--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 13:06:54 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/obgE/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1948.04 -1951.46 2 -1948.09 -1951.08 -------------------------------------- TOTAL -1948.07 -1951.29 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892656 0.089151 0.397701 1.523522 0.860516 1271.41 1386.20 1.000 r(A<->C){all} 0.162395 0.018646 0.000058 0.432615 0.127192 198.24 228.38 1.010 r(A<->G){all} 0.166887 0.018925 0.000262 0.448980 0.132466 214.89 242.45 1.000 r(A<->T){all} 0.171554 0.022003 0.000056 0.467099 0.128270 120.65 210.56 1.003 r(C<->G){all} 0.170773 0.019974 0.000001 0.453526 0.135406 183.20 189.32 1.001 r(C<->T){all} 0.157140 0.016726 0.000005 0.411678 0.126475 224.77 320.34 1.003 r(G<->T){all} 0.171250 0.020164 0.000047 0.450703 0.132356 116.35 169.90 1.003 pi(A){all} 0.171433 0.000095 0.152610 0.190491 0.171120 1290.88 1330.11 1.000 pi(C){all} 0.286011 0.000144 0.263507 0.309326 0.285907 1045.77 1213.20 1.000 pi(G){all} 0.331158 0.000147 0.309190 0.356796 0.331030 1136.49 1154.25 1.000 pi(T){all} 0.211398 0.000118 0.191242 0.233967 0.211539 1322.24 1324.92 1.000 alpha{1,2} 0.439832 0.239728 0.000118 1.407981 0.271875 1205.91 1315.60 1.000 alpha{3} 0.452489 0.239246 0.000285 1.371793 0.293425 1244.80 1252.66 1.000 pinvar{all} 0.998989 0.000001 0.996677 0.999999 0.999388 1001.58 1068.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1895.144388 Model 2: PositiveSelection -1895.144388 Model 0: one-ratio -1895.144823 Model 7: beta -1895.144388 Model 8: beta&w>1 -1895.144388 Model 0 vs 1 8.700000003045716E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C2 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C3 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C4 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C5 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C6 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=479 C1 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C2 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C3 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C4 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C5 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C6 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV ************************************************** C1 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C2 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C3 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C4 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C5 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C6 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE ************************************************** C1 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C2 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C3 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C4 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C5 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C6 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR ************************************************** C1 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C2 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C3 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C4 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C5 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C6 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV ************************************************** C1 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C2 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C3 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C4 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C5 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C6 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE ************************************************** C1 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C2 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C3 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C4 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C5 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C6 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ************************************************** C1 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C2 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C3 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C4 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C5 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C6 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP ************************************************** C1 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C2 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C3 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C4 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C5 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C6 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG ************************************************** C1 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C2 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C3 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C4 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C5 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C6 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR ************************************************** C1 GTDARLESTDPVGTAERKVARHQRHKHGG C2 GTDARLESTDPVGTAERKVARHQRHKHGG C3 GTDARLESTDPVGTAERKVARHQRHKHGG C4 GTDARLESTDPVGTAERKVARHQRHKHGG C5 GTDARLESTDPVGTAERKVARHQRHKHGG C6 GTDARLESTDPVGTAERKVARHQRHKHGG ***************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] Relaxation Summary: [14370]--->[14370] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.554 Mb, Max= 31.074 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C2 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C3 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C4 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C5 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV C6 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV ************************************************** C1 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C2 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C3 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C4 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C5 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE C6 DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE ************************************************** C1 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C2 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C3 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C4 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C5 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR C6 DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR ************************************************** C1 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C2 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C3 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C4 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C5 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV C6 DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV ************************************************** C1 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C2 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C3 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C4 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C5 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE C6 VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE ************************************************** C1 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C2 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C3 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C4 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C5 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR C6 PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ************************************************** C1 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C2 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C3 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C4 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C5 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP C6 ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP ************************************************** C1 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C2 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C3 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C4 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C5 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG C6 APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG ************************************************** C1 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C2 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C3 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C4 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C5 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR C6 YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR ************************************************** C1 GTDARLESTDPVGTAERKVARHQRHKHGG C2 GTDARLESTDPVGTAERKVARHQRHKHGG C3 GTDARLESTDPVGTAERKVARHQRHKHGG C4 GTDARLESTDPVGTAERKVARHQRHKHGG C5 GTDARLESTDPVGTAERKVARHQRHKHGG C6 GTDARLESTDPVGTAERKVARHQRHKHGG ***************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG C2 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG C3 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG C4 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG C5 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG C6 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG ************************************************** C1 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG C2 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG C3 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG C4 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG C5 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG C6 CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG ************************************************** C1 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC C2 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC C3 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC C4 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC C5 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC C6 GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC ************************************************** C1 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC C2 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC C3 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC C4 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC C5 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC C6 GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC ************************************************** C1 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG C2 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG C3 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG C4 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG C5 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG C6 CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG ************************************************** C1 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA C2 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA C3 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA C4 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA C5 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA C6 GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA ************************************************** C1 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC C2 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC C3 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC C4 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC C5 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC C6 GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC ************************************************** C1 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA C2 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA C3 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA C4 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA C5 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA C6 CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA ************************************************** C1 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT C2 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT C3 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT C4 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT C5 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT C6 CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT ************************************************** C1 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT C2 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT C3 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT C4 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT C5 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT C6 GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT ************************************************** C1 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC C2 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC C3 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC C4 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC C5 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC C6 TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC ************************************************** C1 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG C2 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG C3 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG C4 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG C5 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG C6 CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG ************************************************** C1 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT C2 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT C3 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT C4 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT C5 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT C6 GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT ************************************************** C1 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA C2 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA C3 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA C4 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA C5 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA C6 CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA ************************************************** C1 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA C2 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA C3 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA C4 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA C5 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA C6 TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA ************************************************** C1 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC C2 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC C3 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC C4 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC C5 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC C6 CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC ************************************************** C1 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG C2 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG C3 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG C4 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG C5 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG C6 AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG ************************************************** C1 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC C2 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC C3 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC C4 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC C5 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC C6 AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC ************************************************** C1 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC C2 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC C3 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC C4 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC C5 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC C6 GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC ************************************************** C1 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT C2 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT C3 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT C4 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT C5 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT C6 GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT ************************************************** C1 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG C2 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG C3 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG C4 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG C5 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG C6 TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG ************************************************** C1 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT C2 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT C3 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT C4 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT C5 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT C6 GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT ************************************************** C1 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC C2 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC C3 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC C4 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC C5 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC C6 TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC ************************************************** C1 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC C2 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC C3 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC C4 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC C5 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC C6 CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC ************************************************** C1 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG C2 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG C3 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG C4 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG C5 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG C6 TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG ************************************************** C1 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG C2 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG C3 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG C4 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG C5 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG C6 GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ************************************************** C1 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG C2 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG C3 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG C4 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG C5 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG C6 ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG ************************************************** C1 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG C2 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG C3 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG C4 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG C5 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG C6 GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG ************************************************** C1 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA C2 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA C3 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA C4 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA C5 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA C6 CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA ************************************* >C1 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C2 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C3 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C4 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C5 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C6 ATGCCTCGGTTTGTCGATCGCGTCGTCATCCACACCTGGGCGGGTTCTGG CGGTAACGGCTGCGCTTCGATTCATCGCTCAAAGTTCAAGCCGTTAGGTG GCCCTGATGGTGGCAATGGTGGCCGTGGCGGCAGCGTGGTCTTCGTCGTC GACCCTCATGTGCACACCTTGTTGGACTTTCATTTCCGACCGCACATCAC CGCGCCATCCGGCAAACAGGGTATGGGCAACAACCGTGACGGTGCAGCCG GCGCGGATCTGGAAGTCAAAGTCCCCGACGGCACCGTCGTCCTGGACGAA GACGGTCGGTTGCTAGCTGATCTGGTAGGCGCGGGCACTCGTTTCCAAGC CGCCGCTGGCGGTCGCGGCGGCTTGGGCAATGCAGCGCTCGCGTCGCGTA CCCGCAAGGTGCCCGGCTTCGCACTGCTCGGTGAACAAGGCGAGTCTCGT GATCTCACCCTGGAGCTCAAGAGCGTTGCCGATGTCGGTTTGATCGGGTT TCCTTCGGCCGGAAAGTