794] (-779.285) (-782.847) (-777.847) -- 0:00:47
130000 -- [-778.440] (-780.972) (-778.351) (-778.901) * (-778.519) (-780.319) (-784.866) [-779.311] -- 0:00:46
Average standard deviation of split frequencies: 0.019842
130500 -- (-779.678) (-783.719) (-778.471) [-782.057] * (-781.742) [-778.090] (-779.926) (-780.724) -- 0:00:46
131000 -- (-781.381) (-780.086) (-778.230) [-785.351] * (-780.220) [-780.608] (-780.318) (-777.970) -- 0:00:46
131500 -- [-783.940] (-781.383) (-779.706) (-785.626) * (-778.883) (-783.534) (-782.612) [-778.475] -- 0:00:52
132000 -- (-782.937) [-779.276] (-777.816) (-782.213) * (-779.091) (-780.853) (-779.818) [-777.649] -- 0:00:52
132500 -- (-780.616) (-781.619) [-778.576] (-779.674) * (-780.772) (-778.310) (-780.241) [-781.479] -- 0:00:52
133000 -- (-779.668) [-777.506] (-778.439) (-780.406) * [-781.697] (-780.816) (-780.273) (-779.537) -- 0:00:52
133500 -- (-782.596) (-782.083) [-780.906] (-779.064) * (-779.552) (-778.920) [-781.020] (-779.712) -- 0:00:51
134000 -- [-778.994] (-777.727) (-779.342) (-782.745) * (-779.887) [-778.679] (-782.951) (-779.850) -- 0:00:51
134500 -- (-779.458) [-778.124] (-779.481) (-784.860) * (-779.041) (-780.577) (-779.448) [-778.148] -- 0:00:51
135000 -- (-780.559) (-778.059) [-778.580] (-779.516) * [-779.210] (-780.467) (-778.327) (-778.805) -- 0:00:51
Average standard deviation of split frequencies: 0.019520
135500 -- [-778.345] (-778.169) (-781.675) (-780.002) * (-780.405) [-778.399] (-782.380) (-781.618) -- 0:00:51
136000 -- [-779.533] (-777.840) (-782.003) (-784.760) * (-781.877) (-778.549) (-780.621) [-779.027] -- 0:00:50
136500 -- [-779.953] (-778.434) (-779.689) (-780.554) * (-779.614) (-778.175) (-778.634) [-779.029] -- 0:00:50
137000 -- (-778.528) (-780.231) [-779.728] (-777.964) * [-781.943] (-780.702) (-779.453) (-783.033) -- 0:00:50
137500 -- (-784.733) (-779.841) (-778.153) [-780.236] * (-787.515) [-780.549] (-783.401) (-781.913) -- 0:00:50
138000 -- (-780.440) (-779.659) [-777.893] (-782.694) * (-779.537) [-780.326] (-785.171) (-779.898) -- 0:00:49
138500 -- (-779.298) (-778.978) [-777.900] (-782.199) * (-778.482) (-778.850) (-778.831) [-778.617] -- 0:00:49
139000 -- (-779.379) (-779.347) [-778.671] (-781.534) * [-779.872] (-780.412) (-779.706) (-779.527) -- 0:00:49
139500 -- (-778.078) [-781.161] (-778.199) (-782.805) * (-779.365) [-779.283] (-779.964) (-778.643) -- 0:00:49
140000 -- (-780.281) [-779.413] (-778.292) (-777.845) * (-777.709) (-780.156) [-782.647] (-778.636) -- 0:00:49
Average standard deviation of split frequencies: 0.019225
140500 -- [-779.730] (-780.589) (-778.018) (-780.562) * (-778.927) (-779.082) (-780.992) [-781.429] -- 0:00:48
141000 -- [-779.126] (-777.877) (-778.483) (-782.494) * (-778.822) (-779.100) [-779.531] (-779.250) -- 0:00:48
141500 -- [-781.071] (-780.540) (-780.177) (-778.982) * [-781.581] (-781.555) (-780.081) (-779.394) -- 0:00:48
142000 -- (-781.037) (-781.195) (-779.190) [-782.631] * (-779.234) (-780.211) (-778.287) [-779.808] -- 0:00:48
142500 -- (-779.757) (-780.442) (-778.764) [-780.534] * (-783.032) [-779.424] (-778.856) (-784.742) -- 0:00:48
143000 -- (-782.140) [-779.115] (-780.534) (-781.800) * (-779.298) (-780.856) (-780.378) [-781.244] -- 0:00:47
143500 -- (-778.436) (-778.013) [-779.507] (-784.003) * (-778.709) (-784.748) [-780.033] (-787.081) -- 0:00:47
144000 -- (-778.897) (-781.511) [-780.271] (-786.319) * (-778.447) [-779.175] (-778.773) (-782.179) -- 0:00:47
144500 -- (-779.419) (-782.483) [-779.398] (-785.627) * (-780.519) [-778.653] (-778.937) (-781.647) -- 0:00:47
145000 -- (-778.470) (-783.574) (-780.789) [-779.281] * [-779.725] (-779.197) (-781.859) (-779.440) -- 0:00:47
Average standard deviation of split frequencies: 0.022602
145500 -- [-778.785] (-784.505) (-783.704) (-779.256) * (-778.789) (-779.108) [-780.986] (-779.966) -- 0:00:46
146000 -- [-778.278] (-778.115) (-781.305) (-779.024) * (-779.575) (-781.039) [-779.437] (-778.271) -- 0:00:46
146500 -- (-778.585) (-779.531) (-778.918) [-780.822] * (-778.032) (-778.065) [-783.420] (-778.636) -- 0:00:46
147000 -- (-779.371) (-779.201) (-779.341) [-778.550] * [-778.172] (-778.358) (-779.802) (-779.638) -- 0:00:46
147500 -- (-780.894) (-779.596) [-781.931] (-780.850) * (-778.632) (-779.595) [-779.411] (-779.586) -- 0:00:46
148000 -- (-781.033) (-777.822) (-781.630) [-782.972] * [-778.413] (-779.469) (-781.813) (-780.078) -- 0:00:46
148500 -- (-782.088) [-778.646] (-778.129) (-786.171) * (-779.211) [-779.640] (-782.100) (-780.764) -- 0:00:51
149000 -- (-780.672) (-778.654) [-778.686] (-780.344) * (-778.752) (-778.083) (-782.100) [-780.446] -- 0:00:51
149500 -- [-779.931] (-781.638) (-781.876) (-780.159) * (-781.544) (-779.363) [-782.704] (-778.408) -- 0:00:51
150000 -- [-780.541] (-779.322) (-784.550) (-778.885) * (-782.009) (-781.150) (-780.747) [-778.514] -- 0:00:51
Average standard deviation of split frequencies: 0.022396
150500 -- (-779.951) (-778.072) (-784.038) [-784.071] * [-779.001] (-779.649) (-780.455) (-779.307) -- 0:00:50
151000 -- [-782.377] (-779.964) (-783.787) (-784.136) * (-780.126) (-779.123) (-780.352) [-778.812] -- 0:00:50
151500 -- (-785.319) (-780.022) (-780.193) [-782.180] * (-780.300) [-778.405] (-781.454) (-777.811) -- 0:00:50
152000 -- (-785.680) (-780.915) (-780.832) [-777.837] * (-781.193) (-779.310) [-780.640] (-778.797) -- 0:00:50
152500 -- (-778.240) (-779.270) (-779.320) [-779.335] * (-780.481) (-778.066) [-781.908] (-778.524) -- 0:00:50
153000 -- [-778.722] (-781.568) (-781.076) (-779.206) * (-778.713) (-779.245) [-778.977] (-778.338) -- 0:00:49
153500 -- (-780.563) (-779.997) (-783.318) [-779.528] * (-780.298) (-779.636) [-780.599] (-778.795) -- 0:00:49
154000 -- (-779.241) (-780.194) [-780.225] (-780.317) * [-779.497] (-779.669) (-779.078) (-777.766) -- 0:00:49
154500 -- (-778.373) [-780.260] (-780.168) (-780.233) * (-778.558) (-778.687) [-777.766] (-781.212) -- 0:00:49
155000 -- [-778.002] (-781.436) (-780.043) (-779.785) * (-778.895) (-779.248) [-778.589] (-780.471) -- 0:00:49
Average standard deviation of split frequencies: 0.022425
155500 -- (-778.983) (-781.257) (-779.459) [-782.931] * [-777.911] (-780.996) (-779.297) (-782.712) -- 0:00:48
156000 -- [-779.825] (-778.463) (-778.790) (-782.159) * (-779.527) [-781.215] (-779.443) (-782.281) -- 0:00:48
156500 -- [-781.279] (-778.663) (-778.833) (-779.079) * [-777.758] (-779.452) (-780.297) (-779.297) -- 0:00:48
157000 -- (-780.377) (-781.253) (-782.038) [-780.341] * [-778.970] (-780.528) (-779.674) (-780.421) -- 0:00:48
157500 -- (-780.312) [-781.514] (-780.058) (-780.750) * (-781.589) (-779.750) (-779.425) [-778.202] -- 0:00:48
158000 -- (-781.946) (-780.381) (-780.769) [-781.412] * (-778.922) (-779.635) (-777.996) [-787.147] -- 0:00:47
158500 -- (-782.212) (-780.061) [-778.354] (-779.905) * [-778.352] (-780.619) (-777.988) (-777.504) -- 0:00:47
159000 -- (-782.186) [-778.265] (-778.534) (-782.372) * (-781.522) (-780.354) [-781.658] (-778.103) -- 0:00:47
159500 -- (-778.751) [-778.193] (-781.751) (-782.170) * (-784.716) (-780.232) [-779.213] (-778.520) -- 0:00:47
160000 -- (-779.036) (-778.736) [-780.394] (-778.191) * (-779.758) (-780.532) [-780.203] (-778.599) -- 0:00:47
Average standard deviation of split frequencies: 0.020098
160500 -- (-779.807) (-778.330) (-778.730) [-779.319] * (-779.208) [-780.936] (-779.570) (-783.007) -- 0:00:47
161000 -- (-782.567) [-780.597] (-779.053) (-780.662) * (-781.757) (-778.362) [-779.147] (-781.502) -- 0:00:46
161500 -- (-781.433) (-780.093) (-778.060) [-780.813] * (-780.384) (-780.269) [-780.593] (-778.482) -- 0:00:46
162000 -- (-780.499) [-779.160] (-778.664) (-779.947) * (-779.086) [-781.677] (-783.673) (-777.777) -- 0:00:46
162500 -- (-779.465) (-779.156) [-777.907] (-780.464) * [-777.907] (-780.518) (-779.321) (-780.256) -- 0:00:46
163000 -- [-780.993] (-780.752) (-780.707) (-780.056) * (-778.867) (-781.753) [-779.651] (-779.432) -- 0:00:46
163500 -- (-781.068) (-780.014) (-780.152) [-780.059] * (-782.526) [-778.710] (-786.722) (-780.460) -- 0:00:46
164000 -- (-784.017) (-782.083) [-779.522] (-780.132) * (-781.222) (-779.818) [-781.067] (-780.870) -- 0:00:45
164500 -- (-785.115) (-777.948) (-782.298) [-781.754] * (-778.912) (-782.731) [-780.306] (-780.399) -- 0:00:45
165000 -- (-784.288) (-778.974) [-781.645] (-781.690) * [-779.542] (-781.773) (-781.586) (-780.014) -- 0:00:45
Average standard deviation of split frequencies: 0.021971
165500 -- [-780.041] (-778.553) (-779.232) (-781.211) * (-779.072) [-778.453] (-780.816) (-778.838) -- 0:00:50
166000 -- [-778.852] (-783.834) (-779.844) (-781.734) * [-780.361] (-779.768) (-780.536) (-780.370) -- 0:00:50
166500 -- (-778.311) (-780.169) [-779.564] (-785.420) * [-780.804] (-779.410) (-783.395) (-779.843) -- 0:00:50
167000 -- [-777.891] (-779.580) (-782.286) (-778.112) * [-778.733] (-778.310) (-781.789) (-780.667) -- 0:00:49
167500 -- [-779.044] (-783.381) (-779.173) (-778.240) * (-784.108) [-778.527] (-777.929) (-778.595) -- 0:00:49
168000 -- (-778.564) (-780.764) [-778.842] (-780.575) * [-782.531] (-785.669) (-777.909) (-778.074) -- 0:00:49
168500 -- (-778.317) [-779.567] (-780.918) (-778.482) * (-779.449) (-779.470) [-777.920] (-780.224) -- 0:00:49
169000 -- (-781.411) (-779.749) (-780.348) [-778.110] * (-781.576) (-777.910) (-779.478) [-781.803] -- 0:00:49
169500 -- (-779.662) (-778.848) (-780.230) [-778.474] * (-780.977) (-780.855) [-782.278] (-785.497) -- 0:00:48
170000 -- (-781.757) [-778.155] (-779.941) (-777.909) * (-783.856) (-783.037) (-779.450) [-781.454] -- 0:00:48
Average standard deviation of split frequencies: 0.022824
170500 -- (-781.107) (-778.372) [-782.601] (-779.519) * [-780.472] (-780.112) (-779.364) (-779.941) -- 0:00:48
171000 -- (-782.583) [-778.533] (-779.984) (-778.256) * (-785.862) (-778.918) (-778.338) [-779.531] -- 0:00:48
171500 -- (-779.902) (-782.003) [-780.495] (-779.920) * (-780.591) (-779.524) [-777.691] (-780.366) -- 0:00:48
172000 -- (-780.383) (-779.327) [-786.233] (-781.040) * (-779.042) (-779.029) (-778.047) [-783.050] -- 0:00:48
172500 -- [-780.791] (-780.028) (-780.762) (-780.996) * (-779.850) [-779.864] (-779.404) (-784.370) -- 0:00:47
173000 -- [-779.310] (-780.079) (-780.938) (-782.740) * (-782.765) [-777.855] (-778.476) (-780.605) -- 0:00:47
173500 -- (-783.958) [-781.860] (-778.977) (-781.958) * (-778.966) (-779.001) (-783.738) [-777.943] -- 0:00:47
174000 -- [-778.744] (-782.472) (-778.638) (-782.347) * (-780.249) (-779.194) (-783.098) [-777.928] -- 0:00:47
174500 -- (-778.339) (-781.877) [-785.022] (-782.627) * [-779.216] (-780.967) (-782.301) (-778.896) -- 0:00:47
175000 -- (-778.807) (-782.140) (-779.432) [-780.984] * [-779.973] (-779.962) (-780.305) (-779.695) -- 0:00:47
Average standard deviation of split frequencies: 0.020864
175500 -- [-779.688] (-779.057) (-779.318) (-778.367) * (-780.811) (-782.182) [-779.258] (-779.251) -- 0:00:46
176000 -- (-780.793) [-779.104] (-778.846) (-781.928) * (-782.812) [-779.704] (-777.530) (-779.212) -- 0:00:46
176500 -- (-778.510) [-778.371] (-778.702) (-780.577) * (-780.289) (-778.033) (-779.710) [-781.009] -- 0:00:46
177000 -- (-779.057) (-778.657) [-777.998] (-784.408) * [-779.507] (-780.664) (-780.136) (-779.978) -- 0:00:46
177500 -- [-781.137] (-778.771) (-778.897) (-777.582) * (-779.803) (-783.959) (-779.867) [-780.240] -- 0:00:46
178000 -- [-779.944] (-781.400) (-778.697) (-779.702) * (-779.895) (-778.469) [-780.159] (-786.418) -- 0:00:46
178500 -- (-783.363) (-781.327) (-782.237) [-779.850] * (-780.926) [-780.992] (-780.782) (-783.130) -- 0:00:46
179000 -- (-780.793) (-779.431) (-778.711) [-780.213] * (-780.392) (-780.712) [-779.463] (-782.653) -- 0:00:45
179500 -- (-779.070) (-779.469) [-779.105] (-777.679) * (-778.448) [-779.798] (-782.134) (-778.729) -- 0:00:45
180000 -- (-780.934) [-778.181] (-779.094) (-777.509) * (-778.732) [-778.249] (-779.415) (-779.003) -- 0:00:45
Average standard deviation of split frequencies: 0.018814
180500 -- (-780.535) (-781.463) (-778.936) [-779.217] * [-778.603] (-778.149) (-781.501) (-780.245) -- 0:00:45
181000 -- (-778.861) (-778.167) [-778.720] (-777.803) * (-778.345) [-778.578] (-779.106) (-777.971) -- 0:00:45
181500 -- (-777.939) [-778.264] (-779.093) (-781.699) * (-781.966) [-778.602] (-784.777) (-778.864) -- 0:00:45
182000 -- (-777.928) (-778.372) (-782.918) [-780.643] * (-780.064) [-779.290] (-783.447) (-780.367) -- 0:00:44
182500 -- (-779.723) [-779.305] (-778.664) (-780.917) * (-781.408) [-778.034] (-782.700) (-780.499) -- 0:00:49
183000 -- (-779.006) [-780.263] (-779.547) (-781.621) * [-782.796] (-777.827) (-781.072) (-778.391) -- 0:00:49
183500 -- (-779.514) (-779.884) (-779.490) [-781.663] * (-778.985) (-777.800) (-783.956) [-779.408] -- 0:00:48
184000 -- [-779.479] (-782.472) (-778.789) (-780.121) * (-782.147) [-778.341] (-779.961) (-780.758) -- 0:00:48
184500 -- [-778.878] (-779.427) (-782.317) (-781.725) * (-779.832) (-779.897) (-782.648) [-782.967] -- 0:00:48
185000 -- (-781.516) (-780.732) [-780.978] (-779.538) * [-779.548] (-778.654) (-778.610) (-779.300) -- 0:00:48
Average standard deviation of split frequencies: 0.020396
185500 -- (-778.946) (-782.143) (-778.175) [-780.545] * (-778.579) [-778.910] (-780.605) (-778.943) -- 0:00:48
186000 -- [-779.774] (-781.256) (-780.103) (-779.174) * (-782.500) [-779.081] (-780.454) (-778.351) -- 0:00:48
186500 -- (-778.942) (-780.752) [-779.422] (-778.548) * (-781.843) (-778.000) (-781.871) [-778.776] -- 0:00:47
187000 -- (-784.732) (-778.994) (-778.547) [-780.225] * [-779.709] (-778.930) (-780.093) (-779.075) -- 0:00:47
187500 -- (-783.720) (-780.340) [-778.031] (-778.692) * (-779.458) (-779.020) (-782.653) [-780.465] -- 0:00:47
188000 -- (-780.380) (-779.597) [-778.007] (-780.365) * (-782.572) (-779.119) (-779.924) [-778.708] -- 0:00:47
188500 -- (-780.281) (-779.938) (-778.314) [-780.391] * (-782.266) (-781.024) (-779.231) [-781.741] -- 0:00:47
189000 -- (-779.413) (-778.917) [-779.707] (-780.797) * (-780.972) (-780.237) (-779.575) [-779.644] -- 0:00:47
189500 -- [-779.758] (-779.670) (-778.651) (-782.284) * [-780.852] (-781.588) (-781.109) (-779.024) -- 0:00:47
190000 -- (-780.030) (-780.195) [-780.678] (-780.099) * [-779.662] (-782.201) (-782.568) (-780.844) -- 0:00:46
Average standard deviation of split frequencies: 0.019308
190500 -- [-781.028] (-777.874) (-781.951) (-781.524) * (-783.012) (-783.161) [-781.820] (-780.226) -- 0:00:46
191000 -- (-781.003) [-778.464] (-779.250) (-782.662) * (-780.715) [-781.406] (-780.776) (-784.790) -- 0:00:46
191500 -- (-781.699) (-786.716) [-777.992] (-781.604) * (-778.275) (-780.105) (-780.492) [-781.610] -- 0:00:46
192000 -- (-779.896) (-781.067) (-778.821) [-779.621] * (-778.220) [-778.746] (-778.759) (-779.293) -- 0:00:46
192500 -- (-778.199) (-779.829) [-782.637] (-781.898) * (-783.150) [-782.155] (-779.253) (-780.646) -- 0:00:46
193000 -- (-778.660) (-778.207) [-780.041] (-780.280) * (-785.163) (-780.823) (-779.094) [-778.729] -- 0:00:45
193500 -- [-778.794] (-779.643) (-778.964) (-779.394) * (-781.355) (-779.988) [-778.007] (-780.803) -- 0:00:45
194000 -- (-783.282) [-780.087] (-783.723) (-780.540) * (-781.805) [-779.166] (-780.143) (-782.394) -- 0:00:45
194500 -- [-779.426] (-781.463) (-782.667) (-778.771) * (-781.967) (-783.180) [-779.175] (-780.282) -- 0:00:45
195000 -- [-780.568] (-781.438) (-782.795) (-778.241) * (-779.024) (-780.014) [-780.178] (-781.687) -- 0:00:45
Average standard deviation of split frequencies: 0.020043
195500 -- (-782.868) (-782.883) (-778.325) [-781.237] * (-780.398) (-779.468) (-778.062) [-779.010] -- 0:00:45
196000 -- (-783.169) [-778.702] (-778.922) (-777.796) * (-783.968) (-778.736) (-778.823) [-778.266] -- 0:00:45
196500 -- [-782.615] (-781.474) (-779.346) (-779.875) * (-779.944) [-778.687] (-779.320) (-777.992) -- 0:00:44
197000 -- (-780.100) (-780.158) (-779.002) [-780.278] * (-781.219) (-777.927) [-778.516] (-779.961) -- 0:00:44
197500 -- (-780.870) (-786.110) (-779.509) [-779.331] * (-778.371) [-778.698] (-777.970) (-781.199) -- 0:00:44
198000 -- (-779.338) [-777.765] (-780.562) (-778.780) * [-778.463] (-778.390) (-780.579) (-783.861) -- 0:00:44
198500 -- (-778.390) [-779.153] (-790.637) (-778.430) * (-781.023) (-781.843) [-782.441] (-782.224) -- 0:00:44
199000 -- (-782.197) (-780.534) (-780.066) [-779.229] * [-777.972] (-781.111) (-779.176) (-779.111) -- 0:00:44
199500 -- (-778.443) (-779.368) [-780.399] (-782.770) * (-785.136) [-781.468] (-779.671) (-781.829) -- 0:00:48
200000 -- (-778.138) [-780.582] (-779.339) (-778.933) * (-785.206) (-781.918) (-778.925) [-779.685] -- 0:00:48
Average standard deviation of split frequencies: 0.020583
200500 -- (-781.818) (-780.206) [-778.683] (-781.106) * (-782.265) [-779.091] (-778.951) (-783.448) -- 0:00:47
201000 -- [-780.230] (-779.405) (-781.842) (-783.422) * (-783.115) (-779.117) (-778.550) [-780.230] -- 0:00:47
201500 -- [-779.724] (-783.333) (-782.534) (-781.344) * (-779.843) (-784.348) (-783.155) [-779.004] -- 0:00:47
202000 -- (-780.120) (-780.865) (-780.992) [-784.112] * (-779.165) [-778.226] (-780.233) (-784.332) -- 0:00:47
202500 -- (-782.615) [-778.243] (-783.482) (-788.855) * [-779.308] (-782.613) (-780.716) (-780.383) -- 0:00:47
203000 -- (-780.213) [-779.627] (-782.448) (-781.024) * (-780.414) (-786.369) [-780.456] (-785.726) -- 0:00:47
203500 -- (-779.851) (-783.475) (-780.957) [-778.349] * (-779.686) (-779.978) [-780.582] (-779.892) -- 0:00:46
204000 -- [-778.892] (-778.057) (-779.596) (-778.664) * (-781.038) [-781.482] (-780.095) (-779.707) -- 0:00:46
204500 -- (-779.073) [-778.468] (-779.072) (-780.129) * (-782.108) (-780.436) (-779.990) [-777.945] -- 0:00:46
205000 -- [-779.046] (-780.545) (-782.876) (-780.005) * (-783.673) (-781.151) [-779.853] (-778.510) -- 0:00:46
Average standard deviation of split frequencies: 0.021685
205500 -- (-779.900) (-780.475) (-780.231) [-778.369] * [-786.486] (-779.588) (-782.736) (-779.987) -- 0:00:46
206000 -- [-778.168] (-780.867) (-780.179) (-781.047) * (-779.974) (-781.965) [-781.766] (-785.296) -- 0:00:46
206500 -- [-779.522] (-780.945) (-783.610) (-780.231) * [-779.659] (-781.832) (-780.719) (-780.563) -- 0:00:46
207000 -- (-778.920) (-783.023) [-779.569] (-779.674) * (-778.436) (-779.067) [-782.817] (-780.373) -- 0:00:45
207500 -- (-778.356) (-789.779) (-780.420) [-779.252] * (-779.288) [-778.313] (-783.312) (-779.691) -- 0:00:45
208000 -- (-779.281) (-781.818) (-780.036) [-778.836] * (-778.846) (-778.313) [-779.766] (-779.973) -- 0:00:45
208500 -- (-778.428) [-780.155] (-782.453) (-779.315) * (-781.536) (-778.728) [-779.285] (-781.114) -- 0:00:45
209000 -- (-779.075) (-779.420) (-782.378) [-780.021] * (-782.030) (-780.935) [-781.112] (-778.543) -- 0:00:45
209500 -- [-779.336] (-780.230) (-778.104) (-781.117) * [-783.313] (-779.770) (-778.434) (-780.551) -- 0:00:45
210000 -- (-788.723) (-780.569) [-777.961] (-778.769) * [-779.808] (-781.336) (-777.731) (-780.385) -- 0:00:45
Average standard deviation of split frequencies: 0.021631
210500 -- (-778.152) [-778.878] (-780.885) (-781.947) * (-781.866) (-786.546) [-779.483] (-779.297) -- 0:00:45
211000 -- (-778.522) (-779.217) (-778.462) [-780.996] * (-780.862) [-780.424] (-780.190) (-779.172) -- 0:00:44
211500 -- (-778.355) (-779.944) (-778.457) [-779.766] * [-779.336] (-777.792) (-777.803) (-781.656) -- 0:00:44
212000 -- [-778.812] (-778.799) (-783.909) (-779.818) * (-777.876) [-778.851] (-778.498) (-782.112) -- 0:00:44
212500 -- [-782.978] (-780.428) (-783.033) (-781.017) * [-779.679] (-778.861) (-784.147) (-780.688) -- 0:00:44
213000 -- (-779.961) [-780.021] (-779.957) (-779.687) * (-779.772) (-778.426) [-779.645] (-778.791) -- 0:00:44
213500 -- (-784.067) (-779.871) [-779.919] (-777.903) * (-778.250) (-779.468) (-782.602) [-780.025] -- 0:00:44
214000 -- [-778.361] (-779.677) (-781.069) (-778.626) * [-779.070] (-779.446) (-780.221) (-779.090) -- 0:00:44
214500 -- [-777.767] (-781.072) (-779.273) (-779.330) * (-779.532) (-779.922) (-779.876) [-779.235] -- 0:00:43
215000 -- [-778.751] (-781.003) (-781.651) (-779.417) * (-783.698) (-781.275) (-777.964) [-779.049] -- 0:00:43
Average standard deviation of split frequencies: 0.019751
215500 -- (-777.806) (-782.847) [-778.089] (-778.680) * (-779.507) [-783.736] (-778.867) (-779.601) -- 0:00:43
216000 -- (-781.593) [-780.224] (-780.789) (-779.464) * (-779.296) (-780.556) [-778.371] (-779.119) -- 0:00:47
216500 -- (-787.871) (-779.155) [-779.529] (-784.387) * (-779.271) [-779.160] (-779.837) (-779.544) -- 0:00:47
217000 -- [-784.666] (-779.968) (-780.651) (-781.968) * [-778.526] (-778.619) (-778.945) (-781.465) -- 0:00:46
217500 -- (-784.663) (-779.892) [-780.336] (-779.554) * [-778.852] (-777.816) (-779.630) (-779.302) -- 0:00:46
218000 -- (-781.132) [-779.100] (-782.642) (-780.461) * [-780.366] (-778.072) (-780.639) (-780.515) -- 0:00:46
218500 -- (-780.482) (-782.568) [-778.438] (-784.048) * (-781.858) (-779.036) [-781.707] (-780.828) -- 0:00:46
219000 -- (-779.155) (-780.855) [-779.055] (-782.993) * (-781.521) (-779.460) [-780.769] (-778.408) -- 0:00:46
219500 -- (-779.045) (-780.762) [-782.068] (-782.796) * (-780.753) (-780.815) [-784.289] (-780.066) -- 0:00:46
220000 -- (-785.502) (-780.914) (-778.450) [-778.569] * [-779.907] (-781.067) (-780.084) (-779.906) -- 0:00:46
Average standard deviation of split frequencies: 0.020688
220500 -- (-777.898) (-780.698) [-779.184] (-780.476) * (-782.089) (-780.695) (-782.086) [-778.826] -- 0:00:45
221000 -- [-778.345] (-780.896) (-780.091) (-778.036) * (-779.297) (-784.458) [-780.849] (-778.427) -- 0:00:45
221500 -- [-781.779] (-778.914) (-781.021) (-778.697) * (-780.195) (-779.282) (-780.317) [-779.831] -- 0:00:45
222000 -- (-782.855) (-779.499) [-781.117] (-779.910) * (-783.414) (-781.836) [-779.668] (-778.652) -- 0:00:45
222500 -- (-778.579) (-781.728) [-780.587] (-779.014) * (-783.355) (-782.715) [-778.429] (-778.233) -- 0:00:45
223000 -- (-778.853) (-781.600) (-783.970) [-779.129] * (-784.810) [-779.583] (-778.746) (-779.412) -- 0:00:45
223500 -- (-779.018) [-780.212] (-780.567) (-778.443) * [-782.348] (-778.035) (-779.267) (-780.851) -- 0:00:45
224000 -- (-780.235) [-779.135] (-781.382) (-779.297) * (-780.664) [-778.836] (-779.218) (-778.500) -- 0:00:45
224500 -- (-781.985) (-780.781) [-780.212] (-779.229) * (-780.047) [-779.286] (-777.886) (-778.262) -- 0:00:44
225000 -- [-779.224] (-781.347) (-780.662) (-778.002) * [-781.297] (-781.473) (-779.890) (-779.691) -- 0:00:44
Average standard deviation of split frequencies: 0.020024
225500 -- (-778.614) (-780.209) (-782.345) [-777.593] * (-778.990) [-778.771] (-783.468) (-783.358) -- 0:00:44
226000 -- (-780.927) [-780.347] (-777.900) (-779.948) * (-778.070) (-779.332) (-780.665) [-780.380] -- 0:00:44
226500 -- (-782.799) (-778.813) [-778.386] (-778.859) * (-778.473) [-778.285] (-779.837) (-778.916) -- 0:00:44
227000 -- (-778.342) [-780.591] (-780.487) (-778.010) * (-780.431) (-778.974) (-779.269) [-783.236] -- 0:00:44
227500 -- (-778.160) (-781.970) [-779.942] (-781.679) * (-778.247) [-781.268] (-780.796) (-779.129) -- 0:00:44
228000 -- [-778.771] (-780.260) (-780.585) (-778.158) * (-778.699) [-778.624] (-780.468) (-777.768) -- 0:00:44
228500 -- (-779.047) (-780.108) [-778.659] (-780.497) * [-778.781] (-780.047) (-778.931) (-778.193) -- 0:00:43
229000 -- [-779.984] (-783.823) (-779.187) (-779.760) * (-777.563) (-779.410) [-780.019] (-779.365) -- 0:00:43
229500 -- (-784.303) (-779.624) [-778.893] (-782.089) * (-784.503) (-780.506) [-781.438] (-779.558) -- 0:00:43
230000 -- (-782.634) (-778.792) [-778.319] (-785.360) * (-780.733) (-780.915) (-780.040) [-779.656] -- 0:00:43
Average standard deviation of split frequencies: 0.019684
230500 -- (-778.538) [-779.790] (-778.860) (-783.206) * [-779.992] (-780.648) (-779.261) (-782.143) -- 0:00:43
231000 -- [-779.652] (-777.873) (-778.534) (-781.413) * (-778.594) (-780.544) (-780.148) [-779.523] -- 0:00:43
231500 -- (-778.495) (-777.920) [-779.574] (-782.060) * (-779.223) (-780.890) [-781.283] (-778.918) -- 0:00:43
232000 -- (-778.515) (-779.206) [-782.110] (-783.398) * [-779.089] (-782.347) (-782.865) (-786.567) -- 0:00:43
232500 -- (-780.552) [-778.458] (-784.027) (-780.581) * (-779.284) (-781.386) [-780.921] (-782.119) -- 0:00:42
233000 -- [-780.185] (-778.807) (-778.530) (-782.137) * (-780.523) (-782.089) [-779.839] (-781.075) -- 0:00:46
233500 -- (-781.731) [-777.667] (-783.257) (-782.778) * [-778.084] (-777.780) (-780.955) (-778.851) -- 0:00:45
234000 -- [-777.822] (-777.828) (-782.657) (-778.370) * (-778.167) [-781.239] (-778.838) (-779.921) -- 0:00:45
234500 -- (-778.322) (-778.914) [-782.676] (-780.190) * (-777.949) (-779.842) (-783.880) [-778.951] -- 0:00:45
235000 -- [-782.168] (-779.773) (-781.242) (-778.742) * (-778.568) (-780.198) [-785.308] (-780.985) -- 0:00:45
Average standard deviation of split frequencies: 0.019449
235500 -- (-782.027) (-779.386) (-784.761) [-777.992] * [-779.520] (-781.765) (-778.682) (-780.328) -- 0:00:45
236000 -- (-780.869) (-778.701) [-782.923] (-778.092) * (-779.840) (-779.255) (-787.548) [-778.603] -- 0:00:45
236500 -- (-780.869) (-778.161) (-780.004) [-778.266] * (-783.551) (-777.947) (-781.456) [-777.959] -- 0:00:45
237000 -- [-779.933] (-778.325) (-779.023) (-781.472) * (-778.273) (-778.627) [-779.557] (-778.702) -- 0:00:45
237500 -- (-779.179) (-778.292) [-779.903] (-783.405) * (-778.366) (-779.855) (-780.566) [-781.567] -- 0:00:44
238000 -- [-783.063] (-783.654) (-780.137) (-781.538) * (-783.877) [-780.503] (-779.558) (-787.125) -- 0:00:44
238500 -- (-778.898) (-784.928) (-781.354) [-778.114] * (-781.336) (-779.399) [-780.225] (-781.000) -- 0:00:44
239000 -- (-778.607) (-780.954) (-779.882) [-777.778] * [-778.533] (-779.567) (-779.441) (-779.685) -- 0:00:44
239500 -- (-779.566) [-781.716] (-780.209) (-779.042) * (-778.622) (-780.378) [-779.431] (-783.217) -- 0:00:44
240000 -- (-778.326) (-782.336) [-778.899] (-781.295) * (-777.703) (-782.792) [-781.817] (-784.166) -- 0:00:44
Average standard deviation of split frequencies: 0.019011
240500 -- (-779.179) [-780.618] (-782.868) (-784.433) * (-777.900) [-779.546] (-778.580) (-781.701) -- 0:00:44
241000 -- (-781.106) (-778.279) (-780.663) [-782.916] * [-778.024] (-779.562) (-782.130) (-782.441) -- 0:00:44
241500 -- [-778.946] (-779.846) (-779.554) (-785.072) * (-781.044) (-782.634) (-781.345) [-780.981] -- 0:00:43
242000 -- (-777.854) (-786.039) [-779.023] (-782.746) * [-780.090] (-778.712) (-780.214) (-778.177) -- 0:00:43
242500 -- [-778.930] (-778.983) (-780.409) (-780.962) * (-779.891) [-779.186] (-781.470) (-778.046) -- 0:00:43
243000 -- (-781.857) (-782.994) (-780.605) [-778.576] * [-779.510] (-783.011) (-781.702) (-778.606) -- 0:00:43
243500 -- (-779.406) (-779.495) (-781.916) [-778.416] * (-778.839) (-779.432) [-786.256] (-780.589) -- 0:00:43
244000 -- (-778.640) (-781.590) [-780.994] (-778.617) * [-779.171] (-778.352) (-782.684) (-778.605) -- 0:00:43
244500 -- (-785.186) (-778.182) (-779.307) [-778.202] * [-781.490] (-780.439) (-781.252) (-779.346) -- 0:00:43
245000 -- [-778.230] (-778.064) (-782.076) (-778.878) * (-778.075) (-778.963) [-781.123] (-780.332) -- 0:00:43
Average standard deviation of split frequencies: 0.017342
245500 -- (-778.235) (-778.268) (-779.905) [-778.758] * (-778.137) [-783.277] (-781.560) (-781.651) -- 0:00:43
246000 -- (-781.490) (-778.342) [-779.471] (-780.606) * [-778.354] (-779.910) (-779.755) (-780.348) -- 0:00:42
246500 -- (-779.957) (-778.351) [-782.753] (-778.737) * (-778.364) (-780.459) (-780.918) [-779.342] -- 0:00:42
247000 -- [-778.965] (-780.747) (-782.261) (-779.910) * (-778.725) (-779.808) (-782.035) [-778.324] -- 0:00:42
247500 -- (-778.210) (-784.620) (-780.311) [-779.054] * (-779.692) (-784.476) [-781.297] (-781.813) -- 0:00:42
248000 -- (-779.009) (-782.572) (-786.049) [-782.785] * [-780.213] (-778.562) (-779.249) (-781.783) -- 0:00:42
248500 -- (-779.092) [-780.173] (-784.439) (-780.313) * (-778.698) (-778.928) (-783.395) [-778.034] -- 0:00:42
249000 -- (-782.548) [-779.357] (-782.034) (-780.609) * (-784.722) (-778.835) (-778.478) [-778.361] -- 0:00:42
249500 -- (-782.889) [-780.771] (-778.551) (-781.903) * (-779.001) (-779.233) [-780.644] (-779.608) -- 0:00:42
250000 -- [-782.747] (-778.986) (-778.535) (-783.171) * (-778.971) (-782.048) [-778.055] (-779.778) -- 0:00:45
Average standard deviation of split frequencies: 0.016628
250500 -- [-780.417] (-779.990) (-778.139) (-779.332) * [-778.288] (-781.046) (-778.126) (-778.198) -- 0:00:44
251000 -- (-780.504) (-779.419) (-779.525) [-778.762] * (-780.271) [-777.967] (-780.487) (-778.779) -- 0:00:44
251500 -- (-779.672) (-782.691) [-780.449] (-780.080) * [-778.387] (-777.787) (-779.577) (-778.870) -- 0:00:44
252000 -- (-777.858) [-779.271] (-781.579) (-780.091) * (-779.933) [-778.737] (-781.950) (-780.658) -- 0:00:44
252500 -- (-778.798) [-779.811] (-781.081) (-780.317) * [-782.310] (-779.172) (-783.373) (-782.606) -- 0:00:44
253000 -- (-778.736) (-783.021) [-780.948] (-779.350) * (-779.062) (-779.579) [-780.958] (-781.170) -- 0:00:44
253500 -- (-778.151) (-778.696) (-779.590) [-778.665] * (-783.862) (-780.504) (-778.491) [-779.828] -- 0:00:44
254000 -- [-781.992] (-781.143) (-780.737) (-781.637) * (-781.796) [-779.593] (-778.077) (-779.143) -- 0:00:44
254500 -- (-782.179) (-780.876) (-781.244) [-780.884] * [-780.050] (-778.251) (-778.221) (-778.622) -- 0:00:43
255000 -- (-778.646) (-780.757) [-779.183] (-779.366) * (-783.429) (-780.487) [-779.618] (-781.468) -- 0:00:43
Average standard deviation of split frequencies: 0.016789
255500 -- (-781.226) [-779.563] (-780.353) (-778.408) * (-783.393) (-784.308) [-782.003] (-780.585) -- 0:00:43
256000 -- (-784.501) [-780.448] (-779.213) (-777.846) * (-782.773) [-780.192] (-782.069) (-779.982) -- 0:00:43
256500 -- (-783.514) (-778.780) [-782.189] (-777.844) * (-784.700) (-779.700) [-782.644] (-779.563) -- 0:00:43
257000 -- (-782.015) (-778.724) (-781.753) [-779.845] * (-780.685) (-778.403) (-782.463) [-778.213] -- 0:00:43
257500 -- (-778.755) (-784.538) (-779.468) [-779.636] * [-781.590] (-779.018) (-779.094) (-778.323) -- 0:00:43
258000 -- (-779.945) [-781.163] (-778.628) (-779.395) * (-781.225) [-779.386] (-781.106) (-778.638) -- 0:00:43
258500 -- (-779.387) (-779.858) (-779.973) [-781.157] * [-778.346] (-778.516) (-779.721) (-778.649) -- 0:00:43
259000 -- [-781.866] (-779.947) (-781.584) (-782.124) * (-780.898) (-781.027) [-778.141] (-779.966) -- 0:00:42
259500 -- (-783.998) (-779.739) [-780.110] (-779.383) * (-779.926) (-780.833) (-780.331) [-778.314] -- 0:00:42
260000 -- (-781.149) (-781.388) (-781.196) [-779.064] * [-778.435] (-781.932) (-782.337) (-780.414) -- 0:00:42
Average standard deviation of split frequencies: 0.017765
260500 -- (-779.597) (-779.127) (-782.327) [-779.053] * (-779.862) (-779.422) [-779.430] (-779.919) -- 0:00:42
261000 -- (-782.272) (-781.119) (-778.672) [-779.735] * (-779.752) (-778.774) [-780.858] (-778.759) -- 0:00:42
261500 -- [-786.449] (-783.769) (-778.960) (-783.930) * (-781.475) [-778.928] (-780.517) (-778.999) -- 0:00:42
262000 -- (-780.850) [-783.277] (-778.252) (-785.438) * [-782.046] (-779.324) (-782.747) (-781.739) -- 0:00:42
262500 -- (-779.923) (-780.008) (-779.864) [-782.805] * (-780.041) (-779.612) (-778.319) [-779.137] -- 0:00:42
263000 -- (-779.189) [-780.001] (-778.105) (-778.493) * (-778.276) (-778.590) [-778.122] (-781.856) -- 0:00:42
263500 -- (-779.507) [-778.438] (-779.394) (-778.761) * [-781.224] (-778.638) (-778.215) (-782.155) -- 0:00:41
264000 -- [-782.139] (-778.961) (-778.776) (-778.986) * (-780.678) (-779.790) (-780.987) [-778.533] -- 0:00:41
264500 -- (-778.926) (-779.626) (-782.344) [-778.059] * [-779.109] (-784.003) (-779.044) (-781.003) -- 0:00:41
265000 -- (-778.090) (-782.370) (-781.312) [-782.972] * (-777.880) (-784.353) [-779.684] (-781.700) -- 0:00:41
Average standard deviation of split frequencies: 0.016344
265500 -- [-777.949] (-778.183) (-781.109) (-780.330) * (-778.051) (-781.342) [-781.855] (-782.108) -- 0:00:41
266000 -- (-781.046) (-778.279) [-779.329] (-784.191) * (-778.423) [-778.771] (-779.163) (-779.413) -- 0:00:41
266500 -- (-780.110) [-778.297] (-778.274) (-777.921) * [-778.339] (-781.108) (-780.310) (-779.417) -- 0:00:44
267000 -- [-782.625] (-780.690) (-779.143) (-778.588) * [-778.892] (-784.819) (-781.146) (-778.739) -- 0:00:43
267500 -- (-782.907) (-782.607) (-782.277) [-779.083] * (-780.912) (-778.887) [-781.611] (-780.121) -- 0:00:43
268000 -- (-780.155) (-778.547) (-782.229) [-779.976] * (-780.797) [-778.579] (-784.927) (-779.756) -- 0:00:43
268500 -- [-779.165] (-779.385) (-786.389) (-780.481) * (-781.039) [-781.212] (-781.283) (-780.397) -- 0:00:43
269000 -- (-779.658) [-780.468] (-779.368) (-784.801) * (-780.450) (-778.241) (-780.501) [-781.168] -- 0:00:43
269500 -- (-778.488) (-779.898) [-778.166] (-787.894) * (-784.389) [-782.107] (-779.412) (-780.177) -- 0:00:43
270000 -- (-778.363) [-777.634] (-777.857) (-785.321) * (-781.627) (-782.363) [-779.459] (-783.098) -- 0:00:43
Average standard deviation of split frequencies: 0.017126
270500 -- (-781.008) (-778.669) (-778.508) [-779.328] * (-781.884) (-784.111) (-777.885) [-780.610] -- 0:00:43
271000 -- [-778.742] (-779.742) (-779.382) (-780.083) * [-781.527] (-782.306) (-780.990) (-779.881) -- 0:00:43
271500 -- [-778.152] (-781.409) (-779.064) (-780.949) * (-779.769) (-783.420) [-779.342] (-779.379) -- 0:00:42
272000 -- [-779.527] (-778.991) (-780.099) (-782.520) * (-779.841) (-778.512) [-779.327] (-779.877) -- 0:00:42
272500 -- (-781.831) (-778.266) [-782.078] (-783.057) * [-779.082] (-778.164) (-780.282) (-780.076) -- 0:00:42
273000 -- [-780.344] (-779.749) (-780.983) (-780.686) * (-778.567) (-780.472) (-778.924) [-779.512] -- 0:00:42
273500 -- (-778.924) [-779.959] (-779.697) (-780.441) * (-784.493) [-781.755] (-784.289) (-781.383) -- 0:00:42
274000 -- (-779.043) [-780.878] (-778.304) (-783.477) * [-778.990] (-779.115) (-782.585) (-778.706) -- 0:00:42
274500 -- (-781.845) (-778.635) [-780.445] (-780.199) * (-779.048) (-779.281) (-784.553) [-779.246] -- 0:00:42
275000 -- (-779.303) [-780.466] (-780.761) (-782.441) * (-779.675) (-779.735) (-777.939) [-780.647] -- 0:00:42
Average standard deviation of split frequencies: 0.016276
275500 -- [-780.627] (-784.481) (-784.484) (-779.997) * (-779.632) (-779.181) [-780.645] (-777.822) -- 0:00:42
276000 -- (-778.577) (-780.324) [-778.964] (-780.196) * [-778.484] (-777.960) (-783.547) (-778.049) -- 0:00:41
276500 -- (-783.271) [-781.887] (-778.412) (-780.219) * (-782.349) [-778.532] (-778.972) (-777.839) -- 0:00:41
277000 -- (-785.592) (-779.231) [-779.230] (-784.558) * (-780.036) (-778.957) [-778.579] (-778.745) -- 0:00:41
277500 -- (-780.517) (-779.269) (-780.023) [-782.611] * (-780.850) (-781.676) [-777.835] (-784.153) -- 0:00:41
278000 -- (-779.243) (-784.542) (-783.500) [-778.124] * (-778.955) (-779.792) (-779.707) [-781.129] -- 0:00:41
278500 -- (-778.763) [-781.380] (-779.506) (-781.635) * (-782.329) [-778.419] (-778.545) (-781.104) -- 0:00:41
279000 -- (-782.739) (-780.219) (-778.358) [-783.646] * (-781.616) [-778.847] (-779.268) (-779.661) -- 0:00:41
279500 -- (-781.930) [-780.821] (-782.740) (-779.225) * (-781.149) (-780.522) (-781.506) [-778.558] -- 0:00:41
280000 -- (-780.589) [-780.814] (-780.368) (-778.183) * (-779.169) (-782.715) [-778.624] (-779.309) -- 0:00:41
Average standard deviation of split frequencies: 0.014743
280500 -- [-780.852] (-778.870) (-778.884) (-777.945) * (-778.869) [-780.663] (-779.903) (-782.085) -- 0:00:41
281000 -- (-781.219) (-779.415) [-777.755] (-778.696) * [-779.138] (-785.574) (-781.121) (-781.929) -- 0:00:40
281500 -- (-781.013) (-783.297) (-778.669) [-777.775] * (-783.154) [-779.945] (-784.164) (-779.913) -- 0:00:40
282000 -- [-779.163] (-779.729) (-781.163) (-780.141) * (-781.013) [-780.806] (-778.262) (-780.833) -- 0:00:40
282500 -- [-778.712] (-779.087) (-779.064) (-779.555) * (-779.179) [-778.445] (-781.176) (-777.801) -- 0:00:40
283000 -- (-778.523) [-781.079] (-779.056) (-778.256) * (-780.724) [-778.610] (-780.470) (-778.949) -- 0:00:40
283500 -- [-778.275] (-782.506) (-779.397) (-778.687) * (-781.224) (-779.679) (-779.816) [-779.788] -- 0:00:42
284000 -- [-777.778] (-779.922) (-778.731) (-779.539) * (-778.313) (-779.385) (-778.986) [-780.427] -- 0:00:42
284500 -- (-778.425) (-779.787) (-778.535) [-780.143] * (-782.233) (-780.394) [-778.329] (-779.972) -- 0:00:42
285000 -- (-779.039) (-780.854) (-781.495) [-778.514] * (-782.698) [-778.706] (-781.040) (-778.437) -- 0:00:42
Average standard deviation of split frequencies: 0.012545
285500 -- (-779.104) [-780.257] (-780.265) (-778.122) * (-778.826) [-779.931] (-784.305) (-781.896) -- 0:00:42
286000 -- (-781.571) (-779.173) (-782.204) [-778.253] * (-779.000) (-779.061) (-779.048) [-781.294] -- 0:00:42
286500 -- [-780.019] (-779.426) (-782.964) (-781.940) * (-781.218) (-779.659) (-781.652) [-780.818] -- 0:00:42
287000 -- [-780.426] (-778.185) (-784.231) (-781.972) * (-779.941) [-780.864] (-782.208) (-777.978) -- 0:00:42
287500 -- [-781.630] (-781.745) (-779.218) (-783.150) * [-781.361] (-778.826) (-778.437) (-778.157) -- 0:00:42
288000 -- (-782.284) (-779.666) (-781.230) [-779.112] * [-780.595] (-780.207) (-779.773) (-781.741) -- 0:00:42
288500 -- (-784.164) [-779.293] (-781.701) (-782.885) * [-778.952] (-784.322) (-782.808) (-778.283) -- 0:00:41
289000 -- (-785.230) (-781.941) [-779.732] (-780.269) * (-777.647) [-784.834] (-779.373) (-778.396) -- 0:00:41
289500 -- (-778.948) (-784.047) [-777.851] (-783.306) * (-777.953) [-782.166] (-780.570) (-780.402) -- 0:00:41
290000 -- (-782.116) [-779.235] (-779.817) (-778.610) * (-778.698) (-778.050) [-779.416] (-783.440) -- 0:00:41
Average standard deviation of split frequencies: 0.012344
290500 -- (-784.019) (-781.773) (-779.163) [-778.605] * (-778.773) (-780.970) (-782.727) [-780.783] -- 0:00:41
291000 -- (-784.075) (-778.705) (-782.159) [-779.348] * [-779.288] (-779.627) (-779.330) (-778.548) -- 0:00:41
291500 -- (-779.593) [-778.333] (-783.401) (-781.456) * (-780.397) [-779.657] (-782.336) (-782.950) -- 0:00:41
292000 -- [-779.652] (-778.377) (-781.587) (-781.629) * [-779.195] (-781.644) (-781.226) (-779.710) -- 0:00:41
292500 -- (-780.665) (-777.792) [-781.268] (-783.965) * (-779.003) (-788.206) (-780.771) [-780.738] -- 0:00:41
293000 -- [-778.982] (-779.354) (-779.196) (-780.510) * (-779.132) (-779.323) [-778.753] (-778.113) -- 0:00:41
293500 -- [-780.045] (-781.679) (-780.534) (-783.556) * (-779.545) [-780.283] (-778.764) (-783.967) -- 0:00:40
294000 -- (-782.236) (-777.762) [-780.620] (-780.511) * (-788.294) (-781.071) (-778.887) [-782.181] -- 0:00:40
294500 -- (-778.594) (-779.720) (-779.606) [-778.101] * (-782.083) (-779.834) (-780.321) [-782.780] -- 0:00:40
295000 -- (-779.126) (-779.078) (-779.257) [-779.789] * (-781.267) (-779.414) (-780.621) [-780.370] -- 0:00:40
Average standard deviation of split frequencies: 0.012298
295500 -- (-778.123) (-781.751) [-783.660] (-779.826) * (-780.172) (-779.963) [-779.196] (-782.396) -- 0:00:40
296000 -- [-783.384] (-780.816) (-778.620) (-781.137) * (-780.621) (-779.873) [-780.119] (-780.229) -- 0:00:40
296500 -- (-781.912) (-779.138) [-779.893] (-778.735) * (-782.935) (-779.609) (-780.235) [-780.458] -- 0:00:40
297000 -- (-782.652) (-778.554) (-779.429) [-778.445] * [-783.392] (-779.008) (-780.727) (-786.321) -- 0:00:40
297500 -- [-782.658] (-778.327) (-783.471) (-778.991) * (-779.887) (-781.840) (-780.603) [-778.849] -- 0:00:40
298000 -- [-783.206] (-777.923) (-781.930) (-781.190) * (-778.546) (-778.798) [-780.190] (-779.505) -- 0:00:40
298500 -- [-779.962] (-778.948) (-783.273) (-779.086) * (-778.265) [-779.029] (-783.172) (-782.405) -- 0:00:39
299000 -- (-781.005) (-779.036) [-780.703] (-780.101) * [-779.074] (-780.650) (-779.418) (-783.943) -- 0:00:39
299500 -- (-779.926) (-779.957) (-779.530) [-781.496] * (-780.867) [-778.934] (-781.329) (-786.219) -- 0:00:39
300000 -- (-779.925) (-781.843) (-778.214) [-781.205] * [-778.123] (-778.747) (-782.323) (-782.013) -- 0:00:39
Average standard deviation of split frequencies: 0.011672
300500 -- (-779.626) (-780.363) [-779.036] (-781.109) * (-778.505) (-782.495) (-780.266) [-784.057] -- 0:00:41
301000 -- (-780.593) [-780.606] (-778.673) (-783.399) * [-778.600] (-779.088) (-780.310) (-782.456) -- 0:00:41
301500 -- (-779.634) (-779.163) [-778.607] (-781.382) * (-782.316) [-780.040] (-780.092) (-780.636) -- 0:00:41
302000 -- (-780.031) (-782.709) [-778.700] (-782.216) * (-779.409) (-778.859) (-781.379) [-781.024] -- 0:00:41
302500 -- [-778.365] (-780.495) (-778.453) (-782.440) * [-779.425] (-779.159) (-778.462) (-779.144) -- 0:00:41
303000 -- (-778.344) [-780.821] (-777.774) (-782.235) * (-781.321) [-780.620] (-778.138) (-779.503) -- 0:00:41
303500 -- (-778.838) (-779.707) (-779.538) [-782.008] * (-783.219) (-779.547) (-778.799) [-781.230] -- 0:00:41
304000 -- (-781.321) (-779.236) (-779.039) [-779.428] * [-784.002] (-779.365) (-778.774) (-779.161) -- 0:00:41
304500 -- (-779.520) (-779.030) (-779.808) [-779.955] * [-778.923] (-783.140) (-781.197) (-781.989) -- 0:00:41
305000 -- (-779.741) (-779.268) (-782.413) [-782.683] * (-780.164) (-781.747) [-781.259] (-784.326) -- 0:00:41
Average standard deviation of split frequencies: 0.011212
305500 -- (-779.530) (-782.250) (-780.915) [-778.287] * (-780.746) (-785.529) (-784.419) [-778.550] -- 0:00:40
306000 -- (-779.861) (-778.800) [-777.914] (-784.645) * (-778.520) [-778.886] (-780.317) (-783.701) -- 0:00:40
306500 -- (-779.883) (-780.509) [-778.150] (-778.546) * (-779.236) (-784.686) (-779.877) [-781.288] -- 0:00:40
307000 -- (-782.911) (-779.132) (-779.034) [-778.211] * (-780.570) [-780.238] (-780.037) (-780.934) -- 0:00:40
307500 -- (-786.252) [-782.653] (-779.479) (-778.094) * [-777.592] (-781.562) (-778.534) (-783.367) -- 0:00:40
308000 -- [-783.148] (-780.536) (-782.060) (-780.600) * [-777.592] (-780.851) (-778.638) (-782.979) -- 0:00:40
308500 -- (-780.606) (-782.442) [-778.556] (-781.024) * (-778.771) (-780.476) [-778.635] (-778.439) -- 0:00:40
309000 -- (-779.721) (-780.942) [-779.043] (-784.663) * (-782.552) (-780.771) [-778.344] (-778.867) -- 0:00:40
309500 -- (-781.334) [-781.564] (-779.710) (-779.278) * (-777.947) (-780.824) (-781.924) [-781.466] -- 0:00:40
310000 -- (-783.120) [-778.464] (-779.101) (-780.425) * (-780.529) [-778.474] (-781.464) (-780.255) -- 0:00:40
Average standard deviation of split frequencies: 0.011604
310500 -- (-778.915) (-779.243) (-779.639) [-780.664] * (-782.560) [-778.456] (-780.043) (-779.486) -- 0:00:39
311000 -- (-778.570) (-778.785) [-778.780] (-782.220) * (-780.742) (-778.703) [-777.880] (-781.449) -- 0:00:39
311500 -- (-783.782) [-779.677] (-780.118) (-779.010) * [-778.869] (-779.369) (-780.144) (-778.115) -- 0:00:39
312000 -- (-783.492) [-781.883] (-778.547) (-781.496) * (-777.631) (-779.362) [-779.684] (-778.590) -- 0:00:39
312500 -- (-782.595) (-785.228) (-782.253) [-780.207] * (-777.586) (-778.811) (-779.998) [-777.579] -- 0:00:39
313000 -- (-778.817) (-782.314) [-778.665] (-781.058) * (-783.854) (-778.312) (-779.567) [-778.756] -- 0:00:39
313500 -- (-780.303) (-785.280) (-780.939) [-780.639] * (-778.954) (-778.032) [-777.972] (-777.814) -- 0:00:39
314000 -- (-779.288) (-780.858) [-778.689] (-781.021) * [-779.675] (-779.696) (-778.163) (-778.647) -- 0:00:39
314500 -- [-777.888] (-780.894) (-779.962) (-778.579) * [-780.855] (-779.683) (-780.205) (-779.512) -- 0:00:39
315000 -- [-781.812] (-782.147) (-786.537) (-779.655) * (-783.950) [-778.095] (-780.545) (-781.579) -- 0:00:39
Average standard deviation of split frequencies: 0.012110
315500 -- [-779.325] (-783.115) (-782.726) (-782.786) * (-779.589) [-778.134] (-785.876) (-779.843) -- 0:00:39
316000 -- (-779.186) [-780.612] (-782.323) (-781.133) * (-779.727) [-780.013] (-780.992) (-780.058) -- 0:00:38
316500 -- (-779.859) (-779.281) [-780.937] (-783.835) * (-779.992) (-782.049) (-780.882) [-779.219] -- 0:00:38
317000 -- (-778.752) (-779.918) [-778.873] (-789.071) * [-779.395] (-778.668) (-782.271) (-780.614) -- 0:00:40
317500 -- (-778.248) (-781.907) (-778.807) [-784.004] * (-780.622) (-777.780) [-779.744] (-779.055) -- 0:00:40
318000 -- [-779.525] (-784.146) (-781.662) (-778.342) * (-779.665) [-778.942] (-779.401) (-779.123) -- 0:00:40
318500 -- [-779.211] (-783.586) (-779.279) (-778.698) * (-789.738) (-779.634) (-787.809) [-780.980] -- 0:00:40
319000 -- (-777.747) (-780.302) [-780.436] (-780.944) * (-779.951) (-779.779) (-784.168) [-780.308] -- 0:00:40
319500 -- (-778.492) [-781.564] (-784.431) (-781.761) * [-777.961] (-781.809) (-780.344) (-782.709) -- 0:00:40
320000 -- (-778.403) [-778.407] (-780.707) (-779.343) * (-780.025) (-779.598) (-778.567) [-780.691] -- 0:00:40
Average standard deviation of split frequencies: 0.011026
320500 -- (-779.502) (-783.506) [-781.088] (-779.147) * (-782.495) (-779.356) [-777.954] (-779.792) -- 0:00:40
321000 -- (-779.006) (-779.936) (-784.604) [-779.362] * [-781.382] (-778.538) (-779.237) (-782.604) -- 0:00:40
321500 -- (-778.088) (-782.352) (-782.932) [-783.193] * (-782.167) (-779.755) (-782.459) [-781.051] -- 0:00:40
322000 -- (-779.002) (-781.797) (-782.330) [-783.758] * [-778.972] (-779.496) (-778.585) (-778.533) -- 0:00:40
322500 -- (-779.660) [-778.414] (-781.980) (-779.577) * (-779.375) [-779.147] (-779.437) (-779.056) -- 0:00:39
323000 -- (-780.761) (-780.040) (-781.584) [-779.086] * (-777.886) (-780.673) (-778.754) [-779.914] -- 0:00:39
323500 -- (-779.791) (-778.441) [-779.210] (-778.969) * (-777.976) (-778.921) (-781.999) [-780.468] -- 0:00:39
324000 -- (-778.889) (-780.100) (-778.280) [-778.505] * (-779.142) [-781.892] (-782.446) (-778.838) -- 0:00:39
324500 -- (-777.823) (-781.961) (-781.504) [-779.464] * (-779.979) (-780.043) (-780.654) [-779.273] -- 0:00:39
325000 -- (-780.028) (-778.760) (-780.315) [-778.190] * (-779.396) [-780.556] (-781.599) (-779.017) -- 0:00:39
Average standard deviation of split frequencies: 0.010207
325500 -- [-778.553] (-779.801) (-778.790) (-778.872) * [-781.450] (-780.349) (-779.129) (-779.784) -- 0:00:39
326000 -- (-779.443) (-783.519) (-778.909) [-780.064] * (-783.515) (-779.567) (-780.188) [-778.994] -- 0:00:39
326500 -- (-780.379) [-777.478] (-777.840) (-779.713) * (-779.696) (-783.232) (-778.844) [-778.475] -- 0:00:39
327000 -- (-779.469) (-778.955) (-784.068) [-779.931] * (-780.860) [-779.128] (-779.001) (-778.455) -- 0:00:39
327500 -- (-778.662) (-781.069) [-779.766] (-780.400) * (-778.927) (-778.734) (-779.832) [-780.736] -- 0:00:39
328000 -- (-785.732) (-783.335) [-781.518] (-778.778) * (-781.492) [-779.935] (-777.880) (-778.947) -- 0:00:38
328500 -- (-784.069) [-781.631] (-782.151) (-779.505) * (-780.113) [-778.762] (-777.799) (-781.001) -- 0:00:38
329000 -- [-784.007] (-783.550) (-780.435) (-781.528) * [-779.298] (-779.813) (-777.855) (-781.365) -- 0:00:38
329500 -- (-782.957) [-777.753] (-781.885) (-780.959) * (-779.257) (-777.760) [-779.706] (-783.272) -- 0:00:38
330000 -- (-782.240) [-779.634] (-779.893) (-784.399) * (-782.991) (-779.205) [-779.574] (-779.334) -- 0:00:38
Average standard deviation of split frequencies: 0.010692
330500 -- (-779.280) [-779.953] (-781.902) (-782.933) * (-781.053) [-781.789] (-782.226) (-780.481) -- 0:00:38
331000 -- (-780.364) (-779.753) [-780.110] (-777.679) * [-781.017] (-779.187) (-781.371) (-781.706) -- 0:00:38
331500 -- (-779.611) (-778.683) [-778.206] (-778.635) * (-779.578) [-778.968] (-780.118) (-781.752) -- 0:00:38
332000 -- (-780.654) (-781.094) [-779.554] (-778.579) * (-779.114) [-778.988] (-783.005) (-778.994) -- 0:00:38
332500 -- (-780.875) [-781.689] (-780.614) (-778.654) * (-779.223) (-779.188) [-778.023] (-779.390) -- 0:00:38
333000 -- (-782.053) (-780.692) (-779.208) [-780.012] * (-780.664) (-778.340) (-779.659) [-780.243] -- 0:00:38
333500 -- (-780.940) [-778.140] (-781.287) (-779.126) * [-782.652] (-779.707) (-778.585) (-781.455) -- 0:00:37
334000 -- [-780.150] (-781.834) (-781.623) (-781.196) * (-783.128) [-777.960] (-778.200) (-780.032) -- 0:00:37
334500 -- (-781.612) [-780.534] (-780.387) (-779.254) * (-781.253) (-778.506) [-778.357] (-781.641) -- 0:00:39
335000 -- (-780.334) (-777.855) [-780.917] (-781.922) * [-781.468] (-777.846) (-780.225) (-780.587) -- 0:00:39
Average standard deviation of split frequencies: 0.009408
335500 -- (-781.476) (-778.477) (-784.941) [-779.736] * (-783.991) (-781.006) (-779.386) [-779.316] -- 0:00:39
336000 -- (-779.627) (-779.370) [-779.135] (-781.093) * (-787.010) (-780.364) (-778.076) [-779.290] -- 0:00:39
336500 -- (-779.384) (-780.120) [-781.365] (-778.857) * (-787.245) [-777.962] (-778.832) (-780.230) -- 0:00:39
337000 -- [-778.620] (-779.484) (-779.685) (-780.546) * (-781.631) [-777.825] (-779.976) (-780.317) -- 0:00:39
337500 -- (-778.180) (-780.520) [-778.864] (-779.090) * (-783.711) (-778.964) [-778.738] (-780.603) -- 0:00:39
338000 -- (-778.298) (-777.769) (-781.969) [-779.158] * [-779.975] (-778.720) (-778.678) (-779.664) -- 0:00:39
338500 -- (-781.005) (-777.674) [-778.875] (-780.480) * [-779.984] (-777.696) (-780.098) (-782.420) -- 0:00:39
339000 -- (-778.907) (-778.121) [-779.561] (-779.027) * (-778.688) [-780.546] (-786.877) (-780.052) -- 0:00:38
339500 -- (-780.489) (-777.654) [-780.073] (-787.782) * (-777.822) (-785.130) (-781.891) [-780.641] -- 0:00:38
340000 -- (-786.364) [-778.536] (-781.637) (-786.325) * [-779.257] (-780.975) (-779.602) (-777.582) -- 0:00:38
Average standard deviation of split frequencies: 0.009442
340500 -- [-781.466] (-781.147) (-779.079) (-784.358) * (-779.090) (-781.837) [-780.794] (-779.560) -- 0:00:38
341000 -- (-780.057) (-779.144) [-778.670] (-780.412) * (-779.843) (-779.371) (-779.206) [-778.870] -- 0:00:38
341500 -- (-779.742) (-780.852) (-779.651) [-779.283] * (-785.270) (-780.869) (-778.884) [-777.623] -- 0:00:38
342000 -- (-778.015) (-779.112) (-782.055) [-778.311] * (-783.103) (-781.414) [-779.096] (-784.672) -- 0:00:38
342500 -- [-778.222] (-782.557) (-780.039) (-778.565) * (-780.354) [-781.954] (-779.899) (-783.290) -- 0:00:38
343000 -- (-778.004) (-778.700) [-784.620] (-782.522) * (-778.830) (-780.791) (-781.062) [-784.603] -- 0:00:38
343500 -- (-779.810) (-782.864) (-781.561) [-780.181] * (-778.366) [-779.279] (-784.649) (-783.263) -- 0:00:38
344000 -- (-781.154) (-780.408) (-779.228) [-780.292] * (-778.854) [-778.850] (-779.485) (-783.346) -- 0:00:38
344500 -- (-780.209) (-779.465) (-790.252) [-782.708] * [-778.805] (-779.650) (-778.660) (-779.204) -- 0:00:38
345000 -- [-779.419] (-780.712) (-780.164) (-780.176) * (-778.890) (-783.983) [-779.148] (-779.586) -- 0:00:37
Average standard deviation of split frequencies: 0.009617
345500 -- [-780.492] (-778.987) (-778.992) (-780.681) * [-778.508] (-781.947) (-782.049) (-778.703) -- 0:00:37
346000 -- [-783.748] (-779.310) (-778.083) (-779.926) * (-779.156) (-778.317) (-779.684) [-780.734] -- 0:00:37
346500 -- (-781.283) (-783.709) [-777.735] (-778.286) * (-778.375) (-780.586) [-780.202] (-778.482) -- 0:00:37
347000 -- [-778.708] (-782.907) (-778.952) (-780.998) * [-779.659] (-779.470) (-778.921) (-778.494) -- 0:00:37
347500 -- (-783.465) (-785.629) (-780.471) [-781.232] * (-780.276) (-782.821) [-779.557] (-779.101) -- 0:00:37
348000 -- (-778.761) [-778.005] (-778.648) (-783.218) * (-781.268) [-780.080] (-784.296) (-779.052) -- 0:00:37
348500 -- [-780.819] (-779.495) (-779.149) (-777.955) * (-780.269) [-780.361] (-780.176) (-777.877) -- 0:00:37
349000 -- (-778.248) [-777.633] (-780.901) (-779.850) * (-778.771) (-782.020) (-779.582) [-779.769] -- 0:00:37
349500 -- [-782.495] (-779.295) (-780.564) (-780.475) * (-782.066) [-780.279] (-778.303) (-782.642) -- 0:00:37
350000 -- (-778.446) (-780.525) [-781.613] (-777.939) * (-779.757) (-779.583) (-778.957) [-779.368] -- 0:00:37
Average standard deviation of split frequencies: 0.008990
350500 -- (-777.560) [-783.372] (-782.827) (-779.450) * [-780.580] (-780.545) (-779.176) (-779.612) -- 0:00:37
351000 -- (-778.689) (-779.062) (-781.823) [-778.203] * (-782.453) (-781.005) [-778.700] (-780.083) -- 0:00:36
351500 -- (-781.747) (-778.694) [-780.731] (-778.401) * (-785.349) (-777.909) [-778.758] (-781.550) -- 0:00:38
352000 -- (-779.238) (-777.574) [-778.782] (-779.943) * (-781.055) [-778.770] (-781.731) (-780.000) -- 0:00:38
352500 -- (-781.757) (-778.783) (-778.195) [-779.187] * [-778.166] (-781.057) (-783.484) (-781.161) -- 0:00:38
353000 -- (-786.888) (-783.605) [-778.520] (-780.027) * (-780.991) (-777.759) (-781.388) [-781.463] -- 0:00:38
353500 -- (-778.662) (-783.912) [-781.236] (-781.970) * (-779.282) (-777.734) [-778.459] (-783.823) -- 0:00:38
354000 -- (-778.908) (-784.123) (-778.325) [-778.921] * (-780.334) (-779.367) [-778.891] (-783.823) -- 0:00:38
354500 -- [-778.904] (-779.890) (-778.286) (-782.003) * (-779.071) (-778.086) (-778.272) [-779.041] -- 0:00:38
355000 -- (-780.014) [-779.259] (-782.456) (-782.465) * (-779.807) (-777.813) (-781.506) [-780.078] -- 0:00:38
Average standard deviation of split frequencies: 0.009849
355500 -- (-784.184) (-779.184) [-779.660] (-778.322) * (-781.106) [-777.869] (-778.787) (-780.367) -- 0:00:38
356000 -- [-780.831] (-780.555) (-779.035) (-779.199) * (-781.707) [-778.471] (-780.648) (-780.320) -- 0:00:37
356500 -- [-783.363] (-779.872) (-778.852) (-781.410) * (-778.411) (-779.573) [-783.338] (-782.336) -- 0:00:37
357000 -- (-784.988) (-778.217) [-780.232] (-782.134) * [-777.793] (-783.286) (-779.936) (-780.725) -- 0:00:37
357500 -- [-781.100] (-779.336) (-778.074) (-779.421) * (-779.704) (-779.107) (-780.815) [-778.180] -- 0:00:37
358000 -- (-781.730) (-779.697) (-779.244) [-780.342] * [-779.825] (-779.570) (-778.764) (-778.698) -- 0:00:37
358500 -- [-778.499] (-779.819) (-780.107) (-778.713) * (-778.474) [-779.938] (-782.757) (-778.211) -- 0:00:37
359000 -- (-779.711) (-778.884) [-781.078] (-779.000) * (-779.199) [-778.954] (-778.997) (-778.524) -- 0:00:37
359500 -- [-779.761] (-778.954) (-782.082) (-780.845) * (-778.499) (-780.407) [-777.807] (-779.439) -- 0:00:37
360000 -- (-778.762) [-779.302] (-779.852) (-779.051) * (-778.523) (-782.807) [-779.727] (-779.098) -- 0:00:37
Average standard deviation of split frequencies: 0.008986
360500 -- [-780.530] (-779.608) (-779.011) (-779.858) * (-780.214) [-777.502] (-780.251) (-782.106) -- 0:00:37
361000 -- (-779.496) (-780.243) (-779.214) [-780.193] * (-782.990) (-777.718) (-780.981) [-782.806] -- 0:00:37
361500 -- [-779.280] (-778.473) (-779.743) (-779.321) * [-780.526] (-779.124) (-780.007) (-777.765) -- 0:00:37
362000 -- (-779.845) [-778.372] (-784.384) (-778.399) * (-782.139) (-779.088) (-780.090) [-777.943] -- 0:00:37
362500 -- (-778.753) [-780.343] (-781.919) (-779.229) * (-782.330) (-779.099) [-779.639] (-780.717) -- 0:00:36
363000 -- (-779.255) [-781.660] (-779.219) (-778.560) * (-782.848) (-779.773) (-780.335) [-784.476] -- 0:00:36
363500 -- (-778.778) (-784.325) (-784.462) [-778.579] * [-781.837] (-781.494) (-781.424) (-779.996) -- 0:00:36
364000 -- (-778.978) (-780.853) (-781.022) [-778.407] * (-779.120) (-781.249) [-779.875] (-780.239) -- 0:00:36
364500 -- [-779.321] (-778.414) (-783.171) (-779.220) * (-784.696) (-780.972) (-782.571) [-780.595] -- 0:00:36
365000 -- (-780.294) (-778.655) (-780.410) [-778.205] * [-779.074] (-777.948) (-784.915) (-777.920) -- 0:00:36
Average standard deviation of split frequencies: 0.008561
365500 -- [-780.350] (-782.112) (-780.175) (-781.180) * (-778.821) (-777.955) [-779.102] (-778.605) -- 0:00:36
366000 -- (-781.310) (-786.234) [-777.702] (-779.148) * (-779.135) (-780.346) (-781.139) [-779.949] -- 0:00:36
366500 -- (-778.690) [-779.111] (-778.775) (-779.414) * (-780.033) [-778.209] (-780.280) (-780.347) -- 0:00:36
367000 -- (-782.047) (-779.398) [-778.524] (-779.742) * (-781.440) (-779.287) [-780.812] (-781.432) -- 0:00:36
367500 -- (-780.633) [-779.472] (-781.740) (-780.200) * [-778.265] (-777.980) (-782.903) (-784.781) -- 0:00:36
368000 -- (-779.328) (-778.379) (-780.880) [-781.210] * [-778.536] (-777.859) (-780.314) (-786.862) -- 0:00:36
368500 -- (-780.277) (-779.512) [-779.394] (-781.795) * (-780.013) [-779.046] (-782.875) (-794.892) -- 0:00:37
369000 -- (-778.755) (-778.790) [-777.647] (-778.906) * (-781.084) [-778.370] (-778.370) (-785.890) -- 0:00:37
369500 -- (-779.861) (-780.071) [-780.508] (-782.758) * (-779.949) [-778.091] (-782.151) (-781.225) -- 0:00:37
370000 -- [-779.786] (-778.339) (-780.892) (-783.343) * (-782.600) [-778.612] (-778.668) (-778.575) -- 0:00:37
Average standard deviation of split frequencies: 0.008973
370500 -- (-778.543) (-778.272) (-779.554) [-780.336] * (-778.861) [-779.678] (-779.568) (-782.203) -- 0:00:37
371000 -- (-779.864) (-779.738) [-781.670] (-780.584) * [-779.019] (-780.791) (-782.826) (-779.087) -- 0:00:37
371500 -- (-783.802) (-783.546) [-780.107] (-778.418) * (-782.026) (-778.552) (-782.217) [-779.703] -- 0:00:37
372000 -- [-781.895] (-781.140) (-781.613) (-782.282) * [-779.041] (-781.150) (-778.390) (-779.690) -- 0:00:37
372500 -- [-780.884] (-782.402) (-778.105) (-780.038) * (-780.509) (-781.168) [-779.598] (-778.621) -- 0:00:37
373000 -- (-780.445) (-782.735) (-779.988) [-779.811] * (-779.266) (-780.162) [-779.306] (-779.488) -- 0:00:36
373500 -- (-781.025) (-781.071) (-779.537) [-780.541] * (-779.416) [-778.500] (-779.309) (-780.761) -- 0:00:36
374000 -- (-782.003) (-782.468) (-778.875) [-780.371] * (-779.887) (-778.737) [-779.309] (-779.631) -- 0:00:36
374500 -- (-782.484) [-779.747] (-779.679) (-779.454) * (-778.885) (-780.351) [-781.377] (-783.046) -- 0:00:36
375000 -- (-778.838) (-781.216) [-777.972] (-781.353) * (-779.352) (-780.292) (-780.384) [-781.631] -- 0:00:36
Average standard deviation of split frequencies: 0.010472
375500 -- (-779.594) (-782.573) [-779.321] (-778.531) * (-779.562) [-778.627] (-784.537) (-782.051) -- 0:00:36
376000 -- [-780.219] (-779.198) (-778.861) (-781.154) * [-779.482] (-779.709) (-779.551) (-779.103) -- 0:00:36
376500 -- (-783.105) (-782.536) [-778.602] (-779.837) * [-779.258] (-781.059) (-780.833) (-778.405) -- 0:00:36
377000 -- (-782.494) (-780.946) [-781.404] (-783.667) * (-777.973) (-779.506) (-780.292) [-778.335] -- 0:00:36
377500 -- [-779.453] (-784.082) (-778.050) (-781.866) * (-778.988) [-781.598] (-779.835) (-780.281) -- 0:00:36
378000 -- (-779.745) [-780.975] (-777.671) (-781.341) * (-779.458) (-779.054) [-779.630] (-780.480) -- 0:00:36
378500 -- (-779.122) (-781.380) (-779.446) [-779.304] * (-779.823) (-779.562) (-781.197) [-780.697] -- 0:00:36
379000 -- (-778.311) (-782.082) [-778.980] (-780.115) * (-783.208) [-779.717] (-784.302) (-781.775) -- 0:00:36
379500 -- (-779.016) [-778.018] (-781.628) (-779.026) * (-778.833) [-781.255] (-781.351) (-780.387) -- 0:00:35
380000 -- (-778.659) [-778.679] (-777.981) (-777.800) * (-783.009) (-779.226) [-779.264] (-780.022) -- 0:00:35
Average standard deviation of split frequencies: 0.011072
380500 -- (-778.229) (-778.109) (-781.732) [-779.363] * (-781.245) [-778.343] (-778.799) (-779.323) -- 0:00:35
381000 -- (-780.116) (-778.467) [-778.872] (-782.331) * [-779.300] (-778.074) (-778.303) (-782.120) -- 0:00:35
381500 -- (-780.853) (-780.631) [-777.873] (-779.547) * [-779.215] (-780.113) (-781.701) (-781.274) -- 0:00:35
382000 -- (-780.933) (-780.381) [-778.632] (-779.815) * (-778.443) [-778.572] (-780.654) (-778.603) -- 0:00:35
382500 -- [-783.352] (-781.579) (-778.336) (-780.379) * (-777.581) (-779.488) [-779.521] (-779.235) -- 0:00:35
383000 -- (-779.837) (-781.393) [-778.105] (-778.999) * (-779.907) (-781.644) (-779.721) [-782.071] -- 0:00:35
383500 -- (-782.955) (-780.420) (-778.268) [-778.175] * (-778.584) [-778.284] (-778.977) (-782.546) -- 0:00:35
384000 -- [-784.642] (-777.811) (-777.752) (-784.335) * (-780.604) [-779.138] (-784.262) (-778.366) -- 0:00:35
384500 -- (-782.145) (-778.785) (-777.831) [-779.244] * (-784.385) [-780.360] (-779.127) (-779.794) -- 0:00:35
385000 -- (-779.006) (-781.313) (-778.588) [-780.240] * (-778.739) [-777.926] (-780.518) (-779.847) -- 0:00:36
Average standard deviation of split frequencies: 0.010776
385500 -- (-780.483) (-779.561) (-778.720) [-780.764] * (-781.623) (-779.509) (-779.162) [-779.793] -- 0:00:36
386000 -- [-783.362] (-778.501) (-781.960) (-783.957) * (-778.768) (-778.247) (-779.657) [-779.127] -- 0:00:36
386500 -- (-779.260) (-779.556) (-778.477) [-781.898] * (-780.198) [-780.084] (-780.849) (-779.844) -- 0:00:36
387000 -- [-780.015] (-782.512) (-779.527) (-779.788) * [-778.919] (-779.004) (-779.468) (-779.691) -- 0:00:36
387500 -- (-779.822) [-780.471] (-780.549) (-777.855) * (-778.840) (-779.374) [-778.828] (-777.722) -- 0:00:36
388000 -- (-779.815) [-779.937] (-780.079) (-777.863) * [-780.369] (-780.305) (-780.013) (-778.495) -- 0:00:36
388500 -- (-780.097) [-780.799] (-778.884) (-780.630) * [-779.057] (-780.435) (-777.755) (-777.852) -- 0:00:36
389000 -- (-779.516) [-780.139] (-778.384) (-780.392) * (-781.940) [-779.129] (-778.805) (-777.641) -- 0:00:36
389500 -- (-781.755) (-779.605) [-778.597] (-781.769) * (-780.112) (-780.115) [-779.156] (-780.006) -- 0:00:36
390000 -- (-779.017) [-778.082] (-777.604) (-778.001) * (-779.701) [-779.567] (-778.295) (-783.461) -- 0:00:35
Average standard deviation of split frequencies: 0.011357
390500 -- (-779.724) [-779.790] (-777.716) (-777.486) * (-780.369) (-780.585) (-780.378) [-782.119] -- 0:00:35
391000 -- (-778.441) (-780.536) (-782.849) [-777.486] * (-782.366) (-781.609) [-779.163] (-778.486) -- 0:00:35
391500 -- (-781.541) (-781.171) [-779.087] (-777.636) * [-778.763] (-782.107) (-779.245) (-780.694) -- 0:00:35
392000 -- (-778.529) (-782.562) (-781.095) [-778.524] * (-780.157) (-783.522) (-780.536) [-779.942] -- 0:00:35
392500 -- (-779.763) [-779.648] (-780.965) (-783.085) * (-780.046) (-779.783) [-779.268] (-781.264) -- 0:00:35
393000 -- (-778.818) (-781.413) [-781.104] (-783.320) * (-781.773) (-782.264) (-779.589) [-778.938] -- 0:00:35
393500 -- [-780.027] (-779.423) (-780.383) (-781.650) * (-779.529) [-781.160] (-781.027) (-779.140) -- 0:00:35
394000 -- (-781.899) (-777.502) [-778.870] (-781.639) * (-778.822) (-779.093) [-778.321] (-780.307) -- 0:00:35
394500 -- (-783.983) (-777.750) [-782.221] (-782.844) * (-779.403) [-780.817] (-778.528) (-783.814) -- 0:00:35
395000 -- [-779.951] (-779.477) (-780.962) (-783.487) * [-783.070] (-778.760) (-779.894) (-780.473) -- 0:00:35
Average standard deviation of split frequencies: 0.011309
395500 -- [-779.465] (-782.290) (-783.943) (-779.549) * (-783.557) [-781.234] (-779.576) (-778.971) -- 0:00:35
396000 -- [-777.939] (-778.521) (-781.737) (-780.383) * (-777.713) [-780.672] (-779.683) (-778.535) -- 0:00:35
396500 -- (-783.140) (-780.868) (-780.421) [-779.796] * (-781.562) (-782.151) (-778.552) [-779.627] -- 0:00:35
397000 -- [-781.165] (-778.644) (-779.855) (-780.826) * (-780.089) (-785.928) [-778.179] (-780.136) -- 0:00:34
397500 -- [-777.564] (-786.799) (-779.128) (-784.438) * (-779.166) (-780.229) [-778.753] (-780.996) -- 0:00:34
398000 -- (-779.352) (-780.855) [-780.268] (-780.059) * (-778.944) (-779.666) [-778.753] (-780.466) -- 0:00:34
398500 -- (-779.591) (-780.133) [-777.785] (-780.117) * [-782.641] (-781.696) (-780.573) (-778.791) -- 0:00:34
399000 -- [-779.435] (-780.624) (-781.896) (-779.743) * (-782.806) [-781.588] (-780.408) (-780.253) -- 0:00:34
399500 -- (-780.910) [-780.767] (-779.031) (-780.346) * (-781.615) (-781.153) (-778.594) [-782.352] -- 0:00:34
400000 -- (-780.777) (-778.765) [-778.547] (-778.918) * [-780.432] (-778.548) (-781.568) (-780.746) -- 0:00:34
Average standard deviation of split frequencies: 0.011504
400500 -- (-784.694) (-779.027) [-780.034] (-778.825) * [-781.470] (-779.800) (-786.546) (-780.351) -- 0:00:34
401000 -- (-783.135) [-778.982] (-784.078) (-778.082) * (-783.982) [-780.028] (-781.550) (-778.760) -- 0:00:34
401500 -- (-778.295) (-778.889) [-785.308] (-778.501) * (-778.143) [-784.672] (-781.805) (-783.074) -- 0:00:34
402000 -- [-778.384] (-779.509) (-778.463) (-778.814) * (-778.967) (-779.746) (-781.075) [-778.422] -- 0:00:35
402500 -- [-778.341] (-779.437) (-778.939) (-779.332) * [-781.486] (-780.750) (-779.949) (-778.353) -- 0:00:35
403000 -- (-782.260) (-778.726) (-784.089) [-779.256] * (-781.256) (-779.074) [-779.305] (-779.840) -- 0:00:35
403500 -- (-780.196) (-778.388) [-778.367] (-778.626) * (-783.414) (-777.821) (-780.715) [-779.022] -- 0:00:35
404000 -- (-778.276) (-778.481) [-778.763] (-782.473) * [-783.142] (-781.415) (-779.564) (-777.991) -- 0:00:35
404500 -- (-783.631) [-778.410] (-780.430) (-782.310) * [-778.375] (-780.011) (-779.424) (-778.252) -- 0:00:35
405000 -- (-782.756) [-777.999] (-780.440) (-777.961) * (-778.074) (-786.515) (-780.052) [-780.676] -- 0:00:35
Average standard deviation of split frequencies: 0.011095
405500 -- (-778.185) (-778.228) (-779.272) [-778.313] * (-778.739) [-781.398] (-779.853) (-782.181) -- 0:00:35
406000 -- (-781.538) [-777.967] (-778.420) (-778.680) * (-782.185) (-784.325) (-778.474) [-779.436] -- 0:00:35
406500 -- [-778.660] (-779.261) (-779.944) (-784.683) * (-779.920) [-780.346] (-781.439) (-780.412) -- 0:00:35
407000 -- (-779.076) (-780.977) [-779.979] (-781.672) * (-781.211) [-778.925] (-778.336) (-783.034) -- 0:00:34
407500 -- (-778.802) (-780.335) [-778.761] (-778.894) * (-780.308) (-778.249) [-780.589] (-778.562) -- 0:00:34
408000 -- (-782.455) [-781.393] (-779.227) (-779.330) * [-778.423] (-777.862) (-777.576) (-779.380) -- 0:00:34
408500 -- (-779.160) (-784.512) [-779.559] (-780.581) * [-779.496] (-780.990) (-777.605) (-783.632) -- 0:00:34
409000 -- (-780.463) (-786.169) [-780.313] (-779.824) * (-781.495) (-780.142) [-778.114] (-779.717) -- 0:00:34
409500 -- (-781.742) (-779.815) (-779.255) [-779.654] * (-783.201) (-780.142) (-778.141) [-781.431] -- 0:00:34
410000 -- (-780.770) [-779.490] (-780.934) (-783.712) * [-780.435] (-781.140) (-783.393) (-782.578) -- 0:00:34
Average standard deviation of split frequencies: 0.011033
410500 -- [-779.110] (-780.493) (-779.554) (-785.090) * (-779.452) [-779.042] (-784.565) (-780.776) -- 0:00:34
411000 -- (-777.797) (-778.855) [-778.632] (-783.601) * (-780.868) (-780.098) (-778.929) [-778.472] -- 0:00:34
411500 -- (-778.134) (-781.087) [-779.008] (-780.000) * (-779.663) [-781.019] (-780.211) (-780.136) -- 0:00:34
412000 -- (-779.467) [-778.423] (-778.504) (-778.843) * (-779.344) (-778.247) (-779.042) [-778.453] -- 0:00:34
412500 -- (-781.603) (-778.984) [-779.288] (-778.652) * (-782.120) (-780.916) (-779.363) [-781.317] -- 0:00:34
413000 -- (-780.494) (-779.626) [-778.851] (-781.605) * (-783.131) (-780.903) (-778.093) [-778.947] -- 0:00:34
413500 -- (-780.448) [-779.628] (-780.625) (-783.161) * [-777.691] (-780.947) (-778.911) (-778.148) -- 0:00:34
414000 -- [-786.824] (-778.710) (-782.672) (-779.969) * (-780.460) (-778.886) [-777.753] (-779.049) -- 0:00:33
414500 -- (-779.867) [-778.285] (-780.149) (-783.369) * (-778.719) [-779.401] (-780.997) (-778.581) -- 0:00:33
415000 -- (-778.219) [-778.354] (-778.612) (-783.483) * (-777.689) (-781.175) (-782.722) [-777.949] -- 0:00:33
Average standard deviation of split frequencies: 0.011898
415500 -- (-778.525) [-778.149] (-778.259) (-783.356) * (-779.968) [-780.406] (-779.185) (-781.659) -- 0:00:33
416000 -- [-783.234] (-781.619) (-780.505) (-780.460) * [-779.153] (-779.533) (-778.506) (-783.441) -- 0:00:33
416500 -- (-781.735) (-778.138) [-777.705] (-778.092) * (-780.926) [-779.799] (-779.280) (-779.455) -- 0:00:33
417000 -- [-781.250] (-781.017) (-778.095) (-779.476) * (-781.018) (-782.013) (-779.901) [-778.450] -- 0:00:33
417500 -- [-778.481] (-778.828) (-779.383) (-780.758) * (-780.088) (-780.662) (-782.722) [-778.182] -- 0:00:33
418000 -- (-779.928) (-779.520) (-779.422) [-780.330] * [-781.589] (-779.315) (-777.888) (-780.520) -- 0:00:33
418500 -- (-780.138) [-778.230] (-778.916) (-779.971) * (-779.506) [-778.498] (-779.897) (-778.279) -- 0:00:34
419000 -- (-780.177) (-778.629) (-779.701) [-778.793] * (-778.107) [-781.115] (-779.347) (-778.823) -- 0:00:34
419500 -- [-779.947] (-778.399) (-779.743) (-782.864) * [-777.975] (-781.896) (-780.039) (-778.832) -- 0:00:34
420000 -- (-780.355) (-778.464) [-780.781] (-781.679) * [-778.023] (-781.773) (-779.544) (-783.670) -- 0:00:34
Average standard deviation of split frequencies: 0.013118
420500 -- (-779.328) (-778.359) (-781.779) [-778.487] * [-782.806] (-781.340) (-787.419) (-783.846) -- 0:00:34
421000 -- (-780.620) (-778.695) [-779.711] (-782.282) * (-779.788) [-778.843] (-778.497) (-778.036) -- 0:00:34
421500 -- (-779.475) (-778.017) [-779.116] (-780.567) * (-779.148) [-780.155] (-781.653) (-777.740) -- 0:00:34
422000 -- (-779.505) (-781.513) (-778.914) [-778.529] * (-779.737) [-780.567] (-780.087) (-779.932) -- 0:00:34
422500 -- (-783.192) (-778.567) (-777.537) [-778.599] * (-782.321) (-777.831) [-780.718] (-779.830) -- 0:00:34
423000 -- [-778.265] (-779.116) (-779.971) (-779.484) * (-782.208) [-782.444] (-779.710) (-781.108) -- 0:00:34
423500 -- (-782.395) (-784.257) [-778.160] (-779.956) * (-778.740) [-778.073] (-778.559) (-782.824) -- 0:00:34
424000 -- [-780.743] (-780.135) (-778.070) (-778.251) * (-779.551) (-779.096) [-781.414] (-781.544) -- 0:00:33
424500 -- (-781.237) (-778.911) (-781.962) [-780.141] * [-782.214] (-781.287) (-780.464) (-786.014) -- 0:00:33
425000 -- (-777.687) (-786.562) [-784.274] (-781.241) * (-779.189) (-781.978) [-782.898] (-780.933) -- 0:00:33
Average standard deviation of split frequencies: 0.012823
425500 -- (-780.237) (-780.588) (-786.587) [-779.143] * (-782.080) [-783.465] (-780.390) (-778.580) -- 0:00:33
426000 -- (-778.346) (-778.365) (-782.832) [-780.006] * (-778.934) (-784.051) [-781.241] (-778.319) -- 0:00:33
426500 -- (-779.294) (-779.455) [-778.893] (-780.687) * (-778.637) (-778.815) (-781.678) [-779.553] -- 0:00:33
427000 -- (-779.205) (-782.824) [-779.108] (-781.360) * [-780.693] (-780.653) (-785.873) (-779.585) -- 0:00:33
427500 -- [-779.212] (-782.370) (-780.376) (-780.502) * (-781.993) [-780.313] (-784.106) (-779.932) -- 0:00:33
428000 -- (-781.174) (-780.450) [-779.602] (-781.943) * (-778.836) (-778.597) (-781.700) [-779.084] -- 0:00:33
428500 -- (-779.414) [-781.626] (-780.014) (-780.963) * (-779.604) (-781.787) [-779.972] (-779.982) -- 0:00:33
429000 -- (-782.248) (-779.643) [-778.278] (-779.329) * (-779.112) (-782.070) (-781.528) [-779.601] -- 0:00:33
429500 -- (-784.662) [-778.794] (-778.494) (-780.023) * (-780.710) (-779.209) (-781.041) [-778.653] -- 0:00:33
430000 -- (-781.834) (-779.856) [-782.939] (-779.194) * (-778.879) (-780.440) [-783.255] (-781.102) -- 0:00:33
Average standard deviation of split frequencies: 0.013439
430500 -- [-779.437] (-784.759) (-783.526) (-778.835) * (-780.197) (-778.223) [-779.975] (-781.436) -- 0:00:33
431000 -- [-780.608] (-784.558) (-786.229) (-779.662) * (-779.654) [-781.062] (-780.593) (-777.682) -- 0:00:33
431500 -- (-780.020) [-779.212] (-782.501) (-779.616) * (-780.184) (-780.927) [-779.249] (-778.122) -- 0:00:32
432000 -- [-782.052] (-779.617) (-780.869) (-779.118) * (-782.239) [-779.430] (-778.088) (-778.161) -- 0:00:32
432500 -- (-777.723) [-780.729] (-782.757) (-778.633) * (-781.073) (-785.127) (-778.916) [-779.717] -- 0:00:32
433000 -- (-778.085) (-782.309) (-783.295) [-781.499] * (-779.837) (-781.366) (-780.558) [-778.390] -- 0:00:32
433500 -- (-781.623) (-783.822) (-780.585) [-778.756] * [-779.549] (-783.692) (-782.686) (-778.318) -- 0:00:32
434000 -- (-782.677) (-777.986) [-780.264] (-780.923) * [-780.753] (-782.299) (-784.567) (-778.844) -- 0:00:32
434500 -- [-780.269] (-780.124) (-788.079) (-780.999) * (-777.924) (-784.586) [-778.883] (-779.584) -- 0:00:32
435000 -- (-781.156) [-779.496] (-785.810) (-780.046) * [-780.798] (-780.036) (-780.716) (-781.696) -- 0:00:32
Average standard deviation of split frequencies: 0.012854
435500 -- (-781.405) (-781.853) (-780.658) [-779.975] * (-779.768) [-780.314] (-782.084) (-779.842) -- 0:00:33
436000 -- (-781.486) [-782.196] (-779.273) (-781.631) * (-779.601) (-780.421) (-779.128) [-779.114] -- 0:00:33
436500 -- [-778.264] (-782.062) (-782.105) (-778.750) * (-778.613) (-778.816) [-779.010] (-781.005) -- 0:00:33
437000 -- [-778.257] (-787.121) (-783.018) (-781.435) * (-778.174) [-779.663] (-784.661) (-780.216) -- 0:00:33
437500 -- [-778.106] (-779.442) (-782.605) (-778.281) * [-778.146] (-780.841) (-780.260) (-781.656) -- 0:00:33
438000 -- (-781.088) (-779.872) [-780.308] (-780.324) * [-781.043] (-782.885) (-780.292) (-780.491) -- 0:00:33
438500 -- [-778.806] (-779.331) (-783.326) (-783.202) * (-783.972) (-782.183) (-781.271) [-779.461] -- 0:00:33
439000 -- (-779.902) (-778.985) (-778.890) [-783.108] * (-779.261) (-779.729) [-780.245] (-778.432) -- 0:00:33
439500 -- (-780.531) [-778.617] (-778.715) (-779.115) * (-779.124) [-779.365] (-786.289) (-779.455) -- 0:00:33
440000 -- (-779.797) [-779.426] (-782.692) (-778.226) * [-778.964] (-782.688) (-780.738) (-778.867) -- 0:00:33
Average standard deviation of split frequencies: 0.011173
440500 -- (-778.452) (-779.692) (-782.545) [-778.142] * (-780.093) (-782.918) (-780.470) [-778.719] -- 0:00:33
441000 -- (-778.602) (-779.962) (-778.796) [-778.227] * (-779.083) (-780.359) (-778.672) [-781.325] -- 0:00:32
441500 -- [-778.452] (-785.066) (-783.386) (-782.380) * [-782.044] (-781.009) (-779.736) (-779.995) -- 0:00:32
442000 -- (-780.249) (-786.062) (-778.576) [-780.125] * (-779.673) (-782.549) [-777.644] (-779.703) -- 0:00:32
442500 -- (-780.766) [-779.252] (-778.769) (-777.805) * (-778.992) [-781.976] (-782.228) (-781.300) -- 0:00:32
443000 -- (-781.852) (-779.921) (-782.528) [-777.739] * (-783.557) [-778.288] (-781.921) (-780.974) -- 0:00:32
443500 -- (-782.148) (-779.365) (-778.948) [-777.739] * (-779.262) [-778.669] (-780.849) (-780.246) -- 0:00:32
444000 -- [-779.876] (-779.760) (-778.761) (-778.086) * (-786.467) (-783.613) (-781.717) [-783.789] -- 0:00:32
444500 -- (-781.592) (-779.242) [-780.544] (-779.089) * [-786.276] (-781.332) (-780.801) (-783.735) -- 0:00:32
445000 -- (-779.254) [-779.572] (-782.017) (-777.971) * (-780.759) (-779.875) (-781.040) [-779.016] -- 0:00:32
Average standard deviation of split frequencies: 0.011627
445500 -- (-782.673) (-779.901) [-781.024] (-779.910) * [-779.722] (-780.920) (-780.299) (-778.653) -- 0:00:32
446000 -- (-782.062) [-778.296] (-785.338) (-779.101) * (-780.080) (-779.068) (-783.156) [-779.392] -- 0:00:32
446500 -- [-780.434] (-780.224) (-781.122) (-778.534) * (-779.220) (-784.531) (-782.403) [-778.849] -- 0:00:32
447000 -- [-780.200] (-781.045) (-778.564) (-782.370) * (-778.673) (-781.763) [-778.913] (-779.123) -- 0:00:32
447500 -- (-780.415) (-779.088) [-779.473] (-781.217) * [-779.122] (-781.937) (-780.628) (-784.146) -- 0:00:32
448000 -- (-779.522) [-779.412] (-780.786) (-779.014) * (-779.785) (-778.514) (-778.079) [-779.289] -- 0:00:32
448500 -- (-779.934) (-785.154) [-778.860] (-779.771) * (-779.836) [-779.861] (-779.790) (-778.537) -- 0:00:31
449000 -- (-778.584) (-782.785) [-778.410] (-780.730) * (-780.111) (-784.470) [-778.957] (-785.967) -- 0:00:31
449500 -- (-779.910) (-779.322) (-779.339) [-779.978] * (-780.480) (-783.000) (-779.291) [-778.329] -- 0:00:31
450000 -- (-779.067) (-782.250) [-780.731] (-778.430) * (-779.380) (-783.763) (-781.186) [-778.418] -- 0:00:31
Average standard deviation of split frequencies: 0.011564
450500 -- (-778.896) [-781.520] (-779.440) (-778.368) * [-779.318] (-780.068) (-783.041) (-778.318) -- 0:00:31
451000 -- (-780.575) (-780.132) (-779.445) [-778.782] * (-781.535) (-780.968) [-780.017] (-779.514) -- 0:00:31
451500 -- (-781.956) (-779.155) [-778.115] (-780.538) * (-780.890) [-778.215] (-779.419) (-778.772) -- 0:00:31
452000 -- (-779.614) (-779.597) [-780.479] (-780.458) * (-783.308) (-781.821) (-779.233) [-780.392] -- 0:00:31
452500 -- (-778.506) (-780.134) (-780.074) [-778.869] * (-780.357) [-779.602] (-783.303) (-778.267) -- 0:00:32
453000 -- (-778.261) (-784.777) (-778.474) [-780.985] * (-777.989) (-780.315) [-780.858] (-780.479) -- 0:00:32
453500 -- (-779.675) (-780.278) [-779.543] (-779.742) * (-778.213) [-779.954] (-779.956) (-782.000) -- 0:00:32
454000 -- (-778.439) (-780.217) (-778.924) [-778.246] * [-778.798] (-782.530) (-779.185) (-786.401) -- 0:00:32
454500 -- (-785.196) (-782.063) (-779.909) [-780.146] * [-782.684] (-780.772) (-778.414) (-783.871) -- 0:00:32
455000 -- (-778.725) (-780.193) (-778.386) [-779.067] * (-779.103) [-780.861] (-777.572) (-780.087) -- 0:00:32
Average standard deviation of split frequencies: 0.011142
455500 -- [-779.566] (-779.648) (-778.867) (-778.440) * (-781.833) (-781.669) (-777.446) [-779.695] -- 0:00:32
456000 -- (-783.540) (-781.598) (-786.762) [-778.844] * (-782.294) (-783.334) (-778.669) [-779.132] -- 0:00:32
456500 -- (-780.489) (-780.623) [-779.331] (-779.816) * (-778.324) (-780.503) [-778.530] (-779.407) -- 0:00:32
457000 -- (-778.374) [-777.742] (-779.705) (-779.336) * (-777.614) (-778.409) (-779.502) [-778.755] -- 0:00:32
457500 -- (-781.372) [-779.472] (-781.309) (-779.124) * (-781.591) (-779.427) [-779.051] (-779.471) -- 0:00:32
458000 -- (-779.095) [-781.787] (-783.338) (-779.771) * (-778.565) (-780.826) (-779.741) [-778.562] -- 0:00:31
458500 -- (-781.628) (-782.027) [-779.333] (-778.859) * (-778.438) [-779.341] (-779.609) (-778.768) -- 0:00:31
459000 -- (-779.131) (-779.263) (-780.170) [-778.594] * (-778.559) (-779.733) [-781.719] (-779.985) -- 0:00:31
459500 -- [-779.223] (-777.607) (-777.738) (-779.627) * (-779.305) [-779.271] (-778.424) (-781.008) -- 0:00:31
460000 -- (-782.332) [-778.570] (-781.975) (-779.657) * (-778.426) (-782.898) [-781.298] (-779.788) -- 0:00:31
Average standard deviation of split frequencies: 0.009270
460500 -- (-781.555) (-779.144) [-780.373] (-778.913) * (-778.331) [-779.458] (-780.419) (-777.578) -- 0:00:31
461000 -- (-781.939) (-778.556) (-783.544) [-780.590] * (-778.142) (-778.201) [-779.429] (-779.643) -- 0:00:31
461500 -- (-779.816) [-778.719] (-783.250) (-788.495) * [-780.506] (-779.310) (-779.069) (-779.921) -- 0:00:31
462000 -- (-779.626) [-778.290] (-781.402) (-780.092) * (-779.614) (-780.731) (-778.108) [-778.744] -- 0:00:31
462500 -- (-780.941) (-779.010) [-784.096] (-778.546) * (-779.886) (-780.436) [-781.046] (-778.327) -- 0:00:31
463000 -- (-778.169) [-778.405] (-778.047) (-778.674) * (-783.446) (-781.919) (-780.056) [-778.753] -- 0:00:31
463500 -- [-779.839] (-778.307) (-778.312) (-779.951) * (-780.013) (-782.522) (-780.628) [-779.066] -- 0:00:31
464000 -- (-780.222) (-778.469) [-778.453] (-779.501) * [-778.985] (-779.442) (-778.157) (-782.680) -- 0:00:31
464500 -- (-778.399) (-779.881) [-781.715] (-781.263) * [-779.192] (-778.443) (-780.460) (-781.340) -- 0:00:31
465000 -- [-779.954] (-779.435) (-782.139) (-783.794) * (-786.381) (-778.250) (-778.935) [-784.941] -- 0:00:31
Average standard deviation of split frequencies: 0.009640
465500 -- (-778.722) [-780.212] (-780.245) (-778.419) * (-778.711) [-777.705] (-779.355) (-781.398) -- 0:00:31
466000 -- (-777.721) (-778.707) (-781.392) [-778.963] * (-780.935) (-779.437) (-780.483) [-779.769] -- 0:00:30
466500 -- (-780.362) (-779.179) (-779.818) [-778.639] * [-779.397] (-777.713) (-782.247) (-778.664) -- 0:00:30
467000 -- (-779.985) (-781.417) (-780.593) [-778.159] * (-779.170) [-779.143] (-779.024) (-780.316) -- 0:00:30
467500 -- [-781.317] (-780.311) (-780.181) (-778.785) * (-778.804) [-779.340] (-780.644) (-779.636) -- 0:00:30
468000 -- (-780.284) (-779.508) (-779.997) [-779.426] * [-780.207] (-779.350) (-778.397) (-778.625) -- 0:00:30
468500 -- (-777.986) (-779.093) (-780.727) [-783.140] * (-779.975) (-778.815) (-779.854) [-780.482] -- 0:00:30
469000 -- [-780.979] (-779.568) (-780.283) (-779.550) * (-779.665) [-779.796] (-779.368) (-779.525) -- 0:00:30
469500 -- (-783.674) [-782.339] (-778.812) (-778.842) * (-781.864) (-781.424) (-778.456) [-782.090] -- 0:00:31
470000 -- (-781.172) (-783.693) (-778.359) [-778.220] * (-780.174) (-780.615) (-778.576) [-779.263] -- 0:00:31
Average standard deviation of split frequencies: 0.009703
470500 -- [-778.143] (-783.835) (-783.691) (-777.662) * [-782.263] (-783.933) (-779.165) (-780.153) -- 0:00:31
471000 -- [-779.012] (-782.564) (-781.552) (-781.370) * (-780.141) (-780.680) (-780.240) [-784.093] -- 0:00:31
471500 -- (-780.534) [-779.979] (-782.367) (-778.077) * [-779.104] (-779.257) (-781.354) (-783.450) -- 0:00:31
472000 -- (-779.036) (-781.580) (-779.883) [-780.753] * (-778.501) (-779.358) (-781.901) [-779.129] -- 0:00:31
472500 -- (-784.325) (-783.571) (-779.194) [-780.031] * (-779.766) [-778.764] (-784.465) (-779.908) -- 0:00:31
473000 -- (-781.549) [-783.067] (-784.934) (-780.135) * (-783.692) [-784.552] (-778.901) (-781.202) -- 0:00:31
473500 -- (-778.231) [-780.209] (-781.039) (-782.759) * (-779.405) (-786.314) [-778.407] (-779.478) -- 0:00:31
474000 -- (-778.827) [-781.621] (-781.577) (-783.344) * [-778.866] (-783.012) (-778.960) (-778.495) -- 0:00:31
474500 -- (-778.834) (-780.204) [-779.683] (-779.573) * [-781.670] (-783.272) (-779.315) (-778.816) -- 0:00:31
475000 -- (-778.204) (-780.279) [-778.483] (-778.507) * (-782.734) [-780.993] (-782.447) (-779.696) -- 0:00:30
Average standard deviation of split frequencies: 0.009594
475500 -- (-778.105) [-778.428] (-783.245) (-778.621) * (-777.554) (-779.703) [-779.942] (-780.865) -- 0:00:30
476000 -- (-779.904) (-782.963) (-782.794) [-780.240] * (-778.350) (-779.109) [-778.834] (-777.547) -- 0:00:30
476500 -- [-779.241] (-781.000) (-781.063) (-780.924) * (-780.065) (-778.055) (-778.805) [-777.547] -- 0:00:30
477000 -- (-777.919) (-781.551) (-782.487) [-779.229] * [-778.174] (-777.585) (-781.903) (-780.672) -- 0:00:30
477500 -- (-781.432) (-778.684) (-779.706) [-778.553] * (-779.050) (-778.812) [-779.375] (-779.150) -- 0:00:30
478000 -- (-781.144) (-781.900) [-777.948] (-780.356) * (-780.282) (-778.504) [-779.737] (-778.533) -- 0:00:30
478500 -- (-781.411) (-778.190) (-778.651) [-779.682] * [-780.365] (-778.659) (-778.091) (-781.518) -- 0:00:30
479000 -- [-780.563] (-779.307) (-779.308) (-780.634) * (-781.285) (-779.536) [-778.171] (-778.935) -- 0:00:30
479500 -- [-779.874] (-779.767) (-780.903) (-782.135) * (-780.942) (-778.943) [-778.836] (-779.163) -- 0:00:30
480000 -- (-779.364) (-779.428) [-779.959] (-782.408) * (-780.222) (-778.163) [-781.159] (-779.940) -- 0:00:30
Average standard deviation of split frequencies: 0.009501
480500 -- (-780.628) [-779.800] (-779.491) (-780.927) * [-781.814] (-779.259) (-781.057) (-779.570) -- 0:00:30
481000 -- (-779.030) (-782.141) [-779.549] (-783.679) * (-780.310) (-780.584) (-785.132) [-780.131] -- 0:00:30
481500 -- [-779.792] (-778.698) (-779.153) (-778.054) * (-778.200) [-780.298] (-779.253) (-782.694) -- 0:00:30
482000 -- (-780.663) (-779.123) [-779.088] (-781.858) * (-778.113) (-777.874) (-780.058) [-785.058] -- 0:00:30
482500 -- (-780.907) [-778.625] (-782.587) (-781.498) * (-780.321) [-778.080] (-778.226) (-779.974) -- 0:00:30
483000 -- (-784.374) (-779.439) (-779.148) [-778.365] * [-778.733] (-780.062) (-779.461) (-778.715) -- 0:00:29
483500 -- (-781.333) (-778.715) [-778.734] (-780.603) * (-778.192) (-777.763) (-777.853) [-782.121] -- 0:00:29
484000 -- [-778.396] (-778.855) (-783.581) (-784.727) * [-780.083] (-781.785) (-779.127) (-779.299) -- 0:00:29
484500 -- (-785.141) (-780.344) [-780.363] (-784.971) * [-780.586] (-778.441) (-780.660) (-779.884) -- 0:00:29
485000 -- [-783.055] (-778.678) (-780.524) (-779.132) * (-782.138) (-781.522) (-785.501) [-782.241] -- 0:00:29
Average standard deviation of split frequencies: 0.009397
485500 -- (-780.619) (-781.547) [-778.510] (-782.271) * (-779.990) (-784.474) [-780.016] (-781.258) -- 0:00:29
486000 -- (-782.457) [-780.066] (-779.250) (-780.157) * (-782.172) [-780.689] (-780.706) (-781.646) -- 0:00:30
486500 -- (-778.319) [-778.842] (-779.923) (-780.249) * (-785.777) (-781.540) [-781.674] (-780.231) -- 0:00:30
487000 -- [-778.613] (-778.240) (-779.379) (-778.266) * (-781.982) (-781.298) (-781.130) [-777.722] -- 0:00:30
487500 -- (-780.074) (-781.900) (-779.096) [-784.021] * (-780.298) (-780.689) [-780.126] (-780.792) -- 0:00:30
488000 -- (-779.322) [-781.243] (-780.314) (-783.316) * (-779.531) (-782.424) [-778.737] (-779.572) -- 0:00:30
488500 -- [-781.719] (-782.255) (-778.849) (-779.289) * [-779.818] (-779.461) (-779.225) (-778.082) -- 0:00:30
489000 -- [-778.207] (-784.567) (-781.028) (-780.834) * [-778.739] (-780.375) (-782.267) (-778.911) -- 0:00:30
489500 -- [-778.532] (-784.402) (-780.125) (-780.291) * [-778.798] (-780.400) (-777.812) (-780.381) -- 0:00:30
490000 -- (-778.578) [-779.553] (-783.963) (-780.834) * (-782.147) (-780.287) [-781.354] (-780.404) -- 0:00:30
Average standard deviation of split frequencies: 0.008967
490500 -- (-781.653) [-780.796] (-783.933) (-779.175) * (-778.587) [-779.098] (-781.651) (-787.168) -- 0:00:30
491000 -- [-781.304] (-777.693) (-779.903) (-778.645) * (-782.234) [-778.692] (-782.494) (-780.463) -- 0:00:30
491500 -- (-780.415) [-779.047] (-779.969) (-778.757) * [-778.690] (-780.550) (-779.834) (-781.411) -- 0:00:30
492000 -- (-780.356) (-780.331) (-786.917) [-780.331] * (-780.538) (-778.635) [-781.098] (-784.412) -- 0:00:29
492500 -- (-778.837) (-778.209) [-782.373] (-781.303) * (-778.693) (-778.626) [-779.867] (-786.689) -- 0:00:29
493000 -- [-778.965] (-778.275) (-783.690) (-779.839) * (-782.257) (-781.446) (-778.078) [-781.856] -- 0:00:29
493500 -- (-779.349) (-779.927) [-779.382] (-781.194) * (-778.901) (-779.874) (-778.840) [-778.228] -- 0:00:29
494000 -- (-779.313) (-781.460) [-780.004] (-780.517) * [-782.627] (-780.600) (-778.838) (-779.355) -- 0:00:29
494500 -- (-779.212) (-780.410) (-779.854) [-781.699] * [-780.861] (-780.959) (-781.946) (-783.353) -- 0:00:29
495000 -- (-780.351) (-786.432) (-779.323) [-780.277] * (-781.864) (-780.681) [-778.875] (-782.384) -- 0:00:29
Average standard deviation of split frequencies: 0.008427
495500 -- (-777.994) [-781.892] (-780.747) (-781.158) * (-781.326) (-777.582) (-780.346) [-778.760] -- 0:00:29
496000 -- [-779.110] (-782.902) (-779.567) (-781.982) * (-783.899) [-779.861] (-777.924) (-778.852) -- 0:00:29
496500 -- (-778.970) (-780.975) [-779.528] (-782.974) * [-779.663] (-779.341) (-777.997) (-778.823) -- 0:00:29
497000 -- (-780.560) (-779.464) (-778.912) [-778.036] * [-778.410] (-778.935) (-780.551) (-779.068) -- 0:00:29
497500 -- [-778.990] (-783.507) (-778.386) (-780.127) * (-779.838) [-778.893] (-778.673) (-779.068) -- 0:00:29
498000 -- (-781.529) (-780.490) [-778.524] (-779.646) * (-778.748) (-778.866) [-779.060] (-779.214) -- 0:00:29
498500 -- [-778.256] (-780.590) (-779.880) (-779.898) * (-785.300) [-780.580] (-780.772) (-779.672) -- 0:00:29
499000 -- (-780.227) [-778.655] (-778.295) (-778.322) * (-777.964) (-778.414) [-778.337] (-778.722) -- 0:00:29
499500 -- (-780.752) [-777.994] (-783.094) (-778.185) * (-778.347) [-778.660] (-779.288) (-780.110) -- 0:00:29
500000 -- (-779.759) [-780.232] (-781.390) (-778.599) * (-780.956) [-778.496] (-780.044) (-779.746) -- 0:00:29
Average standard deviation of split frequencies: 0.008537
500500 -- (-779.087) (-784.479) [-782.913] (-778.381) * (-779.429) (-779.120) (-780.965) [-782.233] -- 0:00:28
501000 -- (-780.479) (-785.823) [-781.517] (-783.296) * (-785.417) [-778.814] (-781.047) (-779.300) -- 0:00:28
501500 -- (-781.763) (-784.108) [-780.921] (-777.975) * (-778.859) (-782.100) (-779.262) [-777.656] -- 0:00:28
502000 -- (-782.499) (-779.155) [-778.577] (-779.343) * [-782.194] (-780.836) (-777.785) (-778.037) -- 0:00:28
502500 -- [-782.138] (-780.400) (-779.694) (-780.500) * [-783.995] (-778.210) (-778.262) (-782.031) -- 0:00:28
503000 -- (-781.050) (-779.123) [-777.944] (-782.364) * (-783.049) (-778.328) (-779.848) [-782.486] -- 0:00:29
503500 -- (-779.193) (-782.389) [-779.078] (-778.310) * (-779.745) [-778.403] (-781.453) (-777.988) -- 0:00:29
504000 -- (-778.845) [-778.539] (-778.005) (-780.719) * (-779.093) (-779.632) (-781.640) [-779.308] -- 0:00:29
504500 -- (-779.751) (-778.303) [-777.932] (-781.092) * (-781.371) (-781.973) (-779.599) [-781.524] -- 0:00:29
505000 -- (-778.692) [-779.449] (-777.459) (-778.011) * (-778.125) (-780.475) (-782.251) [-778.904] -- 0:00:29
Average standard deviation of split frequencies: 0.009316
505500 -- (-778.615) [-780.209] (-782.327) (-779.328) * [-779.619] (-780.865) (-783.523) (-778.534) -- 0:00:29
506000 -- (-780.038) (-780.703) [-778.686] (-779.395) * (-780.126) [-779.421] (-778.291) (-778.368) -- 0:00:29
506500 -- (-782.623) [-778.088] (-781.831) (-779.444) * (-780.909) [-780.153] (-779.321) (-785.196) -- 0:00:29
507000 -- [-782.954] (-777.942) (-777.964) (-778.311) * [-780.642] (-780.860) (-781.046) (-783.035) -- 0:00:29
507500 -- (-779.211) (-780.161) [-778.373] (-781.406) * [-779.633] (-782.063) (-778.338) (-779.714) -- 0:00:29
508000 -- (-780.588) (-778.287) (-789.397) [-782.371] * (-778.263) (-781.079) [-782.360] (-785.965) -- 0:00:29
508500 -- (-780.494) (-781.169) (-783.002) [-779.590] * [-781.167] (-779.380) (-778.274) (-782.350) -- 0:00:28
509000 -- (-780.277) (-781.290) [-778.178] (-777.648) * [-777.877] (-777.856) (-777.907) (-780.213) -- 0:00:28
509500 -- (-781.326) [-780.981] (-778.471) (-780.233) * (-783.089) (-779.472) [-779.338] (-779.520) -- 0:00:28
510000 -- (-779.570) [-778.704] (-780.184) (-781.575) * [-778.060] (-779.690) (-783.748) (-778.542) -- 0:00:28
Average standard deviation of split frequencies: 0.009923
510500 -- (-779.774) [-781.871] (-781.376) (-778.540) * (-781.735) (-777.784) (-780.349) [-780.356] -- 0:00:28
511000 -- (-780.416) (-779.954) (-780.955) [-780.214] * (-779.477) [-777.900] (-778.416) (-780.314) -- 0:00:28
511500 -- (-779.530) [-780.887] (-782.441) (-778.432) * (-779.440) (-778.287) [-779.322] (-783.427) -- 0:00:28
512000 -- [-780.056] (-782.010) (-780.598) (-778.376) * [-778.971] (-779.092) (-779.275) (-779.775) -- 0:00:28
512500 -- (-780.819) (-779.600) (-781.168) [-778.000] * (-778.696) (-779.769) (-781.872) [-780.109] -- 0:00:28
513000 -- (-782.272) (-779.861) [-781.526] (-787.095) * (-778.739) (-780.629) (-785.180) [-778.007] -- 0:00:28
513500 -- [-781.478] (-779.146) (-779.393) (-780.315) * (-780.394) (-779.744) (-780.630) [-779.250] -- 0:00:28
514000 -- (-779.015) (-783.246) [-778.455] (-782.230) * (-779.045) (-782.538) [-778.976] (-778.760) -- 0:00:28
514500 -- [-778.567] (-778.971) (-782.335) (-780.849) * [-781.185] (-779.897) (-778.661) (-779.554) -- 0:00:28
515000 -- [-777.794] (-778.600) (-779.201) (-779.119) * (-780.625) [-780.341] (-780.895) (-779.361) -- 0:00:28
Average standard deviation of split frequencies: 0.010506
515500 -- (-781.717) [-779.433] (-777.953) (-780.401) * (-782.507) (-778.201) (-780.428) [-779.638] -- 0:00:28
516000 -- (-783.821) (-778.661) (-782.545) [-779.138] * (-780.241) (-778.394) [-781.126] (-778.709) -- 0:00:28
516500 -- [-777.853] (-780.811) (-781.775) (-783.756) * (-779.833) [-782.002] (-780.669) (-783.712) -- 0:00:28
517000 -- (-777.975) (-779.455) (-780.463) [-783.235] * (-779.517) (-778.880) (-779.079) [-778.005] -- 0:00:28
517500 -- (-780.231) (-778.191) [-778.309] (-778.194) * (-780.568) [-781.567] (-780.335) (-781.490) -- 0:00:27
518000 -- [-779.788] (-784.157) (-778.643) (-782.168) * [-778.555] (-780.043) (-780.886) (-779.292) -- 0:00:27
518500 -- [-781.362] (-781.060) (-779.153) (-784.570) * (-779.906) (-781.814) (-783.911) [-777.746] -- 0:00:27
519000 -- (-781.548) [-781.350] (-778.951) (-780.943) * (-779.623) (-779.191) (-784.359) [-777.639] -- 0:00:27
519500 -- (-779.097) (-779.573) [-779.784] (-779.797) * (-777.597) [-778.251] (-788.933) (-781.580) -- 0:00:28
520000 -- (-778.173) (-780.378) (-779.718) [-778.152] * (-778.674) (-782.450) (-779.241) [-778.842] -- 0:00:28
Average standard deviation of split frequencies: 0.010382
520500 -- [-778.445] (-780.891) (-778.162) (-781.790) * (-778.551) [-779.010] (-783.512) (-777.700) -- 0:00:28
521000 -- (-778.101) (-780.963) [-780.843] (-780.432) * (-779.570) [-780.246] (-778.404) (-779.707) -- 0:00:28
521500 -- (-781.291) (-781.614) (-781.741) [-778.419] * (-781.254) [-783.825] (-780.391) (-780.619) -- 0:00:28
522000 -- (-777.753) [-781.715] (-781.024) (-778.524) * [-778.547] (-779.214) (-780.413) (-782.359) -- 0:00:28
522500 -- (-780.237) [-778.772] (-780.026) (-783.050) * (-786.322) (-780.276) [-779.892] (-778.298) -- 0:00:28
523000 -- (-782.664) (-780.939) [-781.869] (-778.872) * (-781.850) [-778.878] (-780.813) (-780.818) -- 0:00:28
523500 -- (-785.855) (-778.785) (-781.371) [-779.211] * [-778.662] (-779.293) (-781.159) (-779.704) -- 0:00:28
524000 -- [-788.357] (-779.926) (-778.149) (-779.219) * (-779.015) [-782.186] (-780.130) (-781.653) -- 0:00:28
524500 -- (-780.077) [-780.112] (-779.798) (-780.047) * (-779.125) (-779.174) [-782.526] (-778.225) -- 0:00:28
525000 -- (-778.729) (-781.667) (-777.935) [-778.282] * (-778.000) [-779.794] (-782.232) (-778.282) -- 0:00:28
Average standard deviation of split frequencies: 0.010923
525500 -- (-778.013) (-777.772) [-777.899] (-780.609) * (-781.162) (-780.015) [-779.920] (-778.153) -- 0:00:27
526000 -- [-779.626] (-777.991) (-780.372) (-778.985) * [-778.593] (-779.367) (-780.521) (-781.886) -- 0:00:27
526500 -- (-780.259) (-782.057) [-779.259] (-778.558) * (-778.548) (-780.097) [-780.795] (-787.655) -- 0:00:27
527000 -- (-779.972) (-781.609) (-781.720) [-778.597] * [-779.499] (-780.205) (-779.884) (-782.165) -- 0:00:27
527500 -- (-779.662) (-779.207) [-779.586] (-782.067) * (-778.522) (-780.888) [-778.286] (-781.351) -- 0:00:27
528000 -- (-778.055) (-780.006) (-782.389) [-778.882] * (-778.692) [-781.146] (-781.048) (-780.703) -- 0:00:27
528500 -- (-782.029) (-783.947) (-785.798) [-778.620] * (-778.925) (-778.601) [-781.018] (-779.199) -- 0:00:27
529000 -- (-786.634) (-779.056) [-779.977] (-783.251) * (-780.335) (-777.951) (-784.027) [-779.046] -- 0:00:27
529500 -- (-780.075) (-780.587) (-780.351) [-777.994] * (-783.657) [-778.461] (-780.053) (-779.882) -- 0:00:27
530000 -- (-780.004) (-779.226) (-779.436) [-778.309] * [-780.569] (-779.227) (-777.984) (-779.908) -- 0:00:27
Average standard deviation of split frequencies: 0.010216
530500 -- (-779.681) (-786.784) [-779.214] (-778.908) * (-781.679) [-780.979] (-779.776) (-779.323) -- 0:00:27
531000 -- (-779.278) [-780.668] (-779.345) (-781.117) * (-778.861) (-778.738) (-781.047) [-782.276] -- 0:00:27
531500 -- (-778.856) (-782.313) (-778.412) [-779.708] * (-777.494) (-781.203) [-778.769] (-780.293) -- 0:00:27
532000 -- (-783.614) [-778.628] (-778.808) (-779.580) * (-777.640) (-780.932) [-780.928] (-780.317) -- 0:00:27
532500 -- [-781.431] (-778.837) (-783.371) (-778.608) * (-779.962) (-780.559) [-780.706] (-779.794) -- 0:00:27
533000 -- (-782.889) (-778.879) [-780.740] (-779.689) * (-778.768) (-782.050) [-779.817] (-781.052) -- 0:00:27
533500 -- (-781.066) [-780.693] (-779.116) (-777.881) * (-777.686) [-780.996] (-778.416) (-780.770) -- 0:00:27
534000 -- [-782.340] (-781.166) (-780.350) (-779.713) * (-777.686) [-780.439] (-779.019) (-779.260) -- 0:00:27
534500 -- (-779.871) (-781.801) [-780.100] (-781.764) * (-779.061) [-781.006] (-779.839) (-780.035) -- 0:00:26
535000 -- (-781.737) (-781.889) (-779.403) [-778.058] * (-780.478) [-784.048] (-781.628) (-786.069) -- 0:00:26
Average standard deviation of split frequencies: 0.010169
535500 -- (-778.972) (-778.581) [-779.308] (-780.215) * [-781.205] (-778.725) (-779.418) (-778.431) -- 0:00:26
536000 -- (-780.626) [-778.064] (-784.952) (-778.736) * (-779.406) [-778.428] (-781.062) (-781.352) -- 0:00:26
536500 -- (-777.815) (-781.149) (-780.722) [-777.894] * (-780.869) [-778.810] (-781.623) (-779.718) -- 0:00:27
537000 -- (-779.135) (-778.107) [-779.724] (-780.549) * (-779.054) (-778.651) (-783.397) [-780.088] -- 0:00:27
537500 -- (-779.671) (-778.541) [-777.555] (-784.960) * (-782.524) (-779.639) (-779.846) [-779.759] -- 0:00:27
538000 -- (-781.640) (-781.009) [-777.526] (-779.698) * (-780.430) (-782.705) (-779.277) [-780.647] -- 0:00:27
538500 -- (-778.477) [-781.348] (-780.476) (-780.677) * (-784.833) (-778.193) (-777.872) [-778.661] -- 0:00:27
539000 -- (-778.630) (-780.492) [-781.381] (-784.122) * (-783.749) (-783.499) (-783.073) [-779.674] -- 0:00:27
539500 -- (-780.713) (-779.446) [-778.663] (-784.751) * (-780.712) [-780.948] (-778.758) (-782.425) -- 0:00:27
540000 -- (-779.840) (-779.194) [-783.165] (-784.440) * (-780.112) (-778.951) [-780.135] (-779.776) -- 0:00:27
Average standard deviation of split frequencies: 0.009591
540500 -- (-781.375) (-778.133) [-779.388] (-781.595) * (-780.216) (-778.941) (-779.518) [-781.716] -- 0:00:27
541000 -- (-779.134) [-779.234] (-780.250) (-778.753) * [-778.075] (-780.467) (-779.348) (-781.249) -- 0:00:27
541500 -- (-779.569) (-780.006) (-783.737) [-779.083] * (-778.078) (-777.522) [-779.125] (-782.012) -- 0:00:27
542000 -- (-779.561) [-780.201] (-778.516) (-783.644) * (-780.530) (-778.017) [-778.834] (-781.950) -- 0:00:27
542500 -- (-779.733) [-778.842] (-778.318) (-783.630) * (-778.868) (-778.024) (-780.785) [-779.006] -- 0:00:26
543000 -- (-783.666) [-781.373] (-778.998) (-780.331) * [-779.164] (-778.711) (-779.239) (-778.765) -- 0:00:26
543500 -- (-777.764) [-779.970] (-777.598) (-778.886) * [-778.437] (-785.257) (-782.941) (-785.309) -- 0:00:26
544000 -- (-778.815) [-779.152] (-780.061) (-782.551) * (-778.840) (-778.761) (-784.561) [-779.768] -- 0:00:26
544500 -- (-779.986) (-782.561) (-780.071) [-779.534] * (-779.060) [-777.732] (-780.187) (-780.794) -- 0:00:26
545000 -- [-780.060] (-778.349) (-780.335) (-779.615) * (-778.816) (-780.548) (-779.662) [-779.604] -- 0:00:26
Average standard deviation of split frequencies: 0.009900
545500 -- (-779.772) [-778.831] (-790.410) (-779.084) * (-779.261) (-777.831) (-784.871) [-779.222] -- 0:00:26
546000 -- (-777.871) [-780.532] (-781.271) (-779.869) * (-779.890) (-782.413) [-783.704] (-784.119) -- 0:00:26
546500 -- (-783.977) [-779.986] (-779.294) (-780.133) * (-779.662) [-778.137] (-779.254) (-779.653) -- 0:00:26
547000 -- (-781.143) [-777.968] (-780.088) (-779.376) * (-779.950) (-778.198) (-779.144) [-780.896] -- 0:00:26
547500 -- (-781.497) (-778.916) [-780.826] (-779.463) * (-778.295) (-778.653) [-780.292] (-780.127) -- 0:00:26
548000 -- (-781.402) (-779.095) [-779.249] (-783.290) * (-779.702) (-781.109) [-779.167] (-778.332) -- 0:00:26
548500 -- (-778.966) (-785.886) [-778.672] (-780.046) * (-784.444) [-778.578] (-778.295) (-779.925) -- 0:00:26
549000 -- (-786.191) [-778.263] (-778.446) (-782.136) * (-778.707) (-782.743) [-777.977] (-781.719) -- 0:00:26
549500 -- (-780.417) [-778.043] (-778.107) (-785.719) * (-780.767) (-779.548) [-785.675] (-781.210) -- 0:00:26
550000 -- (-781.913) [-778.171] (-779.650) (-782.536) * (-781.848) (-780.243) (-780.249) [-779.124] -- 0:00:26
Average standard deviation of split frequencies: 0.010102
550500 -- (-782.600) [-779.633] (-779.734) (-783.602) * [-778.860] (-779.491) (-779.832) (-779.117) -- 0:00:26
551000 -- (-780.537) (-778.708) (-779.470) [-780.343] * [-778.235] (-779.271) (-778.495) (-777.868) -- 0:00:26
551500 -- (-778.317) (-781.845) (-780.985) [-781.229] * [-778.463] (-782.316) (-780.471) (-779.966) -- 0:00:26
552000 -- [-778.884] (-777.770) (-779.074) (-779.673) * (-781.189) (-782.459) (-781.521) [-777.885] -- 0:00:25
552500 -- [-778.207] (-778.626) (-778.980) (-780.221) * (-780.165) (-781.561) (-778.668) [-783.357] -- 0:00:25
553000 -- (-778.207) [-778.078] (-779.017) (-779.645) * (-780.585) (-780.155) (-781.274) [-781.621] -- 0:00:25
553500 -- (-780.563) (-779.688) (-784.043) [-780.378] * (-784.318) (-778.008) (-782.086) [-780.657] -- 0:00:26
554000 -- (-782.521) (-780.036) [-778.886] (-781.835) * [-778.417] (-777.579) (-781.059) (-781.648) -- 0:00:26
554500 -- (-785.399) [-779.823] (-779.010) (-779.590) * [-779.259] (-781.745) (-781.432) (-782.723) -- 0:00:26
555000 -- (-783.356) [-781.593] (-778.850) (-778.847) * (-778.289) (-784.302) [-780.253] (-783.014) -- 0:00:26
Average standard deviation of split frequencies: 0.009383
555500 -- (-779.156) (-781.093) [-777.910] (-778.985) * (-778.360) (-779.732) (-778.464) [-782.324] -- 0:00:26
556000 -- [-779.740] (-781.841) (-779.766) (-778.933) * (-782.079) (-782.644) (-779.470) [-780.386] -- 0:00:26
556500 -- (-779.973) (-778.491) [-783.862] (-778.809) * (-778.250) (-780.421) [-783.459] (-778.113) -- 0:00:26
557000 -- (-779.869) (-780.733) (-783.108) [-781.915] * (-779.440) (-781.252) (-782.217) [-778.188] -- 0:00:26
557500 -- (-780.598) [-780.486] (-784.055) (-782.248) * (-779.656) [-778.205] (-780.678) (-779.365) -- 0:00:26
558000 -- [-781.498] (-777.848) (-782.904) (-780.704) * [-778.742] (-777.924) (-778.814) (-779.622) -- 0:00:26
558500 -- (-784.146) [-777.861] (-781.113) (-779.427) * (-778.616) (-781.529) [-781.069] (-779.983) -- 0:00:26
559000 -- (-779.294) (-779.154) (-780.034) [-778.530] * (-781.646) (-778.269) [-780.138] (-778.121) -- 0:00:26
559500 -- [-779.596] (-779.128) (-783.447) (-783.649) * (-779.386) (-778.731) (-781.063) [-778.119] -- 0:00:25
560000 -- (-779.601) (-778.609) (-779.358) [-781.359] * (-784.334) [-779.624] (-780.314) (-778.121) -- 0:00:25
Average standard deviation of split frequencies: 0.009305
560500 -- (-781.589) (-780.058) (-783.668) [-781.729] * (-788.041) [-779.625] (-781.148) (-781.661) -- 0:00:25
561000 -- (-782.752) (-780.796) [-781.601] (-780.850) * (-780.975) (-781.745) (-778.594) [-782.649] -- 0:00:25
561500 -- (-787.104) [-781.576] (-780.255) (-780.260) * (-779.146) (-780.393) [-778.502] (-782.629) -- 0:00:25
562000 -- (-786.397) [-782.524] (-780.189) (-780.593) * (-780.496) (-779.114) (-780.281) [-780.572] -- 0:00:25
562500 -- [-778.826] (-781.139) (-785.452) (-781.715) * [-779.457] (-780.014) (-778.014) (-781.644) -- 0:00:25
563000 -- (-778.853) (-780.334) [-779.454] (-779.424) * (-778.313) [-779.853] (-779.695) (-782.662) -- 0:00:25
563500 -- (-781.099) (-782.123) [-779.941] (-781.149) * (-783.757) (-782.104) [-778.128] (-778.753) -- 0:00:25
564000 -- [-777.795] (-779.279) (-781.956) (-779.838) * [-781.131] (-778.903) (-781.107) (-777.946) -- 0:00:25
564500 -- (-778.169) (-780.236) (-779.635) [-778.474] * (-781.278) (-780.601) (-778.010) [-777.591] -- 0:00:25
565000 -- [-778.138] (-778.259) (-781.272) (-779.210) * (-784.794) [-781.589] (-779.021) (-777.720) -- 0:00:25
Average standard deviation of split frequencies: 0.008773
565500 -- (-779.465) [-778.767] (-784.736) (-779.205) * [-781.231] (-780.254) (-779.021) (-782.184) -- 0:00:25
566000 -- (-780.446) (-781.702) (-781.134) [-777.833] * (-782.476) (-779.991) (-779.051) [-780.232] -- 0:00:25
566500 -- [-780.712] (-781.369) (-782.499) (-778.470) * [-781.728] (-777.938) (-782.670) (-778.622) -- 0:00:25
567000 -- (-782.819) [-780.142] (-779.180) (-782.559) * (-779.123) (-778.197) [-780.653] (-780.699) -- 0:00:25
567500 -- (-778.432) (-783.295) (-779.811) [-781.380] * (-780.669) (-780.022) [-778.397] (-777.840) -- 0:00:25
568000 -- (-780.628) (-778.378) (-779.210) [-779.219] * (-781.371) (-779.390) (-781.427) [-778.502] -- 0:00:25
568500 -- (-783.936) (-780.006) [-777.599] (-779.886) * (-779.600) [-778.123] (-781.530) (-778.835) -- 0:00:25
569000 -- (-780.486) [-778.847] (-777.963) (-779.730) * [-779.781] (-779.158) (-779.018) (-781.088) -- 0:00:24
569500 -- (-778.727) (-780.748) (-781.501) [-779.696] * (-781.121) (-780.362) [-779.792] (-778.359) -- 0:00:24
570000 -- [-778.510] (-780.589) (-779.260) (-781.051) * (-784.008) [-779.789] (-780.438) (-778.515) -- 0:00:25
Average standard deviation of split frequencies: 0.009142
570500 -- (-781.422) (-785.554) [-780.041] (-779.206) * [-784.652] (-778.287) (-780.193) (-780.101) -- 0:00:25
571000 -- [-778.438] (-784.888) (-778.327) (-781.765) * (-780.461) (-779.395) [-777.972] (-780.480) -- 0:00:25
571500 -- (-782.284) [-788.089] (-779.001) (-782.798) * (-779.544) (-777.734) (-779.317) [-778.554] -- 0:00:25
572000 -- (-779.782) [-777.750] (-779.419) (-785.144) * [-781.644] (-780.680) (-782.947) (-779.339) -- 0:00:25
572500 -- (-779.259) [-777.555] (-779.159) (-778.215) * (-779.317) (-778.969) (-781.175) [-778.153] -- 0:00:25
573000 -- [-784.069] (-779.002) (-781.389) (-786.823) * (-779.355) (-779.122) (-781.920) [-778.198] -- 0:00:25
573500 -- (-779.360) [-780.636] (-783.294) (-788.180) * (-778.726) (-783.780) (-777.978) [-779.986] -- 0:00:25
574000 -- [-780.515] (-780.365) (-778.416) (-782.531) * [-780.140] (-779.784) (-780.878) (-778.361) -- 0:00:25
574500 -- (-777.747) (-778.756) (-782.024) [-778.662] * (-779.124) (-781.424) [-778.265] (-779.498) -- 0:00:25
575000 -- (-778.961) (-780.302) (-778.304) [-781.303] * (-779.179) (-780.624) (-778.399) [-779.215] -- 0:00:25
Average standard deviation of split frequencies: 0.009275
575500 -- (-778.933) (-779.192) (-779.948) [-778.766] * [-782.721] (-780.406) (-780.077) (-780.925) -- 0:00:25
576000 -- (-780.386) (-779.710) [-778.292] (-778.816) * (-782.796) (-780.298) (-779.007) [-779.822] -- 0:00:25
576500 -- (-778.694) (-781.368) (-781.482) [-778.682] * (-782.080) (-784.317) [-780.691] (-779.972) -- 0:00:24
577000 -- [-780.734] (-780.580) (-781.140) (-778.711) * (-779.430) (-779.540) [-783.135] (-778.098) -- 0:00:24
577500 -- (-780.634) (-781.753) (-779.455) [-778.682] * (-783.159) [-778.353] (-781.508) (-779.157) -- 0:00:24
578000 -- (-779.487) (-777.865) (-782.647) [-779.106] * (-780.876) [-778.788] (-780.884) (-787.019) -- 0:00:24
578500 -- [-778.906] (-779.362) (-778.946) (-778.348) * (-781.961) [-781.464] (-782.515) (-778.422) -- 0:00:24
579000 -- (-779.927) (-779.675) [-777.630] (-778.157) * [-782.909] (-783.020) (-781.703) (-778.616) -- 0:00:24
579500 -- (-778.484) (-779.568) (-781.361) [-782.488] * (-780.575) (-778.916) (-783.319) [-778.255] -- 0:00:24
580000 -- [-778.638] (-780.347) (-779.170) (-778.810) * (-778.348) (-780.377) (-777.633) [-784.006] -- 0:00:24
Average standard deviation of split frequencies: 0.009850
580500 -- (-779.160) (-780.481) (-779.012) [-778.698] * (-777.814) (-780.096) (-778.104) [-779.012] -- 0:00:24
581000 -- (-781.718) (-779.788) [-780.215] (-778.072) * [-777.870] (-780.365) (-778.704) (-778.693) -- 0:00:24
581500 -- (-778.324) (-783.622) [-783.853] (-779.275) * (-780.516) (-779.932) (-781.644) [-778.718] -- 0:00:24
582000 -- [-778.329] (-783.741) (-783.684) (-778.931) * (-787.660) [-778.876] (-778.423) (-779.905) -- 0:00:24
582500 -- (-779.565) (-780.688) (-781.070) [-779.287] * [-780.572] (-781.567) (-780.287) (-780.714) -- 0:00:24
583000 -- (-781.349) (-779.554) [-779.270] (-779.493) * (-784.557) (-782.614) (-779.992) [-778.312] -- 0:00:24
583500 -- (-780.251) (-781.929) [-780.945] (-781.030) * (-782.040) (-779.231) (-778.916) [-781.288] -- 0:00:24
584000 -- (-781.245) (-780.154) (-779.680) [-782.165] * (-779.932) (-778.498) [-783.012] (-779.401) -- 0:00:24
584500 -- (-781.354) [-779.043] (-779.204) (-780.797) * (-779.014) (-778.707) [-781.132] (-779.796) -- 0:00:24
585000 -- (-780.004) (-779.097) [-778.400] (-781.597) * (-780.615) [-778.113] (-782.117) (-779.783) -- 0:00:24
Average standard deviation of split frequencies: 0.010082
585500 -- (-779.728) (-779.076) (-780.328) [-781.008] * [-781.513] (-779.691) (-778.765) (-781.422) -- 0:00:24
586000 -- [-783.504] (-782.490) (-778.893) (-780.392) * (-782.320) (-780.845) [-780.224] (-779.388) -- 0:00:24
586500 -- (-783.961) (-780.937) (-780.121) [-781.904] * (-781.675) [-778.243] (-779.531) (-778.436) -- 0:00:23
587000 -- (-781.679) [-777.528] (-780.519) (-784.425) * (-779.750) (-779.322) [-785.289] (-780.185) -- 0:00:24
587500 -- (-779.807) [-777.526] (-777.824) (-780.036) * (-778.015) [-778.249] (-781.915) (-779.284) -- 0:00:24
588000 -- (-781.528) (-781.225) [-781.103] (-780.121) * [-778.184] (-783.764) (-780.013) (-780.762) -- 0:00:24
588500 -- [-781.209] (-782.988) (-780.480) (-778.539) * (-779.784) [-780.299] (-781.575) (-780.367) -- 0:00:24
589000 -- (-782.293) (-779.631) (-784.220) [-778.849] * [-779.587] (-784.340) (-779.996) (-779.450) -- 0:00:24
589500 -- (-779.477) (-778.317) [-777.665] (-781.189) * [-778.234] (-782.279) (-777.812) (-780.944) -- 0:00:24
590000 -- (-782.140) [-780.606] (-778.846) (-778.278) * (-787.389) (-779.426) [-778.881] (-781.193) -- 0:00:24
Average standard deviation of split frequencies: 0.009630
590500 -- (-782.089) (-779.392) [-778.888] (-780.829) * [-779.650] (-780.178) (-784.655) (-779.397) -- 0:00:24
591000 -- [-778.285] (-781.867) (-780.983) (-781.037) * (-779.234) (-780.590) (-779.291) [-778.548] -- 0:00:24
591500 -- [-780.572] (-780.868) (-779.014) (-779.951) * (-780.337) [-780.992] (-777.847) (-778.217) -- 0:00:24
592000 -- (-782.541) (-779.961) [-778.590] (-781.254) * (-778.982) (-780.991) [-780.683] (-782.274) -- 0:00:24
592500 -- (-777.866) (-778.930) [-778.914] (-779.018) * (-780.260) (-779.848) (-780.021) [-779.064] -- 0:00:24
593000 -- (-779.751) [-779.707] (-779.192) (-780.386) * (-779.014) (-779.172) (-778.410) [-780.257] -- 0:00:24
593500 -- (-780.094) (-780.634) [-780.055] (-782.110) * (-782.274) (-778.168) [-778.833] (-778.265) -- 0:00:23
594000 -- [-777.971] (-778.445) (-781.126) (-781.039) * (-784.653) (-780.993) [-779.844] (-783.528) -- 0:00:23
594500 -- (-778.637) [-782.070] (-779.142) (-778.552) * [-780.855] (-781.070) (-784.323) (-782.147) -- 0:00:23
595000 -- (-778.484) (-779.882) (-778.617) [-778.336] * (-781.812) (-778.788) [-778.292] (-782.436) -- 0:00:23
Average standard deviation of split frequencies: 0.009175
595500 -- (-779.595) [-782.419] (-780.500) (-778.010) * (-779.186) [-780.050] (-778.840) (-782.182) -- 0:00:23
596000 -- (-778.578) (-779.451) [-778.722] (-780.357) * (-778.021) (-779.668) [-780.803] (-779.428) -- 0:00:23
596500 -- (-778.902) (-778.673) (-778.682) [-779.526] * (-779.071) (-780.333) [-780.190] (-785.006) -- 0:00:23
597000 -- (-778.397) [-782.114] (-779.035) (-780.582) * [-781.354] (-780.252) (-788.522) (-779.294) -- 0:00:23
597500 -- (-778.562) (-778.977) (-781.296) [-779.920] * (-780.233) (-780.701) [-778.827] (-778.948) -- 0:00:23
598000 -- (-778.636) (-780.677) (-779.342) [-778.179] * (-784.752) (-779.320) (-779.826) [-780.003] -- 0:00:23
598500 -- [-778.583] (-779.123) (-781.390) (-780.615) * (-779.523) (-778.349) (-779.052) [-779.443] -- 0:00:23
599000 -- (-781.588) (-780.983) [-781.712] (-783.215) * (-779.811) (-778.370) [-780.259] (-780.795) -- 0:00:23
599500 -- [-777.944] (-781.741) (-779.990) (-781.289) * (-780.099) [-780.453] (-782.002) (-783.826) -- 0:00:23
600000 -- [-778.874] (-779.253) (-778.403) (-778.441) * (-783.318) (-777.817) [-778.516] (-779.266) -- 0:00:23
Average standard deviation of split frequencies: 0.009627
600500 -- (-778.455) (-779.677) (-782.066) [-777.924] * (-780.262) [-778.905] (-781.561) (-780.870) -- 0:00:23
601000 -- (-780.033) (-778.747) [-779.324] (-779.460) * (-779.812) (-778.872) [-778.599] (-781.033) -- 0:00:23
601500 -- [-778.528] (-780.565) (-780.069) (-778.292) * (-778.340) [-780.026] (-777.503) (-779.206) -- 0:00:23
602000 -- (-778.640) (-779.302) [-779.604] (-780.601) * [-778.671] (-778.080) (-778.177) (-782.255) -- 0:00:23
602500 -- [-778.617] (-778.500) (-781.424) (-778.903) * [-778.428] (-778.198) (-782.668) (-777.937) -- 0:00:23
603000 -- (-777.703) (-780.839) [-778.127] (-781.396) * (-778.638) [-779.280] (-780.191) (-778.710) -- 0:00:23
603500 -- [-779.205] (-782.208) (-781.179) (-778.438) * (-779.115) (-782.977) [-781.831] (-778.488) -- 0:00:23
604000 -- [-786.329] (-778.977) (-778.923) (-779.763) * [-779.365] (-782.263) (-778.418) (-779.091) -- 0:00:23
604500 -- (-782.008) (-780.629) (-779.402) [-779.705] * (-778.209) (-780.877) [-778.259] (-778.615) -- 0:00:23
605000 -- (-779.807) [-779.750] (-782.496) (-779.284) * (-778.347) (-780.484) (-781.336) [-778.214] -- 0:00:23
Average standard deviation of split frequencies: 0.009957
605500 -- (-781.282) (-783.189) [-779.894] (-782.201) * (-787.221) (-782.659) (-780.505) [-778.360] -- 0:00:23
606000 -- (-777.957) [-780.141] (-783.267) (-779.425) * (-783.149) (-778.123) (-782.072) [-779.947] -- 0:00:23
606500 -- [-780.492] (-783.732) (-778.575) (-781.236) * [-779.965] (-779.007) (-783.739) (-779.776) -- 0:00:23
607000 -- [-779.690] (-779.679) (-778.199) (-778.973) * (-779.472) [-780.142] (-779.730) (-779.644) -- 0:00:23
607500 -- [-784.031] (-785.349) (-780.325) (-779.989) * (-778.271) [-779.459] (-779.963) (-780.332) -- 0:00:23
608000 -- (-781.827) [-784.720] (-779.451) (-780.451) * (-777.628) (-781.573) [-778.852] (-779.972) -- 0:00:23
608500 -- (-781.037) (-778.106) (-778.892) [-778.648] * (-777.608) (-779.254) (-778.105) [-783.175] -- 0:00:23
609000 -- (-785.220) (-779.189) [-778.201] (-779.108) * (-779.237) (-779.598) (-781.385) [-782.437] -- 0:00:23
609500 -- (-781.609) (-779.789) [-781.796] (-779.934) * (-778.712) [-781.632] (-778.737) (-779.472) -- 0:00:23
610000 -- [-777.808] (-783.187) (-785.899) (-784.652) * (-780.884) [-778.475] (-778.777) (-779.004) -- 0:00:23
Average standard deviation of split frequencies: 0.010489
610500 -- (-777.790) (-780.504) [-782.014] (-779.560) * (-782.154) (-786.622) (-780.246) [-777.549] -- 0:00:22
611000 -- (-779.337) [-777.835] (-781.522) (-783.829) * (-779.734) [-779.735] (-777.866) (-780.419) -- 0:00:22
611500 -- (-779.981) (-779.357) [-779.489] (-778.731) * (-780.805) [-778.117] (-782.675) (-778.743) -- 0:00:22
612000 -- [-779.989] (-781.375) (-780.928) (-779.215) * (-778.976) [-778.403] (-783.430) (-782.187) -- 0:00:22
612500 -- (-779.655) (-779.717) [-780.406] (-779.540) * (-781.613) [-779.139] (-781.344) (-780.407) -- 0:00:22
613000 -- (-781.213) (-780.393) [-777.924] (-779.521) * (-780.877) [-778.363] (-782.548) (-780.694) -- 0:00:22
613500 -- [-780.372] (-778.647) (-779.287) (-780.212) * (-779.999) [-778.970] (-779.026) (-781.981) -- 0:00:22
614000 -- (-785.513) [-778.655] (-781.869) (-779.014) * (-781.485) (-781.098) (-778.657) [-778.720] -- 0:00:22
614500 -- [-781.160] (-779.515) (-781.569) (-777.815) * (-780.746) [-781.512] (-778.347) (-781.829) -- 0:00:22
615000 -- [-782.748] (-779.145) (-779.339) (-778.603) * (-780.531) (-780.558) [-778.925] (-784.425) -- 0:00:22
Average standard deviation of split frequencies: 0.010612
615500 -- (-782.555) [-779.822] (-785.700) (-785.789) * (-783.596) (-779.654) [-778.180] (-782.992) -- 0:00:22
616000 -- (-778.923) [-778.090] (-779.864) (-777.926) * (-779.345) (-778.216) [-778.324] (-777.896) -- 0:00:22
616500 -- (-778.859) [-780.413] (-782.200) (-778.148) * (-779.072) [-780.467] (-789.836) (-779.024) -- 0:00:22
617000 -- (-778.015) [-778.061] (-779.097) (-779.379) * (-778.541) [-779.572] (-779.720) (-782.182) -- 0:00:22
617500 -- [-778.029] (-778.101) (-778.920) (-778.240) * (-783.745) (-780.632) [-779.464] (-781.001) -- 0:00:22
618000 -- (-778.029) (-781.031) (-778.789) [-777.805] * [-783.911] (-779.235) (-778.843) (-778.597) -- 0:00:22
618500 -- (-782.730) (-779.773) (-778.274) [-777.805] * (-782.518) (-780.131) [-782.813] (-779.885) -- 0:00:22
619000 -- (-779.514) [-778.325] (-778.674) (-780.161) * [-778.521] (-778.487) (-781.176) (-781.606) -- 0:00:22
619500 -- [-779.151] (-779.237) (-780.848) (-782.285) * [-779.173] (-779.572) (-785.151) (-780.588) -- 0:00:22
620000 -- (-780.189) [-781.072] (-779.530) (-777.824) * (-779.380) (-789.603) (-780.833) [-779.438] -- 0:00:22
Average standard deviation of split frequencies: 0.009589
620500 -- (-780.705) (-780.864) (-780.782) [-782.680] * (-781.939) [-781.557] (-781.050) (-779.513) -- 0:00:22
621000 -- [-783.662] (-779.055) (-781.889) (-779.521) * (-778.147) (-779.864) (-779.761) [-779.598] -- 0:00:22
621500 -- (-780.041) (-780.067) (-779.738) [-780.350] * [-779.978] (-780.009) (-779.187) (-785.489) -- 0:00:22
622000 -- (-779.642) [-783.480] (-778.189) (-782.064) * (-779.840) (-780.931) [-779.086] (-779.416) -- 0:00:22
622500 -- (-781.615) (-778.961) [-780.013] (-784.484) * (-779.312) [-781.345] (-779.611) (-781.071) -- 0:00:22
623000 -- (-780.899) (-782.590) (-783.200) [-784.505] * [-778.661] (-778.931) (-778.901) (-781.675) -- 0:00:22
623500 -- (-778.805) (-789.491) [-781.210] (-784.323) * (-777.827) [-781.184] (-779.919) (-781.066) -- 0:00:22
624000 -- (-779.827) [-781.865] (-781.740) (-778.533) * [-779.241] (-779.163) (-781.145) (-780.608) -- 0:00:22
624500 -- (-779.357) [-781.034] (-781.999) (-781.628) * (-785.558) (-778.382) [-779.428] (-779.246) -- 0:00:22
625000 -- (-778.082) [-780.283] (-780.632) (-778.737) * (-778.258) (-778.414) (-780.455) [-779.225] -- 0:00:22
Average standard deviation of split frequencies: 0.010593
625500 -- (-780.654) [-778.371] (-779.989) (-780.314) * (-778.578) (-778.708) [-782.425] (-779.650) -- 0:00:22
626000 -- (-781.706) (-782.606) [-778.651] (-780.776) * (-783.091) (-778.617) [-781.098] (-778.921) -- 0:00:22
626500 -- (-779.687) [-779.589] (-782.979) (-781.717) * [-781.093] (-780.989) (-778.111) (-780.246) -- 0:00:22
627000 -- (-781.375) (-781.702) (-779.707) [-778.192] * (-778.295) (-780.070) [-778.179] (-778.299) -- 0:00:22
627500 -- [-779.112] (-779.716) (-781.225) (-778.219) * (-779.668) [-779.887] (-782.735) (-778.785) -- 0:00:21
628000 -- (-780.251) (-780.269) (-779.154) [-780.290] * [-781.002] (-778.969) (-781.190) (-777.984) -- 0:00:21
628500 -- [-779.668] (-781.034) (-779.326) (-778.972) * (-779.553) (-780.282) (-779.985) [-778.861] -- 0:00:21
629000 -- (-781.419) (-781.849) [-777.869] (-778.323) * (-779.070) [-781.529] (-787.203) (-780.350) -- 0:00:21
629500 -- (-780.710) (-780.172) (-782.047) [-777.841] * [-779.965] (-783.872) (-780.771) (-780.818) -- 0:00:21
630000 -- (-782.590) [-781.112] (-780.667) (-783.609) * [-780.007] (-781.218) (-781.018) (-780.510) -- 0:00:21
Average standard deviation of split frequencies: 0.010564
630500 -- [-780.466] (-779.533) (-781.652) (-779.269) * (-779.889) (-779.219) (-778.341) [-783.534] -- 0:00:21
631000 -- [-777.721] (-779.836) (-783.292) (-778.177) * (-778.826) (-779.475) [-778.036] (-781.714) -- 0:00:21
631500 -- (-782.742) (-778.452) [-778.210] (-782.483) * (-778.410) [-782.557] (-778.775) (-779.888) -- 0:00:21
632000 -- [-779.853] (-780.279) (-784.435) (-782.117) * (-778.319) [-779.467] (-778.554) (-779.427) -- 0:00:21
632500 -- (-781.250) (-780.129) [-778.139] (-779.765) * (-784.518) [-778.680] (-780.345) (-779.545) -- 0:00:21
633000 -- (-780.137) (-780.212) [-778.362] (-780.536) * (-780.818) (-780.822) [-780.001] (-778.846) -- 0:00:21
633500 -- (-778.601) (-781.775) [-780.516] (-779.655) * (-780.459) (-779.621) (-780.274) [-778.022] -- 0:00:21
634000 -- (-779.774) (-782.289) [-778.933] (-779.979) * (-779.312) [-779.591] (-779.930) (-784.825) -- 0:00:21
634500 -- (-781.547) (-779.977) (-780.314) [-779.860] * (-788.357) (-780.898) [-779.331] (-779.746) -- 0:00:21
635000 -- (-781.787) [-780.190] (-782.753) (-780.887) * (-781.343) (-781.321) [-778.691] (-782.987) -- 0:00:21
Average standard deviation of split frequencies: 0.010327
635500 -- (-782.171) [-785.894] (-780.412) (-779.342) * (-781.775) (-782.334) (-778.261) [-780.951] -- 0:00:21
636000 -- (-782.816) (-784.493) [-780.682] (-779.824) * (-783.111) (-780.873) (-780.859) [-781.273] -- 0:00:21
636500 -- (-780.979) [-778.861] (-780.458) (-784.836) * (-780.099) (-785.112) (-779.698) [-779.774] -- 0:00:21
637000 -- [-779.581] (-778.973) (-779.222) (-779.946) * (-779.497) [-779.316] (-782.339) (-777.941) -- 0:00:21
637500 -- (-778.510) (-779.524) (-779.236) [-782.119] * (-787.929) [-779.689] (-783.332) (-780.429) -- 0:00:21
638000 -- (-778.770) (-780.759) (-781.317) [-778.557] * (-779.570) (-781.938) (-779.152) [-779.038] -- 0:00:21
638500 -- (-778.521) [-778.783] (-779.354) (-779.944) * (-781.548) (-779.615) [-779.879] (-779.055) -- 0:00:21
639000 -- (-779.450) (-779.332) (-781.923) [-779.463] * (-782.937) (-778.652) (-779.607) [-778.878] -- 0:00:21
639500 -- (-782.277) (-779.366) [-781.655] (-779.497) * (-780.418) (-779.426) [-778.996] (-782.848) -- 0:00:21
640000 -- [-780.746] (-781.922) (-778.172) (-780.858) * (-779.790) [-778.618] (-779.006) (-779.559) -- 0:00:21
Average standard deviation of split frequencies: 0.010154
640500 -- [-779.821] (-780.073) (-778.228) (-781.492) * (-781.069) (-778.096) (-778.699) [-780.402] -- 0:00:21
641000 -- (-778.429) (-780.925) [-780.316] (-783.938) * (-778.888) (-779.212) [-780.546] (-781.387) -- 0:00:21
641500 -- (-778.429) (-780.270) (-779.146) [-778.888] * (-779.343) (-780.078) [-779.765] (-780.657) -- 0:00:21
642000 -- (-778.821) (-778.616) (-779.015) [-779.186] * [-785.141] (-779.185) (-780.158) (-778.892) -- 0:00:21
642500 -- (-780.532) [-782.671] (-779.431) (-780.261) * (-781.844) (-777.530) [-778.896] (-781.949) -- 0:00:21
643000 -- (-780.627) (-781.959) (-779.151) [-778.837] * (-785.452) (-778.367) [-779.896] (-783.176) -- 0:00:21
643500 -- (-780.706) (-779.509) (-780.250) [-779.767] * [-779.365] (-780.127) (-779.746) (-780.330) -- 0:00:21
644000 -- (-781.272) (-782.360) (-779.341) [-778.237] * [-780.912] (-778.920) (-778.488) (-778.834) -- 0:00:21
644500 -- [-780.628] (-781.650) (-779.078) (-783.673) * (-778.914) (-778.590) (-777.826) [-778.915] -- 0:00:20
645000 -- (-783.706) (-780.030) [-779.009] (-781.361) * (-779.884) (-780.022) (-781.119) [-780.434] -- 0:00:20
Average standard deviation of split frequencies: 0.009535
645500 -- [-780.121] (-778.142) (-779.922) (-779.852) * [-783.205] (-779.025) (-781.967) (-778.199) -- 0:00:20
646000 -- (-778.914) [-778.930] (-778.456) (-782.215) * (-782.362) (-781.558) [-783.233] (-780.430) -- 0:00:20
646500 -- (-781.046) (-780.627) (-778.220) [-778.385] * [-780.820] (-780.630) (-780.251) (-780.689) -- 0:00:20
647000 -- (-778.197) [-780.925] (-780.651) (-779.171) * (-778.573) (-780.765) [-779.031] (-785.595) -- 0:00:20
647500 -- [-778.905] (-777.625) (-780.528) (-780.006) * (-780.524) [-778.412] (-780.515) (-781.283) -- 0:00:20
648000 -- (-778.487) (-780.429) (-783.514) [-778.723] * (-778.458) (-781.475) (-781.654) [-778.425] -- 0:00:20
648500 -- (-779.167) [-777.765] (-778.093) (-781.716) * [-781.171] (-779.897) (-781.077) (-778.421) -- 0:00:20
649000 -- (-782.448) [-778.806] (-779.489) (-779.208) * (-778.288) (-780.110) [-778.716] (-780.005) -- 0:00:20
649500 -- [-778.473] (-780.524) (-778.713) (-778.543) * [-777.571] (-779.467) (-779.432) (-780.185) -- 0:00:20
650000 -- (-780.049) (-779.450) (-780.451) [-778.160] * (-783.281) [-778.290] (-779.574) (-778.756) -- 0:00:20
Average standard deviation of split frequencies: 0.009418
650500 -- [-780.055] (-779.415) (-783.616) (-778.223) * (-779.136) [-777.718] (-780.850) (-778.536) -- 0:00:20
651000 -- (-780.582) [-778.251] (-782.863) (-781.044) * (-779.499) [-777.916] (-782.835) (-780.115) -- 0:00:20
651500 -- (-779.225) [-780.059] (-779.850) (-780.223) * [-780.006] (-777.740) (-779.440) (-783.006) -- 0:00:20
652000 -- [-780.377] (-779.659) (-779.849) (-782.317) * (-783.608) [-779.517] (-785.143) (-781.767) -- 0:00:20
652500 -- (-780.026) (-778.286) (-781.165) [-779.539] * (-779.346) [-779.097] (-779.419) (-781.455) -- 0:00:20
653000 -- (-779.615) [-777.733] (-779.277) (-780.379) * (-779.505) (-779.645) [-781.772] (-778.767) -- 0:00:20
653500 -- (-777.951) (-782.554) [-778.924] (-778.240) * (-779.830) (-780.395) [-778.937] (-779.944) -- 0:00:20
654000 -- (-779.266) (-778.664) [-781.115] (-781.563) * (-780.466) (-781.049) (-778.533) [-780.602] -- 0:00:20
654500 -- [-778.623] (-780.538) (-778.552) (-778.313) * [-782.212] (-779.755) (-779.307) (-779.685) -- 0:00:20
655000 -- (-782.092) (-778.861) [-779.392] (-778.640) * (-780.585) (-782.697) [-778.203] (-779.041) -- 0:00:20
Average standard deviation of split frequencies: 0.009917
655500 -- (-778.264) [-779.397] (-779.098) (-778.928) * (-786.057) (-782.612) [-781.191] (-780.160) -- 0:00:20
656000 -- (-779.453) (-779.973) (-778.891) [-779.621] * (-780.722) (-782.041) [-778.527] (-783.324) -- 0:00:20
656500 -- (-781.518) (-780.283) (-780.016) [-778.788] * (-780.756) (-778.806) [-786.985] (-781.150) -- 0:00:20
657000 -- (-782.294) (-778.177) (-778.601) [-778.569] * (-779.716) (-779.301) [-780.191] (-781.794) -- 0:00:20
657500 -- (-780.207) (-780.034) [-780.126] (-782.316) * (-779.748) (-778.637) (-779.014) [-779.699] -- 0:00:20
658000 -- (-779.456) [-780.888] (-778.995) (-782.423) * (-779.125) (-780.538) (-778.854) [-779.558] -- 0:00:20
658500 -- (-778.664) (-785.079) (-780.066) [-782.943] * (-779.138) [-779.759] (-778.518) (-779.698) -- 0:00:20
659000 -- (-779.599) (-778.882) [-780.778] (-781.421) * (-779.248) [-779.653] (-780.419) (-779.465) -- 0:00:20
659500 -- (-779.709) (-781.131) (-780.375) [-779.157] * [-779.292] (-778.889) (-777.653) (-778.768) -- 0:00:20
660000 -- (-778.862) (-780.630) (-779.987) [-779.700] * (-779.762) (-782.770) [-778.082] (-781.012) -- 0:00:20
Average standard deviation of split frequencies: 0.009609
660500 -- (-779.020) (-784.048) [-779.410] (-781.692) * (-783.215) (-779.671) [-777.789] (-778.658) -- 0:00:20
661000 -- (-779.010) (-780.707) [-780.189] (-780.988) * (-783.499) (-781.733) (-777.854) [-778.247] -- 0:00:20
661500 -- [-778.832] (-778.698) (-781.574) (-783.416) * (-781.439) (-777.893) [-778.940] (-781.440) -- 0:00:19
662000 -- (-779.431) (-777.847) (-781.266) [-778.771] * (-781.073) [-778.044] (-781.955) (-778.327) -- 0:00:19
662500 -- (-778.361) (-781.706) (-779.237) [-778.648] * (-780.837) (-778.535) [-778.611] (-784.392) -- 0:00:19
663000 -- (-779.846) [-781.774] (-780.221) (-783.489) * (-780.542) (-779.643) (-779.050) [-779.954] -- 0:00:19
663500 -- [-779.844] (-781.662) (-783.351) (-782.321) * [-778.974] (-778.283) (-778.738) (-778.988) -- 0:00:19
664000 -- (-779.405) (-780.279) [-785.446] (-780.290) * (-781.956) [-778.466] (-779.044) (-781.296) -- 0:00:19
664500 -- (-780.554) (-778.760) (-784.305) [-780.894] * (-777.729) (-780.070) (-778.896) [-781.469] -- 0:00:19
665000 -- (-781.841) (-781.120) [-779.696] (-778.555) * [-778.636] (-778.884) (-779.892) (-781.675) -- 0:00:19
Average standard deviation of split frequencies: 0.009390
665500 -- [-779.182] (-778.156) (-778.566) (-779.226) * (-780.299) (-778.912) [-777.680] (-781.312) -- 0:00:19
666000 -- (-779.283) (-779.123) [-781.369] (-779.312) * (-778.531) [-779.765] (-779.037) (-782.076) -- 0:00:19
666500 -- (-778.874) (-782.910) (-781.607) [-780.421] * (-778.857) (-779.067) [-778.210] (-778.434) -- 0:00:19
667000 -- (-779.371) (-781.068) [-778.887] (-780.550) * [-777.683] (-781.352) (-782.457) (-779.941) -- 0:00:19
667500 -- [-779.333] (-778.466) (-781.133) (-780.124) * (-781.469) (-780.328) (-784.590) [-777.861] -- 0:00:19
668000 -- (-779.945) (-778.630) (-778.830) [-778.702] * [-778.187] (-779.521) (-783.388) (-781.484) -- 0:00:19
668500 -- (-785.980) [-779.039] (-778.759) (-778.752) * (-781.349) (-781.047) (-778.722) [-777.911] -- 0:00:19
669000 -- (-779.279) (-778.606) (-778.727) [-780.982] * [-780.554] (-778.599) (-779.533) (-780.186) -- 0:00:19
669500 -- (-780.037) (-778.800) [-779.889] (-782.979) * (-778.913) (-777.547) [-777.899] (-782.014) -- 0:00:19
670000 -- (-779.232) (-779.228) (-782.191) [-785.636] * (-780.686) [-778.719] (-778.441) (-781.677) -- 0:00:19
Average standard deviation of split frequencies: 0.009231
670500 -- [-785.599] (-778.349) (-779.193) (-778.522) * (-779.380) (-778.083) [-782.059] (-785.671) -- 0:00:19
671000 -- (-786.855) (-782.963) [-780.969] (-783.458) * (-778.426) (-780.642) (-781.907) [-781.356] -- 0:00:19
671500 -- (-783.793) (-781.055) [-782.561] (-782.404) * (-783.291) (-782.381) (-779.619) [-780.546] -- 0:00:19
672000 -- (-783.282) (-781.922) (-780.794) [-780.915] * [-780.215] (-780.013) (-779.872) (-779.241) -- 0:00:19
672500 -- (-779.278) (-782.174) [-778.418] (-781.843) * (-778.792) (-780.890) [-781.610] (-779.205) -- 0:00:19
673000 -- [-779.899] (-778.499) (-778.481) (-779.988) * (-780.670) (-780.039) [-783.132] (-781.161) -- 0:00:19
673500 -- (-780.612) (-780.152) (-779.119) [-780.009] * (-779.413) [-781.757] (-783.644) (-784.170) -- 0:00:19
674000 -- (-779.974) (-780.433) (-784.151) [-780.546] * (-779.919) [-780.315] (-778.158) (-786.659) -- 0:00:19
674500 -- (-782.240) (-781.555) [-784.368] (-781.434) * [-778.240] (-779.177) (-777.871) (-778.500) -- 0:00:19
675000 -- (-779.531) [-778.199] (-778.741) (-782.608) * (-780.074) [-781.645] (-777.809) (-780.760) -- 0:00:19
Average standard deviation of split frequencies: 0.009065
675500 -- [-778.585] (-778.201) (-780.345) (-779.001) * [-781.837] (-779.506) (-778.650) (-780.574) -- 0:00:19
676000 -- (-779.147) (-792.193) [-784.019] (-778.421) * (-786.760) [-779.596] (-780.238) (-781.155) -- 0:00:19
676500 -- (-779.950) (-778.693) (-781.582) [-778.703] * (-780.233) [-778.326] (-783.347) (-779.943) -- 0:00:19
677000 -- (-782.657) (-778.964) (-780.958) [-779.104] * (-780.438) (-781.963) (-783.596) [-779.611] -- 0:00:19
677500 -- (-778.957) [-780.261] (-780.067) (-782.429) * (-783.713) (-779.115) [-780.939] (-778.250) -- 0:00:19
678000 -- (-785.561) (-779.558) (-781.026) [-778.469] * (-780.346) (-779.050) (-783.060) [-779.764] -- 0:00:18
678500 -- (-784.135) [-779.461] (-778.802) (-779.502) * (-780.535) (-777.906) [-781.255] (-780.477) -- 0:00:18
679000 -- [-782.208] (-781.035) (-778.513) (-781.173) * (-780.335) (-781.370) [-782.968] (-779.276) -- 0:00:18
679500 -- (-780.027) [-780.245] (-779.351) (-781.429) * [-779.997] (-781.664) (-781.137) (-778.388) -- 0:00:18
680000 -- (-780.387) (-784.271) [-778.947] (-779.993) * [-779.714] (-781.172) (-781.597) (-784.740) -- 0:00:18
Average standard deviation of split frequencies: 0.009096
680500 -- (-779.203) (-780.652) [-780.868] (-779.705) * [-779.091] (-780.412) (-782.970) (-780.684) -- 0:00:18
681000 -- [-778.899] (-778.881) (-782.351) (-780.154) * [-778.888] (-780.513) (-778.857) (-784.271) -- 0:00:18
681500 -- (-779.303) (-782.941) [-781.070] (-779.668) * (-787.403) [-783.309] (-785.968) (-779.117) -- 0:00:18
682000 -- [-779.252] (-780.063) (-782.985) (-780.290) * (-780.081) (-777.751) (-778.541) [-780.583] -- 0:00:18
682500 -- (-777.824) (-781.137) (-779.017) [-783.611] * (-780.045) [-777.988] (-779.642) (-779.510) -- 0:00:18
683000 -- (-778.570) [-778.435] (-783.441) (-779.210) * (-779.773) (-778.735) [-783.625] (-787.448) -- 0:00:18
683500 -- (-780.951) (-779.428) [-781.154] (-779.441) * [-780.272] (-777.702) (-778.729) (-782.314) -- 0:00:18
684000 -- (-779.293) (-780.285) (-781.798) [-781.805] * [-778.693] (-778.695) (-780.683) (-780.205) -- 0:00:18
684500 -- [-779.178] (-781.787) (-784.767) (-780.042) * (-781.449) (-779.918) [-779.579] (-781.710) -- 0:00:18
685000 -- [-779.630] (-779.832) (-779.807) (-781.478) * (-780.068) (-780.662) (-780.373) [-778.083] -- 0:00:18
Average standard deviation of split frequencies: 0.008704
685500 -- (-778.524) (-779.884) [-778.521] (-783.946) * (-781.385) (-780.138) (-778.555) [-778.662] -- 0:00:18
686000 -- [-780.462] (-784.645) (-781.425) (-779.687) * (-781.936) [-779.565] (-780.652) (-778.596) -- 0:00:18
686500 -- (-779.993) (-781.986) [-779.152] (-779.067) * (-778.693) [-778.717] (-779.689) (-781.404) -- 0:00:18
687000 -- (-779.441) (-779.921) [-779.207] (-779.471) * (-779.292) [-778.489] (-778.694) (-779.652) -- 0:00:18
687500 -- (-781.363) (-780.195) (-785.052) [-778.901] * (-779.371) (-779.527) (-781.669) [-784.961] -- 0:00:18
688000 -- (-783.765) (-781.684) (-781.828) [-779.038] * (-778.431) (-780.179) (-778.444) [-781.299] -- 0:00:18
688500 -- (-779.422) (-778.523) (-779.838) [-780.591] * (-779.084) [-782.470] (-780.885) (-781.637) -- 0:00:18
689000 -- (-780.674) (-779.789) (-779.020) [-783.809] * (-778.973) (-781.600) [-778.171] (-781.571) -- 0:00:18
689500 -- (-781.126) (-780.583) [-780.146] (-779.642) * (-781.265) (-779.194) (-780.277) [-780.887] -- 0:00:18
690000 -- [-778.023] (-779.855) (-777.931) (-779.419) * (-779.680) (-782.143) (-779.006) [-779.063] -- 0:00:18
Average standard deviation of split frequencies: 0.008827
690500 -- [-779.422] (-779.243) (-778.949) (-777.435) * [-781.076] (-782.184) (-778.620) (-780.407) -- 0:00:18
691000 -- (-779.231) (-779.716) (-778.200) [-781.162] * (-778.626) (-781.603) (-781.940) [-778.138] -- 0:00:18
691500 -- (-781.516) [-778.862] (-779.842) (-781.878) * (-779.466) (-779.127) (-779.759) [-780.765] -- 0:00:18
692000 -- (-783.047) (-784.078) [-779.026] (-779.258) * (-779.099) (-779.266) (-780.843) [-780.356] -- 0:00:18
692500 -- (-781.568) [-780.861] (-786.579) (-778.917) * (-779.936) (-779.729) (-781.292) [-780.139] -- 0:00:18
693000 -- (-779.373) (-784.227) [-779.538] (-778.133) * (-780.176) [-781.239] (-780.810) (-782.818) -- 0:00:18
693500 -- (-779.249) [-787.899] (-779.065) (-781.201) * (-779.092) [-781.847] (-785.593) (-780.721) -- 0:00:18
694000 -- [-779.511] (-785.066) (-781.089) (-784.503) * [-781.274] (-780.722) (-781.942) (-780.272) -- 0:00:18
694500 -- (-780.916) (-780.574) (-782.683) [-779.056] * (-782.069) (-778.978) [-780.561] (-778.605) -- 0:00:18
695000 -- (-779.635) (-778.879) [-780.405] (-778.912) * (-781.067) (-781.063) [-777.969] (-780.156) -- 0:00:17
Average standard deviation of split frequencies: 0.009121
695500 -- (-779.784) (-781.998) (-780.832) [-777.646] * (-782.426) (-779.435) [-778.990] (-778.766) -- 0:00:17
696000 -- [-779.812] (-780.060) (-780.624) (-778.568) * (-784.125) (-779.075) (-784.019) [-778.495] -- 0:00:17
696500 -- [-779.599] (-778.772) (-780.175) (-783.630) * (-782.315) (-779.318) [-779.505] (-779.805) -- 0:00:17
697000 -- (-780.054) (-779.284) [-779.467] (-781.813) * [-779.308] (-780.737) (-779.053) (-779.401) -- 0:00:17
697500 -- [-782.215] (-779.828) (-780.383) (-779.760) * [-782.070] (-779.556) (-778.305) (-778.334) -- 0:00:17
698000 -- (-779.608) (-780.358) (-777.778) [-782.578] * [-780.721] (-777.993) (-781.734) (-778.235) -- 0:00:17
698500 -- [-780.140] (-780.968) (-778.006) (-781.476) * (-777.681) [-778.200] (-778.532) (-778.233) -- 0:00:17
699000 -- (-783.024) (-782.110) [-778.111] (-780.565) * (-779.152) [-779.394] (-779.183) (-779.155) -- 0:00:17
699500 -- (-781.983) [-779.220] (-779.475) (-779.916) * (-779.555) [-779.263] (-780.989) (-779.662) -- 0:00:17
700000 -- (-783.991) (-779.505) [-779.413] (-778.901) * (-779.229) (-779.613) [-778.307] (-780.406) -- 0:00:17
Average standard deviation of split frequencies: 0.009823
700500 -- (-779.705) (-782.701) (-778.845) [-780.403] * (-780.091) (-784.958) (-779.804) [-780.169] -- 0:00:17
701000 -- (-781.231) [-782.191] (-778.891) (-781.080) * (-780.470) [-780.541] (-781.188) (-778.062) -- 0:00:17
701500 -- (-778.485) (-780.400) [-779.639] (-778.765) * (-779.114) (-785.196) [-781.108] (-782.981) -- 0:00:17
702000 -- (-781.965) (-777.876) (-780.164) [-781.495] * (-778.484) (-781.539) (-778.981) [-781.228] -- 0:00:17
702500 -- (-781.757) [-777.916] (-779.401) (-782.962) * (-778.509) (-780.614) [-778.692] (-783.566) -- 0:00:17
703000 -- (-780.964) (-778.739) [-780.115] (-778.389) * [-777.982] (-778.028) (-780.716) (-782.106) -- 0:00:17
703500 -- (-780.117) [-781.112] (-781.144) (-777.875) * (-779.363) (-778.121) (-779.515) [-779.555] -- 0:00:17
704000 -- (-778.907) [-778.638] (-781.590) (-780.819) * [-778.155] (-779.669) (-780.917) (-780.756) -- 0:00:17
704500 -- (-778.018) (-779.844) [-779.988] (-782.133) * (-779.326) (-781.563) (-780.497) [-780.542] -- 0:00:17
705000 -- [-778.735] (-785.265) (-779.401) (-782.714) * (-778.117) (-779.848) [-779.824] (-780.162) -- 0:00:17
Average standard deviation of split frequencies: 0.010238
705500 -- (-779.980) (-780.855) [-779.443] (-778.860) * (-781.406) (-780.794) (-781.285) [-778.491] -- 0:00:17
706000 -- (-778.598) (-778.543) (-780.434) [-779.003] * (-781.487) (-779.846) [-779.785] (-777.914) -- 0:00:17
706500 -- [-778.385] (-778.058) (-779.575) (-780.989) * (-778.963) (-779.483) (-779.911) [-778.759] -- 0:00:17
707000 -- [-778.035] (-778.000) (-783.609) (-781.626) * (-778.691) (-779.249) [-779.285] (-778.543) -- 0:00:17
707500 -- (-779.304) (-780.576) [-779.689] (-779.269) * (-778.644) (-784.558) (-778.030) [-778.040] -- 0:00:17
708000 -- [-777.830] (-781.723) (-778.596) (-784.581) * (-779.029) (-783.521) (-781.516) [-780.368] -- 0:00:17
708500 -- (-778.350) (-782.487) (-778.646) [-782.762] * (-781.661) (-779.427) [-781.329] (-781.466) -- 0:00:17
709000 -- [-778.563] (-780.063) (-782.860) (-779.398) * (-779.251) [-780.567] (-779.568) (-781.633) -- 0:00:17
709500 -- [-780.012] (-779.506) (-781.177) (-780.342) * (-780.022) (-781.283) [-779.814] (-779.025) -- 0:00:17
710000 -- (-778.828) [-783.165] (-779.503) (-780.173) * (-779.295) [-778.110] (-784.262) (-778.630) -- 0:00:17
Average standard deviation of split frequencies: 0.009375
710500 -- (-781.235) (-781.672) [-778.065] (-781.206) * [-779.994] (-778.953) (-782.307) (-780.631) -- 0:00:17
711000 -- (-778.446) [-780.698] (-779.135) (-779.079) * (-778.455) (-780.528) (-780.097) [-780.718] -- 0:00:17
711500 -- [-778.990] (-784.218) (-783.970) (-780.396) * [-779.562] (-781.409) (-779.510) (-781.317) -- 0:00:17
712000 -- (-778.414) [-781.282] (-781.763) (-780.972) * (-783.220) (-782.750) (-780.566) [-784.828] -- 0:00:16
712500 -- (-779.536) [-778.879] (-780.282) (-780.365) * (-780.750) [-778.013] (-782.271) (-779.400) -- 0:00:16
713000 -- (-779.385) (-781.927) [-779.341] (-781.914) * (-783.309) [-779.337] (-778.860) (-788.666) -- 0:00:16
713500 -- [-779.924] (-778.235) (-780.010) (-783.755) * (-778.227) (-778.169) [-778.345] (-784.155) -- 0:00:16
714000 -- (-783.684) (-778.890) (-782.799) [-779.405] * (-780.476) (-778.368) [-778.907] (-778.820) -- 0:00:16
714500 -- (-781.794) [-778.155] (-782.743) (-781.121) * (-783.212) (-778.355) [-778.688] (-779.614) -- 0:00:16
715000 -- (-779.299) [-779.054] (-782.854) (-781.308) * (-778.017) (-779.416) (-781.306) [-778.478] -- 0:00:16
Average standard deviation of split frequencies: 0.008866
715500 -- [-779.503] (-778.301) (-779.581) (-779.762) * (-778.605) (-779.673) (-779.862) [-779.046] -- 0:00:16
716000 -- [-778.529] (-779.063) (-780.926) (-783.401) * [-783.021] (-782.495) (-779.475) (-779.231) -- 0:00:16
716500 -- [-781.047] (-779.414) (-779.841) (-782.635) * (-778.181) (-784.356) [-780.318] (-778.900) -- 0:00:16
717000 -- (-786.505) [-777.963] (-780.262) (-781.102) * (-780.196) (-780.621) [-779.720] (-780.375) -- 0:00:16
717500 -- (-779.128) [-778.888] (-781.761) (-779.974) * (-779.304) [-781.094] (-779.903) (-781.371) -- 0:00:16
718000 -- (-779.646) [-777.497] (-779.932) (-780.756) * (-781.180) (-781.490) [-778.412] (-780.476) -- 0:00:16
718500 -- (-779.311) (-778.052) (-780.427) [-778.214] * (-780.155) [-780.056] (-781.150) (-781.429) -- 0:00:16
719000 -- [-779.722] (-779.981) (-780.024) (-781.203) * (-777.856) [-781.760] (-781.380) (-781.791) -- 0:00:16
719500 -- (-779.694) (-780.005) [-784.171] (-780.276) * [-778.232] (-778.418) (-782.016) (-780.628) -- 0:00:16
720000 -- [-780.913] (-781.060) (-778.469) (-782.609) * (-781.623) (-777.873) [-778.419] (-783.864) -- 0:00:16
Average standard deviation of split frequencies: 0.008547
720500 -- (-779.471) [-778.556] (-780.197) (-781.107) * (-777.656) (-777.735) (-778.439) [-777.990] -- 0:00:16
721000 -- (-779.406) (-779.379) (-779.079) [-781.368] * [-777.821] (-783.887) (-781.876) (-778.745) -- 0:00:16
721500 -- (-789.095) (-779.633) (-781.426) [-779.585] * (-781.796) (-784.226) (-778.879) [-778.161] -- 0:00:16
722000 -- (-783.183) (-784.570) (-779.429) [-778.207] * [-778.909] (-780.335) (-778.565) (-779.019) -- 0:00:16
722500 -- [-781.875] (-781.304) (-779.560) (-777.899) * (-781.291) (-779.498) [-780.272] (-779.523) -- 0:00:16
723000 -- (-784.076) [-780.592] (-784.490) (-781.543) * (-781.017) [-779.537] (-780.267) (-779.695) -- 0:00:16
723500 -- (-780.159) (-782.580) (-779.270) [-777.784] * [-781.200] (-779.370) (-781.874) (-779.414) -- 0:00:16
724000 -- (-778.775) (-780.417) (-782.764) [-779.784] * (-783.316) [-779.954] (-783.041) (-782.298) -- 0:00:16
724500 -- (-780.687) (-781.393) (-783.817) [-780.231] * [-781.188] (-780.509) (-778.583) (-779.579) -- 0:00:16
725000 -- (-779.719) (-783.058) [-781.441] (-778.024) * (-780.505) (-779.329) (-780.587) [-780.351] -- 0:00:16
Average standard deviation of split frequencies: 0.008398
725500 -- (-780.656) (-781.257) (-780.102) [-780.933] * [-778.237] (-779.835) (-781.258) (-779.988) -- 0:00:16
726000 -- (-779.826) [-778.445] (-782.110) (-778.849) * (-777.623) (-780.334) [-779.370] (-782.311) -- 0:00:16
726500 -- (-779.956) [-780.671] (-779.171) (-781.149) * [-777.990] (-778.702) (-782.925) (-780.219) -- 0:00:16
727000 -- [-781.544] (-779.083) (-778.761) (-780.519) * [-781.047] (-778.916) (-783.258) (-782.643) -- 0:00:16
727500 -- (-781.670) [-780.236] (-780.164) (-779.788) * (-778.782) (-781.587) (-779.105) [-783.524] -- 0:00:16
728000 -- (-779.287) [-779.917] (-782.664) (-781.599) * [-780.130] (-779.008) (-779.834) (-780.505) -- 0:00:16
728500 -- (-777.924) [-778.235] (-785.921) (-779.234) * [-779.099] (-778.984) (-779.890) (-778.998) -- 0:00:16
729000 -- (-778.349) (-778.442) [-782.565] (-782.099) * (-781.677) [-779.159] (-779.489) (-779.950) -- 0:00:15
729500 -- [-779.182] (-780.394) (-780.522) (-781.303) * (-780.566) [-778.952] (-779.513) (-777.599) -- 0:00:15
730000 -- (-779.262) (-781.827) [-778.757] (-779.479) * (-782.334) (-779.437) (-780.121) [-780.867] -- 0:00:15
Average standard deviation of split frequencies: 0.008602
730500 -- [-779.586] (-779.461) (-778.978) (-779.067) * [-779.673] (-779.197) (-778.614) (-783.382) -- 0:00:15
731000 -- [-781.937] (-778.421) (-779.160) (-785.600) * (-779.772) [-778.035] (-778.615) (-780.460) -- 0:00:15
731500 -- [-779.232] (-780.549) (-778.338) (-779.720) * [-779.526] (-778.938) (-778.647) (-779.423) -- 0:00:15
732000 -- (-779.430) (-778.162) [-778.197] (-779.655) * (-778.865) (-778.322) (-779.172) [-780.188] -- 0:00:15
732500 -- (-779.272) (-779.168) (-777.961) [-781.977] * (-779.737) (-778.925) (-781.340) [-780.626] -- 0:00:15
733000 -- [-779.950] (-779.764) (-778.280) (-779.621) * [-779.301] (-778.662) (-779.208) (-783.172) -- 0:00:15
733500 -- (-779.346) (-780.433) [-778.085] (-777.984) * [-779.926] (-784.300) (-779.573) (-779.048) -- 0:00:15
734000 -- (-778.997) (-777.467) [-778.262] (-780.428) * (-782.303) [-778.143] (-780.957) (-780.308) -- 0:00:15
734500 -- (-779.332) (-780.205) [-780.308] (-779.633) * (-779.815) [-781.300] (-779.520) (-777.828) -- 0:00:15
735000 -- (-779.193) [-780.815] (-779.486) (-780.476) * (-777.889) (-779.734) (-778.921) [-778.973] -- 0:00:15
Average standard deviation of split frequencies: 0.008497
735500 -- (-779.272) [-778.975] (-779.755) (-781.603) * (-779.510) (-778.731) [-782.873] (-780.432) -- 0:00:15
736000 -- (-779.322) (-780.109) [-778.467] (-779.098) * [-787.560] (-779.505) (-783.474) (-780.099) -- 0:00:15
736500 -- (-781.542) (-779.868) [-778.519] (-779.700) * [-780.456] (-779.806) (-779.254) (-781.466) -- 0:00:15
737000 -- [-779.996] (-783.047) (-782.122) (-779.540) * (-779.399) (-782.863) [-781.381] (-780.767) -- 0:00:15
737500 -- (-781.157) (-782.308) [-780.334] (-780.044) * [-778.229] (-784.009) (-780.991) (-779.222) -- 0:00:15
738000 -- (-782.165) [-778.877] (-781.021) (-781.251) * (-782.664) (-780.053) (-778.449) [-785.273] -- 0:00:15
738500 -- (-783.114) [-780.057] (-778.180) (-779.895) * [-780.006] (-785.282) (-778.423) (-783.352) -- 0:00:15
739000 -- (-780.701) (-779.487) [-778.916] (-784.377) * (-780.420) [-778.462] (-779.243) (-781.102) -- 0:00:15
739500 -- (-778.205) [-780.577] (-779.857) (-781.684) * (-784.231) (-779.579) (-778.188) [-784.507] -- 0:00:15
740000 -- (-782.848) [-777.698] (-779.160) (-782.356) * (-780.537) [-778.452] (-777.628) (-784.952) -- 0:00:15
Average standard deviation of split frequencies: 0.008529
740500 -- [-779.278] (-779.543) (-781.142) (-780.594) * (-782.384) [-781.248] (-780.381) (-782.021) -- 0:00:15
741000 -- (-778.923) (-779.140) [-781.479] (-779.990) * (-779.482) [-778.420] (-778.668) (-779.767) -- 0:00:15
741500 -- (-783.282) (-778.723) [-778.267] (-778.134) * [-779.731] (-778.886) (-778.505) (-778.305) -- 0:00:15
742000 -- [-779.517] (-778.899) (-779.872) (-781.683) * (-781.336) [-778.016] (-780.527) (-778.893) -- 0:00:15
742500 -- (-780.260) (-777.739) [-778.234] (-780.080) * (-778.880) [-778.805] (-780.604) (-782.997) -- 0:00:15
743000 -- (-779.652) (-779.685) [-778.545] (-780.241) * (-782.451) (-778.696) [-778.638] (-783.798) -- 0:00:15
743500 -- (-778.799) (-783.496) (-778.047) [-778.439] * (-782.534) [-779.260] (-778.688) (-784.079) -- 0:00:15
744000 -- (-781.006) (-783.697) (-780.062) [-778.855] * (-782.509) [-779.461] (-778.180) (-786.263) -- 0:00:15
744500 -- (-781.752) (-781.854) (-778.636) [-778.278] * (-782.561) [-778.181] (-781.494) (-789.757) -- 0:00:15
745000 -- [-779.954] (-778.827) (-780.045) (-778.447) * (-788.465) (-778.597) [-778.333] (-778.837) -- 0:00:15
Average standard deviation of split frequencies: 0.008425
745500 -- (-780.008) (-781.926) (-781.444) [-777.787] * (-781.831) (-778.528) (-779.439) [-778.266] -- 0:00:15
746000 -- (-787.961) [-781.521] (-782.384) (-777.659) * (-782.445) (-780.858) [-780.893] (-781.629) -- 0:00:14
746500 -- (-784.209) (-784.133) (-777.942) [-779.782] * [-782.061] (-779.725) (-784.101) (-783.234) -- 0:00:14
747000 -- [-781.873] (-782.997) (-779.179) (-780.280) * (-779.363) [-779.886] (-780.858) (-782.755) -- 0:00:14
747500 -- (-781.301) (-780.945) [-781.078] (-779.781) * [-778.211] (-779.977) (-784.166) (-782.372) -- 0:00:14
748000 -- [-778.179] (-782.234) (-780.777) (-780.128) * (-779.045) (-781.507) (-777.462) [-781.148] -- 0:00:14
748500 -- (-779.646) (-784.288) (-779.825) [-778.832] * (-779.530) (-778.945) (-777.629) [-778.774] -- 0:00:14
749000 -- (-780.515) [-780.798] (-778.776) (-778.524) * (-779.726) [-778.877] (-781.839) (-781.261) -- 0:00:14
749500 -- (-782.285) (-781.044) [-780.176] (-780.964) * (-780.364) (-782.289) (-780.857) [-779.974] -- 0:00:14
750000 -- (-779.240) [-785.347] (-781.655) (-780.703) * (-778.815) [-779.469] (-778.067) (-777.833) -- 0:00:14
Average standard deviation of split frequencies: 0.008959
750500 -- (-778.627) (-786.184) (-781.090) [-779.293] * (-778.667) [-783.435] (-780.174) (-777.978) -- 0:00:14
751000 -- (-778.079) (-781.194) [-779.790] (-783.996) * (-778.795) (-779.602) (-778.737) [-779.262] -- 0:00:14
751500 -- (-778.584) (-778.739) [-778.958] (-778.559) * (-783.575) (-778.947) [-779.572] (-780.571) -- 0:00:14
752000 -- (-778.911) (-778.210) [-779.474] (-780.080) * (-779.579) (-778.033) (-778.183) [-781.914] -- 0:00:14
752500 -- (-780.479) [-779.622] (-780.509) (-778.796) * (-779.435) [-779.385] (-779.839) (-782.705) -- 0:00:14
753000 -- [-781.953] (-778.666) (-779.570) (-778.145) * (-777.768) (-778.800) [-781.992] (-780.554) -- 0:00:14
753500 -- (-779.240) (-781.267) (-779.596) [-777.441] * [-779.843] (-779.338) (-782.154) (-780.926) -- 0:00:14
754000 -- [-782.501] (-783.359) (-777.920) (-777.810) * [-777.835] (-778.956) (-781.101) (-777.793) -- 0:00:14
754500 -- (-780.049) (-783.489) (-778.181) [-779.589] * (-778.246) (-777.811) [-778.125] (-782.791) -- 0:00:14
755000 -- [-780.675] (-782.467) (-783.336) (-779.632) * [-781.083] (-780.298) (-779.356) (-783.885) -- 0:00:14
Average standard deviation of split frequencies: 0.008522
755500 -- (-779.495) (-780.602) [-781.709] (-779.247) * [-778.827] (-779.647) (-779.723) (-781.718) -- 0:00:14
756000 -- [-782.934] (-778.551) (-779.540) (-780.722) * (-779.854) (-779.485) [-778.993] (-779.338) -- 0:00:14
756500 -- (-782.637) [-778.405] (-781.554) (-781.349) * (-781.690) (-781.420) (-778.855) [-779.704] -- 0:00:14
757000 -- (-780.162) (-781.789) (-784.175) [-778.438] * (-778.874) (-780.104) [-781.129] (-779.368) -- 0:00:14
757500 -- [-781.897] (-780.663) (-779.518) (-778.721) * [-779.102] (-781.535) (-778.899) (-782.283) -- 0:00:14
758000 -- (-783.090) (-780.064) (-782.258) [-778.450] * (-778.833) [-779.198] (-778.899) (-781.591) -- 0:00:14
758500 -- (-781.192) [-780.854] (-778.548) (-780.932) * [-777.661] (-780.187) (-781.001) (-790.432) -- 0:00:14
759000 -- [-782.559] (-779.344) (-780.776) (-780.852) * (-780.294) (-778.469) [-779.509] (-786.021) -- 0:00:14
759500 -- (-779.263) (-779.928) (-778.628) [-780.164] * (-780.445) [-778.126] (-783.006) (-782.574) -- 0:00:14
760000 -- (-778.994) (-779.758) (-779.662) [-781.419] * (-783.224) (-779.003) [-785.890] (-783.411) -- 0:00:14
Average standard deviation of split frequencies: 0.008098
760500 -- (-779.707) [-781.701] (-779.911) (-780.276) * [-781.846] (-780.963) (-785.251) (-783.063) -- 0:00:14
761000 -- [-781.893] (-780.116) (-780.419) (-781.360) * [-778.579] (-781.355) (-781.026) (-781.926) -- 0:00:14
761500 -- (-779.652) (-779.828) [-780.899] (-781.005) * (-782.018) (-779.263) [-780.682] (-780.866) -- 0:00:14
762000 -- (-778.274) [-783.323] (-779.639) (-779.285) * (-786.480) [-779.250] (-778.682) (-779.161) -- 0:00:14
762500 -- (-778.234) (-783.548) [-780.494] (-781.090) * (-782.800) (-778.999) [-778.670] (-778.616) -- 0:00:14
763000 -- [-780.421] (-778.102) (-779.795) (-779.248) * (-783.971) [-781.080] (-777.864) (-780.126) -- 0:00:13
763500 -- (-784.479) [-778.900] (-778.150) (-779.897) * (-778.445) (-781.746) (-778.517) [-783.441] -- 0:00:13
764000 -- (-780.519) [-779.354] (-780.320) (-783.002) * (-777.728) [-778.193] (-783.978) (-782.973) -- 0:00:13
764500 -- (-780.418) (-780.139) [-778.223] (-780.757) * (-781.476) [-779.493] (-778.391) (-782.254) -- 0:00:13
765000 -- (-780.663) (-780.250) [-780.022] (-780.225) * (-778.477) (-779.842) (-778.219) [-784.630] -- 0:00:13
Average standard deviation of split frequencies: 0.007631
765500 -- (-779.675) (-778.737) (-780.832) [-779.621] * [-779.926] (-782.391) (-780.175) (-779.666) -- 0:00:13
766000 -- (-780.155) (-778.275) (-778.895) [-780.735] * (-780.157) (-780.098) (-779.452) [-778.702] -- 0:00:13
766500 -- (-782.076) [-780.573] (-779.803) (-780.619) * (-778.084) (-780.870) [-777.893] (-784.038) -- 0:00:13
767000 -- (-782.859) [-780.069] (-779.186) (-779.502) * (-780.310) [-781.088] (-778.626) (-783.209) -- 0:00:13
767500 -- (-781.329) (-778.346) [-780.445] (-780.434) * [-778.911] (-778.037) (-786.807) (-778.247) -- 0:00:13
768000 -- (-782.571) [-780.924] (-783.191) (-781.252) * [-780.442] (-780.539) (-781.787) (-777.781) -- 0:00:13
768500 -- [-779.424] (-778.142) (-782.130) (-779.015) * [-781.475] (-779.451) (-784.548) (-780.687) -- 0:00:13
769000 -- [-778.773] (-780.781) (-782.713) (-779.048) * (-780.678) (-779.689) (-781.935) [-779.804] -- 0:00:13
769500 -- (-779.907) (-778.360) (-782.777) [-784.218] * (-778.235) [-778.001] (-778.323) (-782.364) -- 0:00:13
770000 -- (-779.783) (-781.370) (-781.738) [-782.090] * (-778.032) (-778.301) (-777.844) [-780.948] -- 0:00:13
Average standard deviation of split frequencies: 0.007544
770500 -- (-778.769) [-779.186] (-777.936) (-782.057) * (-778.619) [-780.379] (-778.311) (-781.342) -- 0:00:13
771000 -- (-778.203) (-779.650) [-778.661] (-780.895) * (-780.318) (-778.816) [-778.078] (-781.545) -- 0:00:13
771500 -- (-778.522) (-784.673) [-779.532] (-779.286) * (-779.391) (-779.798) (-781.755) [-781.051] -- 0:00:13
772000 -- (-787.389) (-781.852) (-780.264) [-778.796] * (-785.864) (-779.088) (-782.319) [-781.332] -- 0:00:13
772500 -- [-781.499] (-784.286) (-779.755) (-784.445) * [-784.795] (-778.384) (-782.199) (-778.793) -- 0:00:13
773000 -- (-780.078) [-777.721] (-780.352) (-782.512) * (-778.694) (-779.852) (-784.071) [-778.879] -- 0:00:13
773500 -- [-781.116] (-778.028) (-780.556) (-780.915) * [-779.960] (-780.168) (-780.812) (-779.350) -- 0:00:13
774000 -- (-781.880) (-781.774) (-784.192) [-785.808] * (-778.324) (-778.930) [-782.664] (-780.293) -- 0:00:13
774500 -- (-779.048) (-779.115) (-782.061) [-781.148] * (-778.702) (-780.370) [-782.367] (-780.106) -- 0:00:13
775000 -- (-783.950) (-782.849) (-781.324) [-778.774] * (-779.970) [-779.184] (-779.936) (-780.940) -- 0:00:13
Average standard deviation of split frequencies: 0.007695
775500 -- (-783.841) (-782.313) [-781.363] (-785.635) * (-779.216) [-779.372] (-783.215) (-778.303) -- 0:00:13
776000 -- (-778.972) (-779.815) [-779.602] (-779.140) * (-779.895) (-779.950) [-779.357] (-781.676) -- 0:00:13
776500 -- (-784.180) (-779.286) (-780.195) [-782.721] * (-778.801) [-778.822] (-778.128) (-779.009) -- 0:00:13
777000 -- (-781.062) [-779.423] (-779.621) (-780.737) * (-780.695) [-778.253] (-781.913) (-781.751) -- 0:00:13
777500 -- (-778.962) (-779.725) [-779.092] (-778.569) * (-778.740) [-781.888] (-780.630) (-783.354) -- 0:00:13
778000 -- [-786.725] (-778.237) (-777.734) (-781.215) * (-780.625) [-778.834] (-778.509) (-782.193) -- 0:00:13
778500 -- (-780.158) [-779.569] (-777.787) (-779.211) * (-778.831) (-779.144) (-780.489) [-779.489] -- 0:00:13
779000 -- (-783.854) (-778.479) (-779.406) [-779.711] * [-781.205] (-779.728) (-780.398) (-778.811) -- 0:00:13
779500 -- [-779.309] (-779.623) (-781.894) (-778.799) * (-780.158) [-780.075] (-778.689) (-778.254) -- 0:00:13
780000 -- [-779.575] (-778.965) (-779.555) (-780.347) * (-779.455) (-777.576) (-781.599) [-782.692] -- 0:00:12
Average standard deviation of split frequencies: 0.008011
780500 -- (-778.536) (-779.972) (-780.765) [-779.073] * (-783.700) [-781.515] (-784.923) (-785.686) -- 0:00:12
781000 -- (-781.613) [-779.386] (-779.904) (-779.694) * [-779.371] (-778.552) (-781.150) (-779.151) -- 0:00:12
781500 -- [-781.147] (-781.315) (-779.203) (-779.931) * (-779.753) (-781.387) (-781.011) [-779.669] -- 0:00:12
782000 -- (-778.972) [-779.550] (-781.980) (-779.459) * (-778.629) (-778.109) [-777.896] (-779.371) -- 0:00:12
782500 -- (-779.177) (-779.563) (-779.273) [-780.280] * (-780.286) [-778.254] (-779.739) (-782.647) -- 0:00:12
783000 -- (-781.800) (-777.692) [-777.972] (-780.311) * (-779.183) (-783.594) [-779.323] (-779.090) -- 0:00:12
783500 -- [-782.168] (-781.210) (-781.922) (-783.072) * (-781.140) (-780.008) (-781.817) [-778.911] -- 0:00:12
784000 -- (-779.904) (-778.887) (-779.581) [-781.512] * (-778.057) [-780.930] (-782.953) (-778.305) -- 0:00:12
784500 -- [-780.669] (-778.079) (-779.196) (-781.508) * [-779.355] (-781.596) (-782.243) (-778.478) -- 0:00:12
785000 -- [-785.059] (-778.142) (-778.883) (-782.134) * [-777.868] (-780.662) (-784.352) (-778.689) -- 0:00:12
Average standard deviation of split frequencies: 0.007877
785500 -- [-784.574] (-780.679) (-779.717) (-780.742) * (-779.585) [-779.782] (-780.489) (-780.537) -- 0:00:12
786000 -- (-780.217) [-782.706] (-779.753) (-777.959) * (-779.583) (-780.272) (-777.640) [-787.710] -- 0:00:12
786500 -- [-782.638] (-783.543) (-787.434) (-778.158) * (-778.534) (-778.900) (-779.516) [-780.244] -- 0:00:12
787000 -- (-779.315) (-779.175) (-781.076) [-778.101] * (-778.517) (-781.645) [-779.290] (-782.676) -- 0:00:12
787500 -- [-777.552] (-782.476) (-785.570) (-782.868) * (-781.187) (-779.237) [-778.854] (-780.067) -- 0:00:12
788000 -- (-780.404) (-778.303) [-780.063] (-778.709) * [-780.673] (-782.961) (-779.571) (-779.953) -- 0:00:12
788500 -- (-782.244) [-778.474] (-779.761) (-782.330) * (-780.754) [-780.972] (-780.753) (-779.291) -- 0:00:12
789000 -- (-780.077) (-779.554) (-781.773) [-781.045] * (-781.296) (-778.178) (-778.984) [-780.499] -- 0:00:12
789500 -- [-781.121] (-786.947) (-778.319) (-779.806) * (-778.900) (-779.762) (-779.679) [-780.780] -- 0:00:12
790000 -- (-780.262) (-779.842) (-779.174) [-780.791] * (-780.215) (-787.235) (-784.995) [-779.069] -- 0:00:12
Average standard deviation of split frequencies: 0.007751
790500 -- (-781.513) [-784.572] (-781.568) (-778.977) * (-777.933) (-781.818) [-780.274] (-780.468) -- 0:00:12
791000 -- (-781.747) (-782.621) (-780.244) [-779.568] * [-779.911] (-779.233) (-782.320) (-781.314) -- 0:00:12
791500 -- [-782.503] (-777.876) (-780.197) (-778.691) * [-780.284] (-779.280) (-778.986) (-778.467) -- 0:00:12
792000 -- [-778.915] (-780.725) (-781.059) (-778.103) * [-779.912] (-784.627) (-777.676) (-778.814) -- 0:00:12
792500 -- (-778.493) (-785.803) [-779.395] (-779.726) * (-778.674) [-780.870] (-777.868) (-783.383) -- 0:00:12
793000 -- (-781.745) [-781.476] (-783.313) (-779.111) * (-782.377) (-780.401) [-778.984] (-783.302) -- 0:00:12
793500 -- (-782.803) [-781.657] (-783.038) (-779.324) * [-778.701] (-782.319) (-786.282) (-780.771) -- 0:00:12
794000 -- (-779.815) (-779.892) [-778.778] (-780.052) * (-782.012) (-780.637) [-783.156] (-784.485) -- 0:00:12
794500 -- (-778.429) (-779.193) (-779.603) [-778.862] * (-780.895) (-779.656) [-781.391] (-779.908) -- 0:00:12
795000 -- [-777.998] (-778.916) (-779.546) (-780.777) * (-782.934) (-778.969) [-779.054] (-780.713) -- 0:00:12
Average standard deviation of split frequencies: 0.007857
795500 -- [-779.115] (-778.978) (-779.835) (-784.996) * (-781.615) (-784.430) [-778.250] (-780.774) -- 0:00:12
796000 -- [-778.857] (-780.031) (-778.238) (-783.319) * (-781.303) (-781.946) [-778.446] (-783.674) -- 0:00:12
796500 -- (-778.825) (-779.038) (-779.474) [-778.768] * (-781.005) [-783.767] (-782.051) (-782.507) -- 0:00:12
797000 -- [-779.596] (-778.802) (-779.235) (-778.752) * (-779.319) (-779.255) [-781.861] (-779.777) -- 0:00:11
797500 -- [-779.285] (-778.228) (-780.547) (-783.308) * (-779.946) [-778.648] (-780.988) (-779.472) -- 0:00:11
798000 -- (-780.262) (-778.316) (-780.573) [-781.042] * (-779.327) [-778.136] (-780.454) (-781.127) -- 0:00:11
798500 -- (-778.856) [-779.193] (-778.348) (-780.113) * (-785.588) [-779.226] (-780.970) (-779.320) -- 0:00:11
799000 -- (-779.395) [-779.420] (-782.017) (-781.242) * (-777.753) [-781.225] (-779.051) (-777.953) -- 0:00:11
799500 -- (-779.119) (-779.519) [-778.412] (-780.239) * (-779.647) (-779.129) (-778.849) [-778.232] -- 0:00:11
800000 -- [-781.440] (-780.669) (-780.026) (-778.810) * (-778.020) (-779.679) (-781.490) [-780.420] -- 0:00:11
Average standard deviation of split frequencies: 0.008164
800500 -- (-783.160) (-779.463) (-783.702) [-778.490] * (-780.135) (-778.524) (-778.066) [-785.057] -- 0:00:11
801000 -- (-781.587) [-783.814] (-780.828) (-781.084) * (-778.421) [-782.178] (-779.213) (-782.265) -- 0:00:11
801500 -- (-781.598) (-782.588) (-780.050) [-779.949] * (-779.295) (-782.813) [-779.589] (-778.690) -- 0:00:11
802000 -- [-779.635] (-781.394) (-778.890) (-781.119) * (-780.134) (-780.200) [-781.289] (-780.090) -- 0:00:11
802500 -- (-781.657) [-780.125] (-778.847) (-781.746) * (-778.824) [-779.301] (-782.292) (-781.259) -- 0:00:11
803000 -- (-780.264) (-781.792) [-779.974] (-779.825) * (-780.023) [-779.837] (-779.616) (-782.017) -- 0:00:11
803500 -- [-778.042] (-780.446) (-782.026) (-782.470) * [-780.215] (-779.131) (-778.245) (-781.725) -- 0:00:11
804000 -- (-779.447) [-779.830] (-781.243) (-784.055) * (-778.535) [-778.317] (-779.053) (-780.909) -- 0:00:11
804500 -- (-781.256) [-779.728] (-779.066) (-779.362) * (-782.222) (-778.134) (-781.491) [-779.370] -- 0:00:11
805000 -- (-780.010) (-779.072) (-779.176) [-778.135] * (-780.008) [-777.904] (-781.665) (-779.341) -- 0:00:11
Average standard deviation of split frequencies: 0.008227
805500 -- (-779.929) (-778.185) (-782.589) [-778.557] * (-779.353) (-780.331) (-779.353) [-778.832] -- 0:00:11
806000 -- (-779.564) (-778.259) (-779.151) [-780.526] * (-779.153) (-778.838) (-779.432) [-780.174] -- 0:00:11
806500 -- (-779.035) [-778.280] (-777.984) (-781.787) * (-781.397) [-778.561] (-778.696) (-781.263) -- 0:00:11
807000 -- (-778.851) [-777.903] (-780.545) (-780.948) * (-783.480) [-779.401] (-781.014) (-784.183) -- 0:00:11
807500 -- (-778.788) (-781.652) [-778.994] (-782.130) * (-792.755) (-779.347) (-781.479) [-781.058] -- 0:00:11
808000 -- (-782.416) [-777.902] (-779.660) (-781.088) * (-787.783) (-782.040) [-778.317] (-782.794) -- 0:00:11
808500 -- (-780.851) [-777.970] (-778.311) (-779.368) * [-780.818] (-779.054) (-779.181) (-781.966) -- 0:00:11
809000 -- [-781.586] (-778.078) (-779.486) (-779.337) * (-781.724) (-781.125) (-779.448) [-779.239] -- 0:00:11
809500 -- (-779.728) (-778.939) (-779.277) [-782.282] * (-781.973) (-782.269) [-778.628] (-784.459) -- 0:00:11
810000 -- [-780.914] (-779.334) (-781.548) (-778.434) * (-779.717) [-777.773] (-777.750) (-780.744) -- 0:00:11
Average standard deviation of split frequencies: 0.007986
810500 -- (-778.961) (-780.042) [-779.878] (-780.208) * (-778.262) [-779.045] (-777.725) (-781.608) -- 0:00:11
811000 -- (-780.557) (-781.491) [-779.544] (-778.495) * (-779.326) [-778.650] (-777.741) (-785.077) -- 0:00:11
811500 -- (-781.732) (-779.208) (-778.932) [-778.489] * (-778.436) (-779.837) [-779.141] (-778.057) -- 0:00:11
812000 -- (-780.228) [-778.075] (-778.863) (-777.872) * (-780.618) [-778.685] (-780.936) (-778.529) -- 0:00:11
812500 -- (-778.858) (-781.605) (-779.367) [-778.568] * [-779.287] (-782.699) (-781.014) (-780.360) -- 0:00:11
813000 -- [-778.124] (-780.899) (-784.283) (-778.673) * (-779.387) (-780.005) (-778.220) [-778.030] -- 0:00:11
813500 -- [-782.428] (-781.296) (-779.000) (-778.078) * (-779.726) [-780.319] (-778.881) (-783.719) -- 0:00:11
814000 -- (-779.049) (-778.668) [-778.825] (-781.785) * (-778.031) (-777.714) (-779.290) [-782.569] -- 0:00:10
814500 -- [-779.091] (-779.895) (-781.915) (-782.523) * (-778.792) (-778.255) [-779.478] (-780.450) -- 0:00:10
815000 -- (-779.793) (-779.344) (-777.966) [-781.404] * [-779.819] (-778.918) (-779.799) (-778.845) -- 0:00:10
Average standard deviation of split frequencies: 0.008396
815500 -- (-780.250) (-780.543) [-779.905] (-781.838) * (-778.440) (-778.728) [-778.049] (-780.187) -- 0:00:10
816000 -- (-779.245) (-781.028) [-780.794] (-781.376) * (-781.807) (-782.555) [-778.489] (-781.034) -- 0:00:10
816500 -- [-778.650] (-780.777) (-778.089) (-782.582) * (-781.397) (-779.171) [-780.870] (-778.583) -- 0:00:10
817000 -- (-778.530) (-781.715) [-782.134] (-780.625) * (-779.615) (-778.521) (-779.994) [-778.496] -- 0:00:10
817500 -- (-779.941) (-779.791) [-782.509] (-780.218) * (-781.454) (-780.618) (-780.353) [-777.708] -- 0:00:10
818000 -- (-779.684) (-779.602) (-780.115) [-779.330] * (-784.356) (-779.073) (-781.029) [-780.628] -- 0:00:10
818500 -- [-782.565] (-779.613) (-778.327) (-782.929) * (-781.382) (-781.111) (-779.437) [-779.224] -- 0:00:10
819000 -- (-779.626) [-779.575] (-778.279) (-778.315) * (-780.374) [-781.005] (-779.250) (-778.923) -- 0:00:10
819500 -- (-780.429) (-780.544) (-777.529) [-779.649] * (-778.862) (-778.270) (-780.333) [-778.023] -- 0:00:10
820000 -- (-782.594) [-778.902] (-777.809) (-781.900) * (-781.450) (-779.752) [-779.403] (-779.109) -- 0:00:10
Average standard deviation of split frequencies: 0.008118
820500 -- (-785.573) [-778.784] (-780.550) (-779.737) * (-779.712) [-777.903] (-780.800) (-778.684) -- 0:00:10
821000 -- (-780.354) (-780.305) [-779.541] (-779.372) * [-778.302] (-778.128) (-781.225) (-777.832) -- 0:00:10
821500 -- (-779.102) (-781.544) [-778.133] (-780.267) * (-781.847) (-784.373) [-779.052] (-778.877) -- 0:00:10
822000 -- (-778.538) (-781.200) (-778.876) [-777.868] * (-780.344) [-783.853] (-785.310) (-779.278) -- 0:00:10
822500 -- [-778.323] (-782.879) (-778.362) (-779.144) * (-777.759) [-780.704] (-781.861) (-781.441) -- 0:00:10
823000 -- (-779.100) (-782.835) [-781.222] (-777.737) * [-778.062] (-779.231) (-781.813) (-780.032) -- 0:00:10
823500 -- [-780.100] (-777.648) (-780.251) (-779.664) * [-777.730] (-779.156) (-779.053) (-780.442) -- 0:00:10
824000 -- (-778.857) [-778.014] (-779.283) (-778.914) * (-777.818) (-779.208) (-779.761) [-778.371] -- 0:00:10
824500 -- [-780.804] (-781.079) (-780.540) (-779.868) * (-778.090) [-778.822] (-781.607) (-779.628) -- 0:00:10
825000 -- (-780.578) (-780.181) [-780.088] (-780.204) * [-779.825] (-781.404) (-780.504) (-778.113) -- 0:00:10
Average standard deviation of split frequencies: 0.007800
825500 -- (-781.932) (-780.415) [-779.537] (-778.112) * (-782.431) (-782.514) (-779.361) [-778.523] -- 0:00:10
826000 -- (-779.807) (-783.553) (-779.662) [-777.764] * (-780.696) [-780.163] (-778.830) (-781.288) -- 0:00:10
826500 -- (-778.187) (-780.214) [-780.884] (-778.351) * (-779.447) (-782.168) (-778.975) [-778.035] -- 0:00:10
827000 -- (-779.730) (-781.137) (-782.973) [-778.646] * (-781.371) (-784.809) (-778.372) [-780.490] -- 0:00:10
827500 -- (-778.327) (-784.062) (-778.384) [-778.908] * [-778.202] (-778.791) (-777.891) (-778.039) -- 0:00:10
828000 -- (-779.683) (-781.225) (-784.339) [-780.837] * (-779.382) (-780.360) (-780.134) [-781.447] -- 0:00:10
828500 -- (-782.394) (-779.028) (-778.820) [-780.567] * (-779.125) [-778.228] (-778.622) (-782.795) -- 0:00:10
829000 -- (-779.697) [-779.459] (-779.064) (-779.785) * (-781.385) (-780.238) [-778.989] (-779.533) -- 0:00:10
829500 -- (-782.247) (-780.565) (-780.462) [-779.499] * (-778.067) (-778.624) [-781.767] (-778.945) -- 0:00:10
830000 -- (-779.033) (-780.519) [-779.888] (-780.906) * (-779.040) (-779.579) [-781.617] (-780.450) -- 0:00:10
Average standard deviation of split frequencies: 0.007794
830500 -- [-780.336] (-782.038) (-778.383) (-779.383) * (-779.570) [-779.023] (-781.449) (-779.028) -- 0:00:10
831000 -- (-778.051) (-778.482) (-779.518) [-778.220] * (-780.880) [-779.288] (-781.042) (-778.207) -- 0:00:09
831500 -- (-780.939) [-779.324] (-781.202) (-785.029) * (-780.488) [-778.647] (-782.252) (-780.234) -- 0:00:09
832000 -- (-781.215) (-779.801) [-780.768] (-780.624) * (-780.265) (-778.448) (-780.972) [-779.041] -- 0:00:09
832500 -- (-780.141) (-779.180) (-780.491) [-778.559] * (-783.152) (-784.391) (-779.808) [-782.037] -- 0:00:09
833000 -- (-779.013) (-778.136) (-779.298) [-778.286] * (-778.520) (-779.716) [-779.168] (-778.472) -- 0:00:09
833500 -- (-780.453) (-780.220) (-778.549) [-779.242] * (-781.129) (-778.661) (-780.875) [-780.327] -- 0:00:09
834000 -- (-778.237) (-779.152) [-779.326] (-781.720) * (-779.375) (-777.863) (-780.014) [-778.718] -- 0:00:09
834500 -- [-778.353] (-779.712) (-778.429) (-783.102) * (-780.156) [-779.545] (-778.902) (-778.711) -- 0:00:09
835000 -- (-778.084) (-780.890) [-780.402] (-782.705) * (-780.630) (-781.054) [-780.523] (-779.616) -- 0:00:09
Average standard deviation of split frequencies: 0.007669
835500 -- [-777.919] (-779.815) (-777.490) (-778.325) * (-779.999) (-784.625) (-780.772) [-779.664] -- 0:00:09
836000 -- (-777.555) (-779.831) [-778.743] (-778.703) * [-779.129] (-782.660) (-781.403) (-779.554) -- 0:00:09
836500 -- (-777.975) (-783.058) [-779.042] (-778.236) * [-780.188] (-779.166) (-779.423) (-782.525) -- 0:00:09
837000 -- [-779.444] (-788.501) (-779.643) (-781.687) * [-778.619] (-783.105) (-781.788) (-780.207) -- 0:00:09
837500 -- (-779.444) (-783.598) (-782.075) [-779.376] * (-780.883) (-778.210) [-780.578] (-780.544) -- 0:00:09
838000 -- (-781.512) (-779.563) [-780.519] (-781.460) * (-779.412) (-779.693) (-780.440) [-779.593] -- 0:00:09
838500 -- [-780.455] (-778.822) (-778.434) (-778.698) * (-778.674) [-780.751] (-784.531) (-783.699) -- 0:00:09
839000 -- (-779.012) (-779.076) (-780.454) [-778.177] * [-781.110] (-778.356) (-778.342) (-779.266) -- 0:00:09
839500 -- (-780.527) (-779.223) (-779.817) [-778.472] * (-782.270) [-778.279] (-781.304) (-782.589) -- 0:00:09
840000 -- (-781.851) [-779.928] (-780.892) (-781.975) * (-785.112) [-778.788] (-779.908) (-781.310) -- 0:00:09
Average standard deviation of split frequencies: 0.008336
840500 -- (-778.000) (-779.469) (-779.306) [-779.881] * (-786.533) [-778.301] (-779.105) (-780.244) -- 0:00:09
841000 -- [-778.638] (-781.614) (-779.878) (-781.716) * (-781.759) [-779.230] (-780.880) (-779.324) -- 0:00:09
841500 -- (-784.201) (-782.464) (-783.275) [-783.733] * [-779.056] (-782.709) (-778.762) (-780.436) -- 0:00:09
842000 -- (-781.980) (-783.146) (-779.035) [-778.968] * [-779.737] (-782.710) (-781.071) (-781.758) -- 0:00:09
842500 -- (-786.613) [-778.583] (-779.749) (-781.878) * (-777.824) (-780.214) (-780.566) [-781.952] -- 0:00:09
843000 -- (-784.879) [-781.506] (-780.031) (-781.147) * (-783.179) [-781.939] (-779.091) (-781.213) -- 0:00:09
843500 -- (-780.579) [-779.182] (-778.552) (-783.814) * (-780.665) (-781.014) (-778.844) [-783.563] -- 0:00:09
844000 -- [-780.584] (-779.211) (-779.842) (-782.245) * (-778.396) [-779.491] (-778.107) (-783.156) -- 0:00:09
844500 -- (-779.655) (-778.599) [-779.518] (-782.073) * (-781.470) (-782.924) (-778.255) [-778.346] -- 0:00:09
845000 -- [-779.873] (-778.911) (-781.781) (-784.279) * (-777.808) (-781.368) (-779.277) [-779.147] -- 0:00:09
Average standard deviation of split frequencies: 0.008470
845500 -- (-778.939) (-778.165) (-780.468) [-778.186] * [-779.343] (-778.428) (-778.809) (-780.983) -- 0:00:09
846000 -- [-778.986] (-782.388) (-779.390) (-779.997) * (-782.062) [-779.680] (-779.087) (-779.087) -- 0:00:09
846500 -- (-779.442) [-780.101] (-779.673) (-779.105) * [-777.977] (-777.915) (-783.497) (-777.767) -- 0:00:09
847000 -- [-779.804] (-780.942) (-778.235) (-779.205) * (-778.147) (-780.395) [-781.155] (-780.009) -- 0:00:09
847500 -- (-779.452) (-779.488) (-778.594) [-779.764] * (-778.164) (-778.003) [-779.064] (-778.413) -- 0:00:08
848000 -- (-779.765) (-786.512) [-780.007] (-781.865) * [-777.734] (-783.152) (-779.882) (-779.555) -- 0:00:08
848500 -- (-781.353) (-782.012) (-778.098) [-780.075] * [-780.073] (-778.642) (-784.559) (-781.030) -- 0:00:08
849000 -- (-782.352) (-782.377) [-779.156] (-778.929) * [-778.411] (-780.669) (-782.073) (-785.607) -- 0:00:08
849500 -- [-779.430] (-780.816) (-780.822) (-782.135) * (-781.768) [-778.671] (-779.393) (-784.128) -- 0:00:08
850000 -- (-779.431) (-780.423) [-779.214] (-779.386) * (-781.966) [-782.161] (-779.468) (-784.994) -- 0:00:08
Average standard deviation of split frequencies: 0.008571
850500 -- (-779.863) (-780.184) (-778.477) [-779.527] * [-781.462] (-781.874) (-783.090) (-779.966) -- 0:00:08
851000 -- (-779.896) (-780.034) (-784.301) [-783.658] * (-782.366) (-782.227) [-780.021] (-779.711) -- 0:00:08
851500 -- (-779.618) [-781.600] (-777.938) (-783.657) * [-781.815] (-783.270) (-778.716) (-779.522) -- 0:00:08
852000 -- (-780.311) (-780.578) [-779.538] (-780.348) * (-784.558) [-779.235] (-780.869) (-780.776) -- 0:00:08
852500 -- (-781.749) (-777.674) (-780.564) [-778.026] * (-780.819) (-780.032) [-780.736] (-780.067) -- 0:00:08
853000 -- [-783.251] (-778.890) (-779.005) (-778.123) * (-779.652) (-781.786) [-782.951] (-781.815) -- 0:00:08
853500 -- (-784.359) (-778.619) (-779.582) [-780.474] * (-779.877) (-780.077) [-781.620] (-781.536) -- 0:00:08
854000 -- (-781.433) [-779.076] (-779.615) (-780.988) * [-782.018] (-782.210) (-780.009) (-779.524) -- 0:00:08
854500 -- (-781.051) (-784.398) [-778.944] (-778.957) * [-781.207] (-779.509) (-779.677) (-780.601) -- 0:00:08
855000 -- (-778.890) (-779.237) (-780.070) [-779.426] * [-778.034] (-780.492) (-783.738) (-778.505) -- 0:00:08
Average standard deviation of split frequencies: 0.008444
855500 -- [-778.604] (-780.302) (-778.608) (-780.589) * [-777.921] (-780.370) (-780.330) (-781.498) -- 0:00:08
856000 -- (-779.179) (-778.980) (-778.521) [-783.420] * [-782.790] (-779.667) (-777.529) (-779.609) -- 0:00:08
856500 -- (-778.227) (-780.386) [-778.572] (-780.119) * [-778.979] (-782.893) (-778.852) (-780.486) -- 0:00:08
857000 -- (-778.712) (-778.268) (-778.382) [-779.207] * (-779.401) [-785.787] (-782.702) (-779.500) -- 0:00:08
857500 -- [-781.735] (-779.479) (-778.210) (-778.516) * (-781.510) (-778.245) [-779.961] (-778.184) -- 0:00:08
858000 -- (-781.143) (-781.095) [-778.086] (-779.227) * (-777.787) (-778.704) (-780.493) [-779.535] -- 0:00:08
858500 -- (-779.316) [-778.763] (-778.148) (-780.503) * [-777.502] (-786.792) (-779.947) (-779.645) -- 0:00:08
859000 -- (-777.804) (-778.513) [-778.710] (-780.575) * [-780.346] (-779.950) (-780.908) (-779.339) -- 0:00:08
859500 -- (-784.761) (-780.370) [-780.164] (-779.901) * [-780.226] (-780.909) (-782.187) (-780.809) -- 0:00:08
860000 -- [-781.079] (-781.668) (-783.313) (-779.313) * (-783.761) (-779.120) (-780.997) [-785.601] -- 0:00:08
Average standard deviation of split frequencies: 0.008471
860500 -- (-779.059) (-781.894) [-783.202] (-780.351) * [-779.352] (-779.481) (-779.241) (-779.707) -- 0:00:08
861000 -- (-778.284) (-779.771) [-780.405] (-780.952) * (-778.484) [-782.255] (-778.124) (-781.953) -- 0:00:08
861500 -- [-781.935] (-779.120) (-778.274) (-780.463) * (-777.427) [-779.077] (-778.988) (-779.978) -- 0:00:08
862000 -- (-781.015) (-780.567) (-777.909) [-782.302] * (-781.462) (-779.875) [-779.234] (-781.192) -- 0:00:08
862500 -- (-778.626) (-781.276) [-778.719] (-779.211) * (-780.672) [-781.105] (-778.455) (-779.012) -- 0:00:08
863000 -- (-780.104) [-780.226] (-782.155) (-781.659) * (-781.898) (-777.810) (-779.172) [-779.657] -- 0:00:08
863500 -- [-779.678] (-781.937) (-779.597) (-779.679) * (-782.279) (-777.897) (-781.023) [-780.964] -- 0:00:08
864000 -- (-778.010) (-780.313) (-778.820) [-781.808] * [-779.339] (-778.424) (-779.889) (-779.551) -- 0:00:08
864500 -- (-779.475) [-778.638] (-778.911) (-778.784) * [-781.326] (-777.491) (-780.088) (-781.241) -- 0:00:07
865000 -- [-780.555] (-779.763) (-778.220) (-780.751) * (-781.139) (-779.058) (-779.166) [-779.211] -- 0:00:07
Average standard deviation of split frequencies: 0.008093
865500 -- [-778.637] (-778.836) (-779.028) (-780.842) * (-782.798) (-778.721) [-778.627] (-783.024) -- 0:00:07
866000 -- [-779.404] (-779.968) (-780.425) (-778.507) * [-779.245] (-782.811) (-781.475) (-779.557) -- 0:00:07
866500 -- [-779.252] (-779.972) (-784.896) (-779.757) * (-780.484) (-778.740) (-781.445) [-780.377] -- 0:00:07
867000 -- (-780.309) (-780.509) [-783.969] (-779.507) * (-779.367) (-783.086) [-779.623] (-778.265) -- 0:00:07
867500 -- [-779.132] (-782.087) (-780.534) (-780.450) * (-778.182) [-779.962] (-778.854) (-779.046) -- 0:00:07
868000 -- (-779.011) [-782.957] (-779.396) (-779.005) * (-780.232) (-778.765) (-779.684) [-778.454] -- 0:00:07
868500 -- (-781.426) (-785.410) (-778.643) [-778.217] * (-779.969) (-778.700) [-780.300] (-779.800) -- 0:00:07
869000 -- (-778.600) (-778.796) [-779.357] (-777.632) * (-781.094) (-779.286) (-782.304) [-778.729] -- 0:00:07
869500 -- [-778.204] (-778.417) (-780.714) (-780.378) * (-780.629) [-779.733] (-781.766) (-779.514) -- 0:00:07
870000 -- [-777.616] (-782.687) (-781.833) (-783.690) * (-780.704) (-782.991) (-780.614) [-778.346] -- 0:00:07
Average standard deviation of split frequencies: 0.007616
870500 -- (-778.310) [-780.662] (-780.011) (-783.540) * (-779.968) (-780.989) (-780.098) [-778.434] -- 0:00:07
871000 -- [-777.700] (-780.230) (-783.838) (-779.977) * (-782.867) (-779.593) (-779.687) [-779.330] -- 0:00:07
871500 -- (-781.166) (-779.923) (-779.623) [-778.614] * (-786.324) [-779.477] (-781.531) (-781.821) -- 0:00:07
872000 -- (-778.925) (-780.776) [-778.671] (-781.250) * (-781.329) (-779.368) (-780.793) [-779.435] -- 0:00:07
872500 -- (-779.555) (-782.048) (-780.793) [-779.403] * (-779.626) (-781.694) (-778.082) [-781.425] -- 0:00:07
873000 -- (-778.032) (-781.634) (-779.559) [-778.823] * (-782.478) (-783.700) (-783.426) [-778.454] -- 0:00:07
873500 -- [-785.745] (-785.350) (-777.801) (-779.457) * (-780.016) (-781.611) [-779.435] (-779.829) -- 0:00:07
874000 -- [-782.204] (-785.878) (-779.566) (-781.007) * (-780.653) (-779.791) (-779.378) [-779.501] -- 0:00:07
874500 -- (-781.716) [-779.308] (-781.764) (-780.324) * (-779.497) (-779.150) [-778.361] (-779.667) -- 0:00:07
875000 -- (-784.544) [-783.003] (-782.637) (-778.577) * (-778.013) (-778.793) [-779.332] (-778.082) -- 0:00:07
Average standard deviation of split frequencies: 0.007366
875500 -- (-781.124) (-783.190) (-782.144) [-779.712] * (-781.007) (-779.598) (-779.816) [-779.382] -- 0:00:07
876000 -- (-781.944) (-784.473) (-780.065) [-780.006] * (-781.805) [-779.342] (-778.883) (-781.228) -- 0:00:07
876500 -- (-781.980) [-783.994] (-780.335) (-781.964) * (-781.238) [-779.347] (-778.010) (-779.897) -- 0:00:07
877000 -- (-778.319) (-781.057) [-779.264] (-778.484) * (-778.699) (-778.780) (-780.116) [-780.580] -- 0:00:07
877500 -- (-779.738) (-782.858) (-781.771) [-778.633] * (-783.568) (-778.666) [-780.135] (-779.880) -- 0:00:07
878000 -- [-780.379] (-781.975) (-781.052) (-779.535) * [-780.282] (-779.337) (-780.135) (-779.025) -- 0:00:07
878500 -- (-782.044) [-778.891] (-780.570) (-779.647) * (-782.636) [-781.659] (-779.215) (-779.209) -- 0:00:07
879000 -- [-778.963] (-783.879) (-780.595) (-780.389) * (-781.747) (-778.943) (-779.732) [-780.644] -- 0:00:07
879500 -- (-778.259) [-782.097] (-779.635) (-778.798) * [-779.083] (-778.855) (-778.972) (-778.338) -- 0:00:07
880000 -- (-779.137) (-779.215) [-784.780] (-780.441) * (-780.449) [-782.730] (-779.981) (-780.112) -- 0:00:07
Average standard deviation of split frequencies: 0.007628
880500 -- [-784.074] (-780.886) (-780.757) (-779.327) * [-778.054] (-780.476) (-778.707) (-780.262) -- 0:00:07
881000 -- [-784.663] (-780.173) (-782.150) (-782.107) * [-780.285] (-779.753) (-783.289) (-782.718) -- 0:00:07
881500 -- (-780.661) [-779.947] (-779.143) (-780.988) * [-780.719] (-781.150) (-778.544) (-784.180) -- 0:00:06
882000 -- (-781.227) (-780.768) [-779.481] (-778.093) * [-778.794] (-778.390) (-779.897) (-786.198) -- 0:00:06
882500 -- (-781.576) (-781.217) (-779.448) [-779.048] * (-779.129) (-778.652) [-779.840] (-781.506) -- 0:00:06
883000 -- (-779.520) [-777.934] (-778.357) (-780.551) * (-777.885) (-781.650) (-780.926) [-780.626] -- 0:00:06
883500 -- (-778.736) [-779.602] (-778.387) (-782.412) * (-779.921) [-781.251] (-777.723) (-780.003) -- 0:00:06
884000 -- (-778.339) [-779.049] (-782.320) (-780.986) * (-779.547) (-779.753) (-777.887) [-780.025] -- 0:00:06
884500 -- (-779.225) (-779.521) (-782.158) [-778.858] * [-779.484] (-778.661) (-784.765) (-779.872) -- 0:00:06
885000 -- [-778.047] (-778.445) (-781.559) (-779.261) * (-778.895) (-780.786) (-783.234) [-783.402] -- 0:00:06
Average standard deviation of split frequencies: 0.007482
885500 -- (-782.985) (-782.435) [-782.434] (-779.121) * (-780.497) [-783.481] (-782.954) (-781.765) -- 0:00:06
886000 -- (-780.413) (-785.361) (-781.448) [-778.967] * [-780.869] (-780.701) (-788.070) (-781.145) -- 0:00:06
886500 -- [-778.628] (-780.853) (-782.467) (-782.378) * (-781.046) [-781.386] (-791.518) (-777.770) -- 0:00:06
887000 -- (-778.220) [-780.982] (-779.817) (-781.273) * (-779.276) [-781.998] (-779.758) (-780.322) -- 0:00:06
887500 -- (-779.288) (-780.174) [-785.546] (-781.337) * (-778.868) (-778.752) [-779.921] (-779.645) -- 0:00:06
888000 -- (-779.193) [-778.655] (-780.404) (-779.192) * [-778.513] (-781.795) (-780.614) (-778.285) -- 0:00:06
888500 -- [-778.616] (-777.807) (-781.638) (-781.105) * (-778.555) (-779.814) [-777.718] (-777.839) -- 0:00:06
889000 -- (-778.661) (-780.184) [-781.826] (-779.506) * (-781.987) [-779.561] (-780.633) (-778.223) -- 0:00:06
889500 -- (-779.216) [-780.206] (-782.119) (-779.968) * (-779.834) [-778.696] (-780.831) (-778.213) -- 0:00:06
890000 -- (-781.423) [-779.800] (-779.186) (-782.657) * (-780.650) (-784.242) [-778.815] (-778.036) -- 0:00:06
Average standard deviation of split frequencies: 0.007509
890500 -- (-780.676) [-778.999] (-779.230) (-783.544) * (-778.392) (-779.092) [-780.993] (-779.988) -- 0:00:06
891000 -- (-782.313) [-779.420] (-778.204) (-781.765) * (-779.461) [-778.457] (-779.999) (-781.120) -- 0:00:06
891500 -- (-783.022) (-781.272) [-781.369] (-782.047) * (-778.233) [-777.797] (-780.769) (-782.264) -- 0:00:06
892000 -- [-779.120] (-781.086) (-779.172) (-780.878) * (-780.670) (-778.921) (-780.012) [-779.147] -- 0:00:06
892500 -- (-780.167) [-779.031] (-781.751) (-780.740) * (-779.596) [-781.945] (-779.122) (-779.736) -- 0:00:06
893000 -- [-777.949] (-777.926) (-781.282) (-781.464) * (-778.764) (-782.756) [-780.425] (-778.960) -- 0:00:06
893500 -- (-781.353) [-779.427] (-781.075) (-779.954) * (-779.860) [-780.170] (-778.245) (-780.041) -- 0:00:06
894000 -- (-781.519) (-778.456) (-778.399) [-778.647] * [-781.953] (-778.494) (-780.167) (-781.148) -- 0:00:06
894500 -- [-778.241] (-780.503) (-779.316) (-780.269) * [-783.153] (-779.981) (-780.511) (-782.555) -- 0:00:06
895000 -- [-779.283] (-778.929) (-778.528) (-779.792) * (-781.433) (-779.738) (-783.516) [-779.749] -- 0:00:06
Average standard deviation of split frequencies: 0.007267
895500 -- (-779.734) [-779.259] (-778.202) (-779.789) * (-782.606) (-780.171) [-782.422] (-781.447) -- 0:00:06
896000 -- [-778.344] (-779.651) (-778.202) (-779.776) * (-778.776) [-779.551] (-780.560) (-779.694) -- 0:00:06
896500 -- [-778.652] (-783.941) (-778.274) (-780.621) * (-779.980) [-778.277] (-777.701) (-780.758) -- 0:00:06
897000 -- (-779.928) [-783.182] (-778.120) (-779.231) * (-781.070) [-779.435] (-778.094) (-780.689) -- 0:00:06
897500 -- (-783.087) (-783.632) [-781.606] (-780.138) * (-781.111) (-778.400) (-782.167) [-779.208] -- 0:00:06
898000 -- (-780.789) [-781.076] (-778.534) (-783.593) * (-779.796) [-779.779] (-778.620) (-784.727) -- 0:00:06
898500 -- (-780.657) [-780.162] (-782.011) (-783.234) * (-778.565) (-779.559) (-779.445) [-779.225] -- 0:00:05
899000 -- (-780.344) (-783.132) (-780.217) [-779.851] * (-778.498) (-781.953) [-781.620] (-780.149) -- 0:00:05
899500 -- (-782.974) (-781.685) [-782.680] (-778.090) * [-780.510] (-778.057) (-786.136) (-780.843) -- 0:00:05
900000 -- (-779.148) [-779.777] (-781.568) (-781.548) * (-778.915) [-781.587] (-784.517) (-781.883) -- 0:00:05
Average standard deviation of split frequencies: 0.007524
900500 -- (-778.464) (-778.300) [-780.198] (-778.159) * (-778.976) (-780.071) (-783.562) [-780.326] -- 0:00:05
901000 -- (-779.360) [-779.913] (-779.367) (-779.099) * (-779.059) (-781.867) [-779.325] (-780.091) -- 0:00:05
901500 -- [-780.438] (-782.545) (-779.536) (-786.182) * (-778.927) (-777.905) [-779.623] (-778.758) -- 0:00:05
902000 -- (-781.182) (-781.104) (-782.256) [-781.695] * (-781.626) (-778.640) [-781.248] (-781.257) -- 0:00:05
902500 -- (-778.250) [-778.376] (-782.751) (-778.990) * [-780.819] (-778.496) (-781.082) (-780.882) -- 0:00:05
903000 -- (-779.893) (-777.577) [-779.275] (-780.446) * (-780.171) [-779.282] (-783.195) (-778.304) -- 0:00:05
903500 -- (-781.467) (-780.803) [-780.713] (-777.897) * (-778.788) (-779.660) [-779.067] (-780.201) -- 0:00:05
904000 -- (-788.023) (-781.081) (-778.223) [-778.451] * (-778.557) (-779.933) [-781.094] (-783.528) -- 0:00:05
904500 -- (-780.122) [-779.986] (-781.874) (-781.379) * (-782.185) (-778.525) (-779.155) [-784.914] -- 0:00:05
905000 -- (-778.149) (-779.758) (-780.344) [-778.967] * (-782.037) (-779.009) (-778.347) [-780.439] -- 0:00:05
Average standard deviation of split frequencies: 0.008065
905500 -- (-778.941) (-778.935) (-780.569) [-780.137] * [-780.223] (-778.728) (-779.806) (-783.479) -- 0:00:05
906000 -- (-783.596) (-778.626) [-782.056] (-780.579) * [-781.860] (-779.326) (-780.796) (-784.584) -- 0:00:05
906500 -- [-780.864] (-778.136) (-781.141) (-778.382) * (-779.897) (-788.331) [-781.152] (-782.131) -- 0:00:05
907000 -- [-781.530] (-778.699) (-781.344) (-778.560) * [-780.219] (-780.981) (-783.582) (-779.468) -- 0:00:05
907500 -- (-779.766) [-779.510] (-778.517) (-785.063) * [-778.706] (-783.778) (-780.714) (-779.591) -- 0:00:05
908000 -- (-781.905) (-780.878) (-778.790) [-778.797] * (-778.227) [-782.614] (-778.708) (-779.079) -- 0:00:05
908500 -- [-778.921] (-784.035) (-781.085) (-779.969) * [-780.569] (-782.504) (-778.741) (-778.032) -- 0:00:05
909000 -- [-779.084] (-778.197) (-778.754) (-779.337) * (-780.641) [-779.489] (-779.661) (-780.685) -- 0:00:05
909500 -- [-779.490] (-780.486) (-779.504) (-781.053) * (-781.329) (-778.708) [-778.756] (-780.386) -- 0:00:05
910000 -- (-778.672) [-779.474] (-779.562) (-787.820) * [-780.761] (-778.590) (-780.244) (-778.139) -- 0:00:05
Average standard deviation of split frequencies: 0.008185
910500 -- (-778.709) (-781.074) (-781.424) [-786.398] * (-779.761) (-779.451) (-778.890) [-779.353] -- 0:00:05
911000 -- (-778.342) (-784.543) [-780.175] (-785.616) * [-780.422] (-778.781) (-780.181) (-778.822) -- 0:00:05
911500 -- (-779.889) [-780.487] (-778.781) (-783.672) * (-781.037) (-779.838) [-783.281] (-779.613) -- 0:00:05
912000 -- [-780.868] (-778.944) (-779.574) (-779.128) * (-780.557) [-780.200] (-782.885) (-778.137) -- 0:00:05
912500 -- (-781.303) (-783.297) [-777.813] (-781.733) * (-781.873) (-780.037) (-783.563) [-777.877] -- 0:00:05
913000 -- (-778.191) (-780.093) (-778.541) [-777.950] * (-783.544) [-777.755] (-782.944) (-779.573) -- 0:00:05
913500 -- (-778.931) (-778.720) (-779.161) [-779.107] * (-780.069) (-785.377) [-779.923] (-778.331) -- 0:00:05
914000 -- (-778.267) (-780.354) [-779.097] (-778.352) * (-779.257) (-781.401) (-778.571) [-778.502] -- 0:00:05
914500 -- (-778.586) (-780.019) (-779.429) [-778.104] * [-779.321] (-781.804) (-790.784) (-782.409) -- 0:00:05
915000 -- [-778.287] (-780.827) (-783.537) (-778.001) * (-781.777) (-778.594) (-779.148) [-783.494] -- 0:00:05
Average standard deviation of split frequencies: 0.007912
915500 -- (-782.996) (-778.496) [-778.702] (-778.712) * (-781.129) (-781.900) (-778.616) [-780.445] -- 0:00:04
916000 -- (-779.900) (-781.964) (-780.285) [-778.485] * (-779.474) [-782.322] (-781.759) (-778.590) -- 0:00:04
916500 -- (-780.433) [-779.487] (-778.926) (-779.205) * [-781.502] (-781.216) (-778.480) (-780.485) -- 0:00:04
917000 -- [-778.939] (-781.656) (-780.194) (-778.017) * (-780.326) (-780.213) [-778.533] (-781.587) -- 0:00:04
917500 -- (-779.127) (-782.967) [-787.874] (-780.062) * [-779.690] (-782.331) (-780.130) (-780.697) -- 0:00:04
918000 -- (-780.173) (-779.158) [-782.418] (-777.758) * (-778.173) (-779.589) (-778.554) [-778.589] -- 0:00:04
918500 -- (-779.364) [-780.128] (-779.350) (-777.590) * [-779.599] (-779.166) (-778.238) (-783.164) -- 0:00:04
919000 -- (-781.816) (-778.351) [-780.391] (-779.311) * [-781.777] (-778.387) (-778.622) (-781.757) -- 0:00:04
919500 -- [-779.849] (-779.407) (-781.033) (-779.258) * (-779.283) [-780.154] (-782.783) (-782.502) -- 0:00:04
920000 -- (-778.762) (-778.350) (-778.620) [-784.243] * (-780.793) (-780.812) [-780.728] (-783.195) -- 0:00:04
Average standard deviation of split frequencies: 0.007648
920500 -- (-777.740) [-778.365] (-778.371) (-778.398) * (-782.675) (-778.439) (-779.977) [-781.348] -- 0:00:04
921000 -- (-778.855) (-779.300) (-780.067) [-783.247] * [-780.981] (-778.566) (-779.742) (-777.993) -- 0:00:04
921500 -- (-778.294) (-780.494) (-779.027) [-781.583] * (-783.738) (-781.196) [-779.403] (-779.485) -- 0:00:04
922000 -- [-779.520] (-781.948) (-781.876) (-779.378) * (-778.840) [-780.370] (-778.926) (-778.847) -- 0:00:04
922500 -- (-777.582) [-782.479] (-791.514) (-780.948) * (-778.340) (-781.457) [-780.953] (-779.174) -- 0:00:04
923000 -- [-780.273] (-779.601) (-787.317) (-783.055) * (-781.220) [-783.449] (-782.362) (-778.402) -- 0:00:04
923500 -- (-782.809) [-778.756] (-779.135) (-778.648) * (-781.042) (-782.136) (-780.943) [-779.708] -- 0:00:04
924000 -- (-781.460) (-780.074) (-779.048) [-778.504] * (-783.517) (-780.075) [-780.256] (-779.033) -- 0:00:04
924500 -- [-781.347] (-778.463) (-779.038) (-780.388) * [-782.002] (-780.791) (-779.948) (-780.759) -- 0:00:04
925000 -- (-778.785) [-779.636] (-779.238) (-780.754) * (-779.940) (-779.467) [-777.752] (-779.458) -- 0:00:04
Average standard deviation of split frequencies: 0.007891
925500 -- (-777.722) [-779.977] (-778.810) (-779.745) * [-779.981] (-779.847) (-779.308) (-780.339) -- 0:00:04
926000 -- [-781.005] (-781.641) (-779.276) (-782.748) * (-779.998) (-780.740) [-777.640] (-780.790) -- 0:00:04
926500 -- (-780.861) (-779.488) (-781.840) [-778.274] * (-778.649) (-781.663) [-780.007] (-781.047) -- 0:00:04
927000 -- [-781.182] (-779.687) (-780.468) (-778.385) * (-780.125) [-783.500] (-781.034) (-778.646) -- 0:00:04
927500 -- (-779.486) (-781.804) (-782.573) [-777.960] * (-779.200) (-781.713) [-782.092] (-779.663) -- 0:00:04
928000 -- (-786.999) (-778.525) [-779.882] (-777.905) * (-780.048) [-779.554] (-782.518) (-780.350) -- 0:00:04
928500 -- (-783.941) (-778.525) (-781.328) [-779.296] * [-780.475] (-781.537) (-781.545) (-781.076) -- 0:00:04
929000 -- (-781.092) [-779.780] (-778.807) (-782.926) * (-778.752) (-780.094) [-781.483] (-778.258) -- 0:00:04
929500 -- (-781.388) (-780.323) [-784.660] (-782.005) * [-778.731] (-778.772) (-778.095) (-779.081) -- 0:00:04
930000 -- (-779.103) [-781.088] (-780.769) (-782.417) * (-778.345) [-779.037] (-779.668) (-777.728) -- 0:00:04
Average standard deviation of split frequencies: 0.008104
930500 -- [-778.705] (-785.746) (-777.971) (-777.917) * [-780.362] (-779.761) (-779.603) (-779.712) -- 0:00:04
931000 -- (-778.924) (-782.537) [-782.704] (-779.855) * (-785.293) [-777.835] (-779.022) (-779.113) -- 0:00:04
931500 -- (-779.246) (-779.512) [-779.302] (-782.418) * (-782.303) [-779.676] (-780.558) (-782.785) -- 0:00:04
932000 -- (-778.856) (-778.380) (-779.270) [-781.390] * (-783.268) [-780.832] (-781.205) (-781.870) -- 0:00:04
932500 -- (-777.784) (-778.628) (-778.388) [-783.221] * (-781.501) [-780.163] (-781.077) (-779.500) -- 0:00:03
933000 -- (-779.066) (-779.276) [-784.920] (-784.187) * (-780.389) (-778.847) (-778.901) [-778.537] -- 0:00:03
933500 -- (-781.109) [-778.974] (-780.515) (-781.216) * (-779.947) (-779.309) (-778.316) [-779.055] -- 0:00:03
934000 -- (-783.276) [-778.663] (-779.632) (-781.181) * (-787.410) (-783.296) (-780.525) [-780.167] -- 0:00:03
934500 -- (-783.376) [-780.917] (-778.727) (-781.195) * (-790.706) (-778.083) [-780.099] (-782.271) -- 0:00:03
935000 -- (-780.431) (-780.414) (-782.426) [-779.498] * (-781.305) (-778.071) [-777.718] (-782.916) -- 0:00:03
Average standard deviation of split frequencies: 0.008090
935500 -- (-779.479) (-782.562) (-778.775) [-780.060] * (-780.987) (-779.069) [-780.242] (-783.826) -- 0:00:03
936000 -- [-778.719] (-779.918) (-780.886) (-779.449) * (-778.376) [-778.864] (-781.612) (-786.771) -- 0:00:03
936500 -- (-783.093) [-778.542] (-779.523) (-779.232) * (-778.841) (-782.760) (-782.084) [-780.342] -- 0:00:03
937000 -- (-781.362) (-777.716) (-779.201) [-779.254] * (-779.573) [-782.229] (-782.480) (-784.189) -- 0:00:03
937500 -- (-779.347) [-778.723] (-780.260) (-779.287) * [-779.532] (-779.983) (-788.220) (-780.993) -- 0:00:03
938000 -- (-781.003) (-780.061) [-778.063] (-780.072) * [-783.083] (-785.872) (-785.891) (-781.853) -- 0:00:03
938500 -- (-785.122) (-779.013) [-779.210] (-779.584) * (-780.239) (-782.306) (-783.355) [-778.618] -- 0:00:03
939000 -- (-783.022) [-778.378] (-779.289) (-780.380) * [-779.876] (-783.714) (-780.559) (-778.573) -- 0:00:03
939500 -- (-782.076) (-779.210) (-778.021) [-782.341] * (-779.407) [-781.764] (-782.691) (-777.812) -- 0:00:03
940000 -- [-777.844] (-780.164) (-780.598) (-782.763) * (-778.743) (-779.605) [-779.413] (-781.473) -- 0:00:03
Average standard deviation of split frequencies: 0.008175
940500 -- (-780.416) (-784.671) (-779.666) [-779.883] * (-780.254) (-779.638) (-782.482) [-778.240] -- 0:00:03
941000 -- (-778.912) (-782.385) [-780.480] (-778.542) * (-780.025) (-785.888) (-779.585) [-782.478] -- 0:00:03
941500 -- (-782.494) (-780.047) [-779.365] (-778.101) * [-778.292] (-780.445) (-781.271) (-780.212) -- 0:00:03
942000 -- (-780.389) (-780.409) [-780.655] (-778.143) * (-780.443) (-781.605) [-779.364] (-780.523) -- 0:00:03
942500 -- (-782.551) [-779.054] (-788.751) (-779.129) * [-780.052] (-783.595) (-782.588) (-779.905) -- 0:00:03
943000 -- (-781.654) (-781.479) (-779.324) [-781.426] * (-781.146) (-785.680) [-779.218] (-780.271) -- 0:00:03
943500 -- [-781.288] (-780.404) (-779.781) (-780.390) * [-779.508] (-782.008) (-778.935) (-779.702) -- 0:00:03
944000 -- (-777.873) [-780.767] (-779.405) (-779.964) * (-782.319) [-780.463] (-779.855) (-778.753) -- 0:00:03
944500 -- (-777.981) (-778.666) [-778.895] (-780.301) * (-778.668) (-779.296) (-778.621) [-779.653] -- 0:00:03
945000 -- (-778.601) (-780.943) (-780.489) [-780.136] * (-778.697) (-779.368) [-778.909] (-780.691) -- 0:00:03
Average standard deviation of split frequencies: 0.007973
945500 -- (-778.883) (-778.394) [-779.053] (-777.931) * (-778.845) (-779.072) [-778.658] (-780.422) -- 0:00:03
946000 -- [-778.662] (-780.398) (-780.017) (-783.222) * (-779.382) [-781.473] (-779.589) (-780.477) -- 0:00:03
946500 -- (-780.304) (-781.078) (-778.634) [-779.236] * (-779.049) (-781.731) [-780.904] (-780.551) -- 0:00:03
947000 -- (-779.146) [-778.416] (-779.396) (-778.579) * (-781.241) [-780.719] (-780.547) (-780.747) -- 0:00:03
947500 -- (-779.294) [-779.360] (-779.523) (-778.599) * (-784.550) (-779.888) (-779.941) [-784.301] -- 0:00:03
948000 -- [-779.288] (-778.787) (-782.044) (-778.332) * [-778.399] (-778.754) (-784.079) (-781.834) -- 0:00:03
948500 -- (-779.413) (-778.071) [-778.107] (-781.817) * (-778.240) (-782.203) (-780.887) [-779.229] -- 0:00:03
949000 -- [-780.715] (-780.228) (-782.022) (-781.585) * (-778.381) (-780.936) [-780.092] (-780.798) -- 0:00:03
949500 -- (-782.090) (-782.838) [-778.671] (-781.480) * (-780.269) [-782.572] (-780.897) (-780.705) -- 0:00:02
950000 -- (-787.057) (-779.656) [-780.050] (-784.848) * (-781.567) [-781.796] (-779.168) (-778.057) -- 0:00:02
Average standard deviation of split frequencies: 0.008058
950500 -- (-777.671) (-779.619) [-785.145] (-780.029) * [-778.504] (-782.337) (-781.570) (-777.694) -- 0:00:02
951000 -- (-777.518) (-779.686) [-783.930] (-780.888) * (-777.940) (-780.112) [-780.013] (-781.408) -- 0:00:02
951500 -- (-779.021) (-778.169) (-783.568) [-778.122] * [-783.308] (-782.599) (-786.557) (-782.489) -- 0:00:02
952000 -- (-780.559) (-780.070) [-780.570] (-780.611) * (-779.844) (-778.391) [-782.662] (-781.564) -- 0:00:02
952500 -- (-779.888) [-778.169] (-780.973) (-780.045) * [-778.806] (-784.634) (-784.612) (-778.732) -- 0:00:02
953000 -- (-779.099) (-779.211) (-783.961) [-780.240] * [-779.523] (-779.094) (-785.612) (-780.685) -- 0:00:02
953500 -- (-779.045) (-777.822) (-781.483) [-779.403] * [-779.025] (-782.413) (-781.261) (-781.544) -- 0:00:02
954000 -- (-778.827) (-778.034) (-783.354) [-777.880] * (-781.425) [-781.116] (-780.134) (-779.827) -- 0:00:02
954500 -- (-778.429) (-781.040) [-781.517] (-783.308) * (-780.884) (-778.519) [-780.725] (-778.019) -- 0:00:02
955000 -- (-778.980) [-782.256] (-782.846) (-777.846) * [-778.381] (-781.259) (-779.701) (-778.100) -- 0:00:02
Average standard deviation of split frequencies: 0.008013
955500 -- [-778.582] (-781.744) (-779.226) (-778.101) * (-778.945) (-778.293) (-779.186) [-779.935] -- 0:00:02
956000 -- (-779.194) (-778.763) (-780.256) [-780.382] * [-779.901] (-779.005) (-781.312) (-778.752) -- 0:00:02
956500 -- (-779.052) (-779.976) [-779.637] (-783.948) * [-778.583] (-783.977) (-779.737) (-781.352) -- 0:00:02
957000 -- (-784.452) (-778.658) [-779.636] (-780.219) * (-780.513) (-779.757) (-779.956) [-780.604] -- 0:00:02
957500 -- [-779.271] (-779.692) (-782.868) (-782.759) * [-780.230] (-779.305) (-778.606) (-779.571) -- 0:00:02
958000 -- (-782.272) (-778.769) [-782.465] (-781.928) * (-783.027) (-780.907) (-778.091) [-780.102] -- 0:00:02
958500 -- (-779.695) [-778.996] (-777.814) (-780.875) * (-780.237) [-778.785] (-783.630) (-780.751) -- 0:00:02
959000 -- [-781.329] (-779.022) (-778.308) (-781.671) * (-781.358) [-778.392] (-785.424) (-780.689) -- 0:00:02
959500 -- (-781.922) (-781.963) (-778.492) [-779.609] * (-781.122) (-780.205) [-780.214] (-777.917) -- 0:00:02
960000 -- [-781.596] (-784.968) (-780.404) (-780.967) * (-781.390) (-780.405) (-779.697) [-779.872] -- 0:00:02
Average standard deviation of split frequencies: 0.008434
960500 -- (-781.445) (-779.143) (-777.687) [-779.703] * (-778.286) (-781.370) [-780.164] (-778.489) -- 0:00:02
961000 -- (-780.780) [-779.140] (-778.706) (-778.658) * (-779.767) (-781.106) [-779.584] (-778.630) -- 0:00:02
961500 -- (-778.810) (-778.832) (-777.876) [-778.680] * (-779.034) (-781.063) (-778.160) [-778.434] -- 0:00:02
962000 -- (-780.901) (-778.582) [-780.023] (-779.660) * (-778.638) (-780.006) (-780.434) [-779.404] -- 0:00:02
962500 -- (-780.139) (-778.552) (-780.126) [-778.509] * [-779.216] (-781.209) (-780.753) (-780.711) -- 0:00:02
963000 -- (-779.415) (-779.286) (-779.058) [-778.200] * (-779.996) [-778.070] (-780.425) (-781.380) -- 0:00:02
963500 -- (-777.874) (-778.760) (-781.343) [-781.850] * (-785.724) (-779.643) (-781.536) [-777.728] -- 0:00:02
964000 -- (-778.130) (-778.841) (-779.043) [-780.485] * (-779.861) (-778.717) (-778.821) [-778.512] -- 0:00:02
964500 -- [-777.836] (-778.509) (-779.494) (-780.602) * (-782.553) (-778.560) (-787.086) [-779.347] -- 0:00:02
965000 -- (-779.896) (-780.246) [-779.327] (-786.255) * (-781.066) (-779.001) [-781.031] (-779.447) -- 0:00:02
Average standard deviation of split frequencies: 0.008631
965500 -- (-778.455) (-779.718) [-778.114] (-779.098) * (-778.820) (-782.867) [-780.452] (-784.513) -- 0:00:02
966000 -- (-779.465) (-778.623) (-778.748) [-780.135] * (-779.699) (-781.292) [-779.899] (-783.141) -- 0:00:02
966500 -- [-778.162] (-778.151) (-778.288) (-778.373) * (-778.917) (-778.796) (-781.581) [-781.567] -- 0:00:01
967000 -- (-781.048) (-779.663) [-777.705] (-781.851) * (-778.304) (-778.988) [-778.455] (-782.178) -- 0:00:01
967500 -- (-785.578) (-780.072) (-780.114) [-780.411] * [-781.503] (-780.314) (-784.613) (-785.710) -- 0:00:01
968000 -- (-780.206) [-780.251] (-778.256) (-778.829) * (-779.115) [-781.509] (-784.427) (-784.541) -- 0:00:01
968500 -- (-779.988) (-778.871) (-779.806) [-779.861] * [-779.882] (-779.323) (-782.078) (-781.294) -- 0:00:01
969000 -- (-782.431) (-780.430) (-778.934) [-779.492] * (-781.139) (-779.451) (-782.944) [-778.297] -- 0:00:01
969500 -- (-782.881) [-779.041] (-778.939) (-780.278) * [-778.973] (-781.910) (-778.850) (-779.235) -- 0:00:01
970000 -- (-782.492) (-781.587) (-781.564) [-778.970] * (-778.887) (-782.650) [-778.817] (-779.039) -- 0:00:01
Average standard deviation of split frequencies: 0.008135
970500 -- (-784.304) [-778.721] (-779.879) (-779.156) * (-780.072) (-779.581) (-778.462) [-779.943] -- 0:00:01
971000 -- (-780.529) [-778.415] (-779.689) (-780.622) * (-781.817) (-777.913) [-777.887] (-789.022) -- 0:00:01
971500 -- (-779.754) (-778.035) (-781.924) [-781.373] * (-779.470) (-783.286) [-778.270] (-782.559) -- 0:00:01
972000 -- [-781.442] (-778.811) (-779.923) (-780.043) * [-779.893] (-779.537) (-781.086) (-785.389) -- 0:00:01
972500 -- (-784.968) [-777.509] (-781.206) (-779.207) * (-783.109) [-778.395] (-779.606) (-781.801) -- 0:00:01
973000 -- [-782.035] (-779.458) (-778.767) (-780.615) * (-779.977) (-781.145) (-779.026) [-782.190] -- 0:00:01
973500 -- (-781.553) (-778.498) (-779.363) [-781.774] * (-782.974) [-779.306] (-779.434) (-780.260) -- 0:00:01
974000 -- [-779.216] (-778.402) (-778.249) (-778.097) * (-784.271) (-781.205) [-778.638] (-779.212) -- 0:00:01
974500 -- (-783.442) (-780.457) (-779.149) [-778.216] * (-783.379) (-780.343) (-778.492) [-778.804] -- 0:00:01
975000 -- (-783.818) (-778.886) [-782.195] (-781.117) * (-781.074) [-778.059] (-778.669) (-778.794) -- 0:00:01
Average standard deviation of split frequencies: 0.008060
975500 -- (-782.572) (-782.133) [-780.230] (-779.549) * [-781.806] (-779.090) (-784.025) (-779.609) -- 0:00:01
976000 -- (-782.063) (-779.664) [-780.561] (-777.940) * (-778.864) (-782.262) (-781.625) [-786.252] -- 0:00:01
976500 -- (-779.962) (-777.518) [-779.516] (-780.418) * (-781.705) (-780.333) [-782.545] (-778.473) -- 0:00:01
977000 -- (-779.229) (-778.012) [-777.865] (-779.174) * (-778.757) (-781.635) (-780.133) [-779.128] -- 0:00:01
977500 -- (-781.647) [-779.170] (-779.677) (-780.276) * (-777.823) (-781.107) (-781.229) [-779.994] -- 0:00:01
978000 -- (-780.370) (-778.536) (-780.987) [-779.679] * (-780.198) (-779.443) (-779.380) [-778.927] -- 0:00:01
978500 -- (-778.851) (-778.445) [-782.098] (-781.406) * [-779.770] (-779.734) (-779.419) (-781.099) -- 0:00:01
979000 -- [-778.072] (-778.756) (-783.629) (-778.995) * (-780.933) (-779.307) (-781.781) [-778.464] -- 0:00:01
979500 -- (-781.968) (-779.045) [-778.534] (-781.412) * (-781.078) (-778.587) [-778.500] (-780.736) -- 0:00:01
980000 -- (-778.910) [-778.334] (-782.587) (-780.286) * (-778.841) (-780.916) [-779.138] (-780.881) -- 0:00:01
Average standard deviation of split frequencies: 0.008562
980500 -- (-778.068) (-779.977) (-781.370) [-778.377] * (-778.826) [-779.838] (-784.159) (-784.322) -- 0:00:01
981000 -- (-781.169) [-779.211] (-778.454) (-780.855) * (-783.334) (-781.794) [-781.366] (-779.374) -- 0:00:01
981500 -- (-786.985) (-779.121) (-779.999) [-779.990] * (-778.953) (-782.190) (-779.622) [-778.788] -- 0:00:01
982000 -- (-783.656) (-778.147) (-778.779) [-780.524] * (-777.882) (-780.734) (-785.306) [-778.057] -- 0:00:01
982500 -- (-779.218) (-778.697) (-779.695) [-779.792] * (-780.060) (-780.484) (-780.709) [-779.280] -- 0:00:01
983000 -- (-781.461) (-779.500) (-779.027) [-779.111] * (-781.605) [-780.989] (-778.920) (-779.990) -- 0:00:01
983500 -- (-780.230) (-779.241) (-780.791) [-778.515] * [-782.299] (-779.077) (-780.549) (-779.232) -- 0:00:00
984000 -- (-781.252) (-778.092) (-778.171) [-780.056] * (-782.293) (-777.838) [-779.391] (-779.065) -- 0:00:00
984500 -- (-779.238) [-778.910] (-778.197) (-784.783) * (-778.350) [-779.627] (-778.328) (-781.906) -- 0:00:00
985000 -- (-779.064) (-780.516) [-780.088] (-781.781) * (-777.904) (-779.881) (-780.933) [-781.399] -- 0:00:00
Average standard deviation of split frequencies: 0.008397
985500 -- (-780.665) [-781.675] (-779.723) (-781.623) * (-778.586) (-779.307) [-781.745] (-781.332) -- 0:00:00
986000 -- [-778.815] (-780.914) (-779.242) (-780.808) * (-779.310) [-780.071] (-777.733) (-781.229) -- 0:00:00
986500 -- (-782.482) [-779.606] (-780.245) (-779.336) * (-785.696) (-779.805) (-777.733) [-779.899] -- 0:00:00
987000 -- (-782.540) [-780.679] (-781.380) (-778.206) * (-785.025) (-782.059) [-778.107] (-780.765) -- 0:00:00
987500 -- (-780.966) (-781.436) (-778.949) [-778.236] * (-782.895) (-781.822) [-779.086] (-781.762) -- 0:00:00
988000 -- (-778.480) [-779.427] (-778.157) (-783.296) * (-778.759) [-781.737] (-779.915) (-784.351) -- 0:00:00
988500 -- (-778.602) (-780.430) (-780.151) [-781.975] * (-779.339) [-782.871] (-781.221) (-783.320) -- 0:00:00
989000 -- (-779.968) [-778.997] (-779.665) (-782.202) * (-779.683) (-782.723) (-779.952) [-783.077] -- 0:00:00
989500 -- (-782.721) [-778.753] (-778.147) (-779.638) * [-779.452] (-779.083) (-784.754) (-778.215) -- 0:00:00
990000 -- [-780.567] (-779.610) (-778.522) (-780.332) * [-783.185] (-779.355) (-782.506) (-780.217) -- 0:00:00
Average standard deviation of split frequencies: 0.008565
990500 -- [-779.465] (-783.106) (-782.527) (-780.307) * (-781.458) [-780.913] (-777.607) (-779.858) -- 0:00:00
991000 -- (-778.757) (-781.061) [-782.315] (-781.528) * [-779.079] (-781.158) (-777.659) (-780.349) -- 0:00:00
991500 -- (-777.840) (-781.120) [-778.598] (-783.839) * (-779.163) (-782.751) (-777.659) [-779.074] -- 0:00:00
992000 -- (-778.749) (-778.716) (-779.723) [-777.865] * (-781.636) [-779.332] (-782.949) (-780.497) -- 0:00:00
992500 -- [-779.465] (-779.256) (-779.390) (-779.001) * (-782.288) (-778.837) (-780.767) [-779.083] -- 0:00:00
993000 -- (-779.233) (-778.188) [-779.820] (-778.859) * (-779.528) (-780.075) [-779.629] (-781.034) -- 0:00:00
993500 -- (-781.270) (-780.330) (-778.755) [-778.450] * (-780.456) [-778.796] (-789.129) (-779.948) -- 0:00:00
994000 -- (-778.560) (-782.765) (-781.169) [-779.339] * (-781.774) (-781.172) (-786.216) [-780.247] -- 0:00:00
994500 -- [-783.260] (-780.095) (-781.162) (-779.598) * (-778.278) [-779.895] (-778.213) (-780.037) -- 0:00:00
995000 -- (-778.115) [-782.336] (-784.400) (-779.631) * (-779.462) (-778.162) [-777.804] (-779.399) -- 0:00:00
Average standard deviation of split frequencies: 0.008519
995500 -- [-778.961] (-780.012) (-780.667) (-779.963) * (-779.830) [-779.319] (-779.155) (-779.214) -- 0:00:00
996000 -- (-780.969) (-785.644) [-780.549] (-782.075) * (-780.251) (-779.999) (-780.462) [-779.633] -- 0:00:00
996500 -- (-779.041) (-778.605) [-783.658] (-779.265) * (-778.237) (-784.378) [-778.416] (-786.079) -- 0:00:00
997000 -- (-778.820) [-778.473] (-782.593) (-780.565) * [-778.191] (-779.720) (-777.705) (-780.997) -- 0:00:00
997500 -- [-779.777] (-782.352) (-780.084) (-781.275) * [-779.584] (-782.269) (-779.759) (-782.358) -- 0:00:00
998000 -- (-780.592) (-781.011) (-779.839) [-782.028] * (-781.090) (-780.553) (-778.613) [-779.591] -- 0:00:00
998500 -- (-779.339) [-779.244] (-780.819) (-781.651) * (-779.851) (-780.521) (-780.730) [-779.949] -- 0:00:00
999000 -- (-781.902) [-782.430] (-778.676) (-779.929) * [-780.510] (-780.878) (-779.842) (-781.317) -- 0:00:00
999500 -- [-779.119] (-781.990) (-778.095) (-780.967) * (-778.185) (-785.780) [-779.485] (-780.100) -- 0:00:00
1000000 -- (-778.151) (-779.500) [-778.894] (-781.155) * [-777.771] (-784.455) (-779.413) (-778.684) -- 0:00:00
Average standard deviation of split frequencies: 0.008009
Analysis completed in 59 seconds
Analysis used 58.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -777.40
Likelihood of best state for "cold" chain of run 2 was -777.40
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.6 % ( 24 %) Dirichlet(Pi{all})
32.1 % ( 29 %) Slider(Pi{all})
78.4 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 59 %) Multiplier(Alpha{3})
23.0 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.0 % ( 23 %) Dirichlet(Pi{all})
31.2 % ( 30 %) Slider(Pi{all})
78.9 % ( 56 %) Multiplier(Alpha{1,2})
77.6 % ( 53 %) Multiplier(Alpha{3})
22.7 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 28 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.4 % ( 36 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166446 0.82 0.66
3 | 165942 167123 0.84
4 | 167051 166695 166743
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166635 0.82 0.66
3 | 166805 166721 0.84
4 | 166130 166336 167373
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -779.27
| 2 1 1 1 1 21 |
| 1 2 2 * |
| 2 2 1 1 2 1 1 1112 1 1 2 1 |
|2 2 22 2 1 2 2 * 22 1 |
| 2 2 2 2 2 2 1 1 |
| *1 12 11 2 2 1 2 * 1 1 1 2 2 2 2|
| 1 1 1* 1 2 1 2 2 1 |
| 1 1 22 1 2 1 2 2 2 21|
| 1 2 * 2 1 * 11 21 |
| 1 2 1 1 21 |
| 2 2 1 |
| 2 2 |
|1 2 |
| 1 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -780.92
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -779.10 -782.81
2 -779.13 -782.23
--------------------------------------
TOTAL -779.11 -782.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899324 0.091660 0.401275 1.546566 0.865214 1501.00 1501.00 1.000
r(A<->C){all} 0.155684 0.016981 0.000017 0.411864 0.120694 180.97 216.81 1.000
r(A<->G){all} 0.171941 0.020569 0.000109 0.460863 0.134891 158.88 245.51 1.007
r(A<->T){all} 0.178676 0.021870 0.000108 0.475011 0.139289 159.43 194.78 1.000
r(C<->G){all} 0.161240 0.017848 0.000075 0.433202 0.127880 255.77 258.89 1.000
r(C<->T){all} 0.162131 0.018752 0.000081 0.430800 0.127466 228.40 251.63 1.000
r(G<->T){all} 0.170329 0.019726 0.000158 0.449415 0.135381 214.13 263.99 1.006
pi(A){all} 0.195220 0.000276 0.162750 0.228088 0.194646 1319.78 1410.39 1.000
pi(C){all} 0.285208 0.000343 0.248631 0.321133 0.284861 1266.81 1288.42 1.000
pi(G){all} 0.316940 0.000377 0.278038 0.354335 0.316760 1351.69 1364.65 1.000
pi(T){all} 0.202633 0.000275 0.170005 0.234033 0.202213 1325.37 1370.90 1.000
alpha{1,2} 0.430766 0.238047 0.000121 1.413899 0.257750 1036.53 1146.74 1.000
alpha{3} 0.460990 0.232205 0.000818 1.435770 0.304065 1290.70 1327.21 1.000
pinvar{all} 0.997209 0.000013 0.991460 0.999999 0.998349 1171.33 1189.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...*.*
9 -- .*.*..
10 -- .***.*
11 -- .****.
12 -- ...**.
13 -- ..*.*.
14 -- ..****
15 -- ..**..
16 -- .*...*
17 -- ..*..*
18 -- .*..*.
19 -- .*.***
20 -- ....**
21 -- .**.**
22 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.010835 0.145903 0.161226 2
8 452 0.150566 0.001884 0.149234 0.151899 2
9 447 0.148901 0.010835 0.141239 0.156562 2
10 446 0.148568 0.002827 0.146569 0.150566 2
11 439 0.146236 0.006124 0.141905 0.150566 2
12 438 0.145903 0.008480 0.139907 0.151899 2
13 438 0.145903 0.013191 0.136576 0.155230 2
14 436 0.145237 0.009422 0.138574 0.151899 2
15 434 0.144570 0.005653 0.140573 0.148568 2
16 427 0.142239 0.002355 0.140573 0.143904 2
17 414 0.137908 0.000000 0.137908 0.137908 2
18 409 0.136243 0.004240 0.133245 0.139241 2
19 406 0.135243 0.012248 0.126582 0.143904 2
20 396 0.131912 0.020728 0.117255 0.146569 2
21 394 0.131246 0.008480 0.125250 0.137242 2
22 291 0.096935 0.010835 0.089274 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099411 0.009670 0.000002 0.303696 0.068145 1.000 2
length{all}[2] 0.099505 0.009866 0.000081 0.300307 0.068213 1.000 2
length{all}[3] 0.100868 0.010068 0.000060 0.299559 0.071387 1.000 2
length{all}[4] 0.097243 0.009603 0.000027 0.292996 0.068177 1.000 2
length{all}[5] 0.100119 0.009490 0.000020 0.291060 0.071489 1.000 2
length{all}[6] 0.102323 0.010480 0.000080 0.306120 0.071046 1.000 2
length{all}[7] 0.098845 0.009389 0.000085 0.289461 0.069229 0.998 2
length{all}[8] 0.097663 0.009676 0.000301 0.313532 0.069471 1.007 2
length{all}[9] 0.095015 0.008690 0.000131 0.271591 0.071920 1.002 2
length{all}[10] 0.090897 0.008290 0.000191 0.281031 0.056528 0.998 2
length{all}[11] 0.102168 0.009977 0.000372 0.293211 0.073259 0.998 2
length{all}[12] 0.091786 0.007344 0.000724 0.268272 0.064973 1.000 2
length{all}[13] 0.107060 0.010910 0.000137 0.313487 0.078221 1.002 2
length{all}[14] 0.103561 0.010826 0.000364 0.331313 0.070450 1.001 2
length{all}[15] 0.106243 0.011263 0.000231 0.313115 0.072236 1.002 2
length{all}[16] 0.100393 0.010776 0.000029 0.317419 0.067163 0.998 2
length{all}[17] 0.097796 0.010223 0.000508 0.287115 0.066961 0.998 2
length{all}[18] 0.095374 0.009521 0.000164 0.279803 0.064264 0.999 2
length{all}[19] 0.103512 0.011637 0.000140 0.303194 0.069510 1.003 2
length{all}[20] 0.096997 0.011953 0.000484 0.343176 0.061724 1.000 2
length{all}[21] 0.095606 0.009111 0.000108 0.296170 0.065961 0.998 2
length{all}[22] 0.099335 0.008978 0.000221 0.272050 0.071352 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008009
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 570
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 190 / 190 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 190 / 190 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050082 0.108868 0.097375 0.019155 0.016663 0.082740 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -814.605335
Iterating by ming2
Initial: fx= 814.605335
x= 0.05008 0.10887 0.09738 0.01915 0.01666 0.08274 0.30000 1.30000
1 h-m-p 0.0000 0.0001 455.3057 ++ 796.156586 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0103 37.2644 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 416.2092 ++ 793.852176 m 0.0000 44 | 2/8
4 h-m-p 0.0002 0.0124 31.1521 ----------.. | 2/8
5 h-m-p 0.0000 0.0002 371.5188 +++ 770.873979 m 0.0002 75 | 3/8
6 h-m-p 0.0022 0.0166 24.3539 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 322.9078 +++ 752.427187 m 0.0002 108 | 4/8
8 h-m-p 0.0030 0.0395 15.6178 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 264.9352 ++ 746.856117 m 0.0001 140 | 5/8
10 h-m-p 0.0015 0.1549 9.9055 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 187.6504 ++ 744.657224 m 0.0001 171 | 6/8
12 h-m-p 0.2215 8.0000 0.0000 +++ 744.657224 m 8.0000 183 | 6/8
13 h-m-p 0.0182 8.0000 0.0012 ----------C 744.657224 0 0.0000 206 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --Y 744.657224 0 0.0003 221 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 ---------C 744.657224 0 0.0000 243
Out..
lnL = -744.657224
244 lfun, 244 eigenQcodon, 1464 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076275 0.066650 0.084220 0.030994 0.025338 0.090325 0.299961 0.891446 0.546587
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.345544
np = 9
lnL0 = -813.753286
Iterating by ming2
Initial: fx= 813.753286
x= 0.07628 0.06665 0.08422 0.03099 0.02534 0.09033 0.29996 0.89145 0.54659
1 h-m-p 0.0000 0.0001 448.5462 ++ 786.004775 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 315.8493 ++ 780.779719 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0002 494.5362 ++ 755.535924 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0002 283.4756 ++ 748.599858 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 2373.3741 ++ 745.738389 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 69411.9461 ++ 744.657187 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 744.657187 m 8.0000 86 | 6/9
8 h-m-p 0.0153 7.6414 0.0909 --------C 744.657187 0 0.0000 109 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657187 m 8.0000 127 | 6/9
10 h-m-p 0.0050 2.4880 0.3024 ---------Y 744.657187 0 0.0000 151 | 6/9
11 h-m-p 0.0160 8.0000 0.0009 +++++ 744.657186 m 8.0000 169 | 6/9
12 h-m-p 0.0166 1.7538 0.4279 ------------C 744.657186 0 0.0000 196 | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657186 m 8.0000 214 | 6/9
14 h-m-p 0.0028 1.4236 0.4201 -------Y 744.657186 0 0.0000 236 | 6/9
15 h-m-p 0.0160 8.0000 0.0111 -------------.. | 6/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657186 m 8.0000 280 | 6/9
17 h-m-p 0.0074 3.6803 0.2665 ----------N 744.657186 0 0.0000 305 | 6/9
18 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657186 m 8.0000 323 | 6/9
19 h-m-p 0.0044 2.2189 0.5184 ---------C 744.657186 0 0.0000 347 | 6/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657186 m 8.0000 365 | 6/9
21 h-m-p 0.0014 0.4447 0.4623 +++++ 744.657183 m 0.4447 383 | 7/9
22 h-m-p 0.1222 0.6112 0.6528 ++ 744.657134 m 0.6112 398 | 8/9
23 h-m-p 0.6015 3.7624 0.2070 -------------Y 744.657134 0 0.0000 425 | 8/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657134 m 8.0000 441 | 8/9
25 h-m-p 0.0061 3.0377 0.2564 ---------Y 744.657134 0 0.0000 463 | 8/9
26 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
27 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657134 m 8.0000 503 | 8/9
28 h-m-p 0.0078 2.9771 0.2623 ----------C 744.657134 0 0.0000 526 | 8/9
29 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
30 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657133 m 8.0000 566 | 8/9
31 h-m-p 0.0079 2.9838 0.2624 ----------Y 744.657133 0 0.0000 589 | 8/9
32 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657133 m 8.0000 605 | 8/9
33 h-m-p 0.0060 2.9829 0.2625 ------------.. | 8/9
34 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657132 m 8.0000 644 | 8/9
35 h-m-p 0.0080 3.0179 0.2602 -----------Y 744.657132 0 0.0000 668 | 8/9
36 h-m-p 0.0160 8.0000 0.0000 --------C 744.657132 0 0.0000 689 | 8/9
37 h-m-p 0.0009 0.4330 1.8133 -----------.. | 8/9
38 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657132 m 8.0000 726 | 8/9
39 h-m-p 0.0001 0.0241 32.6441 ---------.. | 8/9
40 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657131 m 8.0000 761 | 8/9
41 h-m-p 0.0004 0.1311 6.0217 ----------.. | 8/9
42 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657131 m 8.0000 797 | 8/9
43 h-m-p 0.0169 6.3317 0.1250 -------------.. | 8/9
44 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657130 m 8.0000 837 | 8/9
45 h-m-p 0.0084 3.0839 0.2574 ---------Y 744.657130 0 0.0000 859 | 8/9
46 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657130 m 8.0000 875 | 8/9
47 h-m-p 0.0059 2.9505 0.2691 ----------Y 744.657130 0 0.0000 898 | 8/9
48 h-m-p 0.0160 8.0000 0.0000 -----Y 744.657130 0 0.0000 916 | 8/9
49 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
50 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657130 m 8.0000 956 | 8/9
51 h-m-p 0.0086 3.1380 0.2537 -------------.. | 8/9
52 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657129 m 8.0000 996 | 8/9
53 h-m-p 0.0086 3.1271 0.2553 -------------.. | 8/9
54 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657128 m 8.0000 1036 | 8/9
55 h-m-p 0.0088 3.1742 0.2522 ----------C 744.657128 0 0.0000 1059 | 8/9
56 h-m-p 0.0009 0.4471 1.7904 ---------Y 744.657128 0 0.0000 1081 | 8/9
57 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657128 m 8.0000 1096 | 8/9
58 h-m-p 0.0160 8.0000 0.0007 +++++ 744.657127 m 8.0000 1112 | 8/9
59 h-m-p 0.0233 3.1885 0.2529 ----------C 744.657127 0 0.0000 1135 | 8/9
60 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
61 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657126 m 8.0000 1175 | 8/9
62 h-m-p 0.0092 3.2525 0.2486 -------------.. | 8/9
63 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657125 m 8.0000 1215 | 8/9
64 h-m-p 0.0093 3.2836 0.2470 -------------.. | 8/9
65 h-m-p 0.0160 8.0000 0.0003 +++++ 744.657125 m 8.0000 1255 | 8/9
66 h-m-p 0.0094 3.2804 0.2479 ----------Y 744.657125 0 0.0000 1278 | 8/9
67 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657125 m 8.0000 1294 | 8/9
68 h-m-p 0.0065 3.2661 0.2490 -----------Y 744.657125 0 0.0000 1318 | 8/9
69 h-m-p 0.0160 8.0000 0.0000 +++++ 744.657125 m 8.0000 1334 | 8/9
70 h-m-p 0.0069 3.4628 0.2349 ------------C 744.657125 0 0.0000 1359 | 8/9
71 h-m-p 0.0160 8.0000 0.0000 -----C 744.657125 0 0.0000 1377 | 8/9
72 h-m-p 0.0160 8.0000 0.0000 -Y 744.657125 0 0.0010 1391
Out..
lnL = -744.657125
1392 lfun, 4176 eigenQcodon, 16704 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071322 0.069994 0.016628 0.024573 0.033498 0.105826 0.000100 1.090063 0.297923 0.350176 1.443742
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.431071
np = 11
lnL0 = -802.234109
Iterating by ming2
Initial: fx= 802.234109
x= 0.07132 0.06999 0.01663 0.02457 0.03350 0.10583 0.00011 1.09006 0.29792 0.35018 1.44374
1 h-m-p 0.0000 0.0000 421.7368 ++ 801.629442 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 200.9548 +++ 783.793374 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0001 156.1005 ++ 777.858711 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0009 71.0680 ++ 771.342698 m 0.0009 59 | 4/11
5 h-m-p 0.0001 0.0003 394.8929 ++ 752.206779 m 0.0003 73 | 5/11
6 h-m-p 0.0000 0.0001 195.3123 ++ 751.688348 m 0.0001 87 | 6/11
7 h-m-p 0.0000 0.0000 12126.0181 ++ 748.501148 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 5.3036 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 181.8850 ++ 744.657179 m 0.0001 140 | 8/11
10 h-m-p 0.3273 8.0000 0.0000 +++ 744.657179 m 8.0000 155 | 8/11
11 h-m-p 0.0068 3.4078 0.1268 +++++ 744.657170 m 3.4078 175 | 9/11
12 h-m-p 0.5010 8.0000 0.1495 ++ 744.657162 m 8.0000 192 | 9/11
13 h-m-p 1.6000 8.0000 0.3034 Y 744.657162 0 1.1970 208 | 9/11
14 h-m-p 1.6000 8.0000 0.0351 Y 744.657162 0 1.0775 224 | 9/11
15 h-m-p 1.6000 8.0000 0.0006 ++ 744.657162 m 8.0000 240 | 9/11
16 h-m-p 0.2633 8.0000 0.0168 ++Y 744.657162 0 3.2468 258 | 9/11
17 h-m-p 1.6000 8.0000 0.0003 ++ 744.657162 m 8.0000 274 | 9/11
18 h-m-p 0.0160 8.0000 2.5325 -----------Y 744.657162 0 0.0000 301 | 9/11
19 h-m-p 0.0160 8.0000 3.3662 +++C 744.657144 0 1.0240 318 | 9/11
20 h-m-p 1.6000 8.0000 0.8390 Y 744.657142 0 1.1178 332 | 9/11
21 h-m-p 1.6000 8.0000 0.0073 Y 744.657142 0 0.7226 348 | 9/11
22 h-m-p 1.6000 8.0000 0.0002 -----Y 744.657142 0 0.0004 369 | 9/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 744.657142 m 8.0000 388 | 9/11
24 h-m-p 0.0160 8.0000 7.2879 -------------.. | 9/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657142 m 8.0000 432 | 9/11
26 h-m-p 0.0160 8.0000 0.9432 -------------.. | 9/11
27 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657142 m 8.0000 478 | 9/11
28 h-m-p 0.0160 8.0000 4.4539 ------------C 744.657142 0 0.0000 506 | 9/11
29 h-m-p 0.0160 8.0000 0.0010 +++++ 744.657142 m 8.0000 523 | 9/11
30 h-m-p 0.0160 8.0000 8.2018 -------------.. | 9/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 744.657142 m 8.0000 567 | 9/11
32 h-m-p 0.0160 8.0000 0.0888 +++++ 744.657104 m 8.0000 586 | 9/11
33 h-m-p 0.0712 8.0000 9.9836 +++Y 744.657036 0 4.5540 605 | 9/11
34 h-m-p 1.6000 8.0000 0.0000 N 744.657036 0 1.6000 619 | 9/11
35 h-m-p 0.0160 8.0000 0.0000 N 744.657036 0 0.0160 635
Out..
lnL = -744.657036
636 lfun, 2544 eigenQcodon, 11448 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -744.694283 S = -744.657788 -0.014054
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:08
did 20 / 52 patterns 0:08
did 30 / 52 patterns 0:08
did 40 / 52 patterns 0:08
did 50 / 52 patterns 0:08
did 52 / 52 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035754 0.014394 0.089733 0.015317 0.044746 0.084914 0.000100 0.786041 1.275363
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.616267
np = 9
lnL0 = -795.545631
Iterating by ming2
Initial: fx= 795.545631
x= 0.03575 0.01439 0.08973 0.01532 0.04475 0.08491 0.00011 0.78604 1.27536
1 h-m-p 0.0000 0.0000 423.8891 ++ 795.078988 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0141 46.7045 +++++ 774.718023 m 0.0141 29 | 2/9
3 h-m-p 0.0000 0.0000 133.3255 ++ 774.383897 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0011 212.3814 ++++ 760.315257 m 0.0011 55 | 4/9
5 h-m-p 0.0003 0.0016 204.8136 ++ 750.952455 m 0.0016 67 | 5/9
6 h-m-p 0.0096 0.1932 7.6300 -------------.. | 5/9
7 h-m-p 0.0000 0.0000 308.6008 ++ 747.725170 m 0.0000 102 | 6/9
8 h-m-p 0.0160 8.0000 1.4266 -------------.. | 6/9
9 h-m-p 0.0000 0.0000 252.7657 ++ 746.795004 m 0.0000 137 | 7/9
10 h-m-p 0.0160 8.0000 1.0033 -------------.. | 7/9
11 h-m-p 0.0000 0.0001 178.1312 ++ 744.657036 m 0.0001 172 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 744.657036 0 1.6000 184 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 Y 744.657036 0 0.0160 197
Out..
lnL = -744.657036
198 lfun, 2178 eigenQcodon, 11880 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017515 0.054928 0.026295 0.101019 0.102179 0.032357 0.000100 0.900000 0.267386 1.299583 1.299921
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.267864
np = 11
lnL0 = -800.541987
Iterating by ming2
Initial: fx= 800.541987
x= 0.01751 0.05493 0.02630 0.10102 0.10218 0.03236 0.00011 0.90000 0.26739 1.29958 1.29992
1 h-m-p 0.0000 0.0000 377.0459 ++ 800.373262 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 181.0755 ++++ 783.356242 m 0.0006 32 | 2/11
3 h-m-p 0.0000 0.0001 249.6638 ++ 776.059798 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0004 160.6423 ++ 771.253236 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0001 966.4626 ++ 761.003869 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 1664.2064 ++ 759.418162 m 0.0000 88 | 6/11
7 h-m-p 0.0003 0.0071 55.1850 +++ 747.640307 m 0.0071 103 | 7/11
8 h-m-p 0.0006 0.0028 427.9707 +
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
+ 744.657202 m 0.0028 117
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.232536e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
| 8/11
9 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.15, 0.00500, 2.20553) = 1.190345e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20485) = 1.190806e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20468) = 1.190921e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20464) = 1.190950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190957e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190959e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
N 744.657202 0 0.0000 139
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.232536e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20475) = 1.190877e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20451) = 1.191043e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190960e-160 2000 rounds
| 8/11
10 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20463) = 1.190958e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20464) = 1.190952e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20468) = 1.190927e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20482) = 1.190828e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
+ 744.657202 m 8.0000 159
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.232270e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20513) = 1.190620e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20488) = 1.190786e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
| 8/11
11 h-m-p 0.0080 4.0214 0.3548
QuantileBeta(0.15, 0.00500, 2.20382) = 1.191509e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20471) = 1.190905e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20493) = 1.190754e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20499) = 1.190716e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190707e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190704e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190704e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
C 744.657202 0 0.0000 185
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.232270e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20513) = 1.190620e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20488) = 1.190786e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20500) = 1.190703e-160 2000 rounds
| 8/11
12 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.20501) = 1.190703e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20501) = 1.190700e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20502) = 1.190690e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20509) = 1.190649e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20533) = 1.190484e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+ 744.657202 m 8.0000 205
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
13 h-m-p 0.0080 3.9989 0.3377
QuantileBeta(0.15, 0.00500, 2.20454) = 1.191021e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20536) = 1.190461e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20557) = 1.190321e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20562) = 1.190286e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20563) = 1.190278e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20563) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
14 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+ 744.657202 m 8.0000 253
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
15 h-m-p 0.0073 3.6513 0.1987
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
Y 744.657202 0 0.0000 280
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
16 h-m-p 0.0160 8.0000 0.0156
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
+ 744.657170 m 8.0000 300
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
17 h-m-p 0.5364 3.6405 0.2324
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
C 744.657170 0 0.0000 332
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
18 h-m-p 0.0021 1.0438 0.8107
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
N 744.657170 0 0.0000 360
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.231827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20576) = 1.190192e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20551) = 1.190358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20564) = 1.190275e-160 2000 rounds
| 8/11
19 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.20563) = 1.190277e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20562) = 1.190282e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20559) = 1.190304e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20546) = 1.190393e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20494) = 1.190747e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
+ 744.657170 m 8.0000 380
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.232781e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20440) = 1.191114e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20416) = 1.191280e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
| 8/11
20 h-m-p 0.0127 6.3360 0.4022
QuantileBeta(0.15, 0.00500, 2.20909) = 1.187938e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20548) = 1.190380e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20458) = 1.190992e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20435) = 1.191146e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20430) = 1.191184e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191196e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191196e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
N 744.657170 0 0.0000 409
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.232781e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20440) = 1.191114e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20416) = 1.191280e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
| 8/11
21 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
N 744.657170 0 0.0000 430
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.232781e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20440) = 1.191114e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20416) = 1.191280e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
| 8/11
22 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
Y 744.657170 0 0.0000 452
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
Out..
lnL = -744.657170
453 lfun, 5436 eigenQcodon, 29898 P(t)
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -744.675051 S = -744.654854 -0.008883
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:19
did 20 / 52 patterns 0:19
did 30 / 52 patterns 0:19
did 40 / 52 patterns 0:19
did 50 / 52 patterns 0:19
did 52 / 52 patterns 0:19
QuantileBeta(0.15, 0.00500, 2.20428) = 1.191197e-160 2000 rounds
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=190
NC_011896_1_WP_010907772_1_540_MLBR_RS02560 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
NC_002677_1_NP_301448_1_320_nusB MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
NZ_AP014567_1_WP_010907772_1_572_nusB MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH
**************************************************
NC_011896_1_WP_010907772_1_540_MLBR_RS02560 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
NC_002677_1_NP_301448_1_320_nusB PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
NZ_AP014567_1_WP_010907772_1_572_nusB PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY
**************************************************
NC_011896_1_WP_010907772_1_540_MLBR_RS02560 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
NC_002677_1_NP_301448_1_320_nusB ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
NZ_AP014567_1_WP_010907772_1_572_nusB ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV
**************************************************
NC_011896_1_WP_010907772_1_540_MLBR_RS02560 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
NC_002677_1_NP_301448_1_320_nusB QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
NZ_AP014567_1_WP_010907772_1_572_nusB QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
****************************************
>NC_011896_1_WP_010907772_1_540_MLBR_RS02560 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG >NC_002677_1_NP_301448_1_320_nusB ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG >NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG >NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG >NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG >NZ_AP014567_1_WP_010907772_1_572_nusB ATGTCTAATCCGGTCAAGGGACGCCATCAGGCCCGTAAGCGTGCCGTCGA CCTGTTGTTCGAAGCCGAGGCCCGCGATCTGAGCCCACTCGAGATAATCG AGGTTCGTAGCGCATTGGCGAAATCCAAGCTGGATGTAGCGCCGCTGCAT CCGTATACGGTCGTGGTAGCCCAAGGTGTTAGCGAGCACACCGCCCGTAT TGACGAACTGATAATCTCGCATCTACAAGGCTGGAAGCTCGATCGGCTGC CAGCAGTGGATCGCGCCATTTTGCGAGTCTCGATATGGGAGCTGCTATAC GCTGACGATGTGCCCGAACCGGTCGCTGTCGACGAGGCGGTCGAGCTGGC CAAGGAGCTGTCTACTGACGACTCACCTGGCTTCGTCAACGGATTGCTGG GCAAAGTTATGCTGGTTACGCCGCAGATCCGTGCGGCCGCTCAAGCAGTC CAGCAGGCGGTGCGCATGGCTGCCGGTACTTCCGAGGATCACGTACCGCA GCGTGAGCCGGCTGCTGGCCAATTGGGTCAGGACGATTCGAACGGCGGCC AAGTCGCTGCTGTCTGCCGG
>NC_011896_1_WP_010907772_1_540_MLBR_RS02560 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR >NC_002677_1_NP_301448_1_320_nusB MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR >NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR >NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR >NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830 MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR >NZ_AP014567_1_WP_010907772_1_572_nusB MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLH PYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLY ADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAV QQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
#NEXUS
[ID: 9114536287]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907772_1_540_MLBR_RS02560
NC_002677_1_NP_301448_1_320_nusB
NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505
NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910
NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830
NZ_AP014567_1_WP_010907772_1_572_nusB
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907772_1_540_MLBR_RS02560,
2 NC_002677_1_NP_301448_1_320_nusB,
3 NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505,
4 NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910,
5 NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830,
6 NZ_AP014567_1_WP_010907772_1_572_nusB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06814457,2:0.06821338,3:0.07138674,4:0.06817708,5:0.07148862,6:0.07104589);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06814457,2:0.06821338,3:0.07138674,4:0.06817708,5:0.07148862,6:0.07104589);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -779.10 -782.81
2 -779.13 -782.23
--------------------------------------
TOTAL -779.11 -782.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nusB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899324 0.091660 0.401275 1.546566 0.865214 1501.00 1501.00 1.000
r(A<->C){all} 0.155684 0.016981 0.000017 0.411864 0.120694 180.97 216.81 1.000
r(A<->G){all} 0.171941 0.020569 0.000109 0.460863 0.134891 158.88 245.51 1.007
r(A<->T){all} 0.178676 0.021870 0.000108 0.475011 0.139289 159.43 194.78 1.000
r(C<->G){all} 0.161240 0.017848 0.000075 0.433202 0.127880 255.77 258.89 1.000
r(C<->T){all} 0.162131 0.018752 0.000081 0.430800 0.127466 228.40 251.63 1.000
r(G<->T){all} 0.170329 0.019726 0.000158 0.449415 0.135381 214.13 263.99 1.006
pi(A){all} 0.195220 0.000276 0.162750 0.228088 0.194646 1319.78 1410.39 1.000
pi(C){all} 0.285208 0.000343 0.248631 0.321133 0.284861 1266.81 1288.42 1.000
pi(G){all} 0.316940 0.000377 0.278038 0.354335 0.316760 1351.69 1364.65 1.000
pi(T){all} 0.202633 0.000275 0.170005 0.234033 0.202213 1325.37 1370.90 1.000
alpha{1,2} 0.430766 0.238047 0.000121 1.413899 0.257750 1036.53 1146.74 1.000
alpha{3} 0.460990 0.232205 0.000818 1.435770 0.304065 1290.70 1327.21 1.000
pinvar{all} 0.997209 0.000013 0.991460 0.999999 0.998349 1171.33 1189.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/nusB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 190
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 6 6 6 6 6 6
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1
CTG 11 11 11 11 11 11 | CCG 7 7 7 7 7 7 | CAG 6 6 6 6 6 6 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 1 1 1 1 1 1 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 3 3 3 3 3 3 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 8 8 8 8 8 8 | Asp GAT 7 7 7 7 7 7 | Gly GGT 3 3 3 3 3 3
GTC 11 11 11 11 11 11 | GCC 10 10 10 10 10 10 | GAC 7 7 7 7 7 7 | GGC 6 6 6 6 6 6
GTA 3 3 3 3 3 3 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 10 10 10 10 10 10 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907772_1_540_MLBR_RS02560
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
#2: NC_002677_1_NP_301448_1_320_nusB
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
#3: NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
#4: NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
#5: NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
#6: NZ_AP014567_1_WP_010907772_1_572_nusB
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 36
CTC 12 | CCC 6 | CAC 12 | CGC 24
CTA 12 | CCA 12 | Gln Q CAA 30 | CGA 6
CTG 66 | CCG 42 | CAG 36 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0
ATC 18 | ACC 6 | AAC 12 | AGC 18
ATA 18 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 48 | Asp D GAT 42 | Gly G GGT 18
GTC 66 | GCC 60 | GAC 42 | GGC 36
GTA 18 | GCA 18 | Glu E GAA 18 | GGA 12
GTG 24 | GCG 30 | GAG 60 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10526 C:0.28947 A:0.15263 G:0.45263
position 2: T:0.28947 C:0.26316 A:0.28947 G:0.15789
position 3: T:0.21053 C:0.30526 A:0.14211 G:0.34211
Average T:0.20175 C:0.28596 A:0.19474 G:0.31754
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -744.657224 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299961 1.299921
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907772_1_540_MLBR_RS02560: 0.000004, NC_002677_1_NP_301448_1_320_nusB: 0.000004, NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505: 0.000004, NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910: 0.000004, NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830: 0.000004, NZ_AP014567_1_WP_010907772_1_572_nusB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.29992
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 428.6 141.4 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -744.657125 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.186525
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907772_1_540_MLBR_RS02560: 0.000004, NC_002677_1_NP_301448_1_320_nusB: 0.000004, NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505: 0.000004, NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910: 0.000004, NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830: 0.000004, NZ_AP014567_1_WP_010907772_1_572_nusB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.18653 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
7..2 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
7..3 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
7..4 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
7..5 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
7..6 0.000 437.4 132.6 0.1865 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -744.657036 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907772_1_540_MLBR_RS02560: 0.000004, NC_002677_1_NP_301448_1_320_nusB: 0.000004, NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505: 0.000004, NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910: 0.000004, NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830: 0.000004, NZ_AP014567_1_WP_010907772_1_572_nusB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907772_1_540_MLBR_RS02560)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -744.657036 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.371769
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907772_1_540_MLBR_RS02560: 0.000004, NC_002677_1_NP_301448_1_320_nusB: 0.000004, NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505: 0.000004, NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910: 0.000004, NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830: 0.000004, NZ_AP014567_1_WP_010907772_1_572_nusB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.37177
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 437.4 132.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -744.657170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.846692 0.005000 2.204279 2.707830
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907772_1_540_MLBR_RS02560: 0.000004, NC_002677_1_NP_301448_1_320_nusB: 0.000004, NZ_LVXE01000008_1_WP_010907772_1_2742_A3216_RS04505: 0.000004, NZ_LYPH01000055_1_WP_010907772_1_2069_A8144_RS09910: 0.000004, NZ_CP029543_1_WP_010907772_1_554_DIJ64_RS02830: 0.000004, NZ_AP014567_1_WP_010907772_1_572_nusB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.84669 p = 0.00500 q = 2.20428
(p1 = 0.15331) w = 2.70783
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08467 0.08467 0.08467 0.08467 0.08467 0.08467 0.08467 0.08467 0.08467 0.08467 0.15331
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.70783
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
7..2 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
7..3 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
7..4 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
7..5 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
7..6 0.000 437.4 132.6 0.4151 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907772_1_540_MLBR_RS02560)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907772_1_540_MLBR_RS02560)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:19
Model 1: NearlyNeutral -744.657125 Model 2: PositiveSelection -744.657036 Model 0: one-ratio -744.657224 Model 7: beta -744.657036 Model 8: beta&w>1 -744.65717 Model 0 vs 1 1.9800000018221908E-4 Model 2 vs 1 1.7800000000534055E-4 Model 8 vs 7 2.6800000000548607E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
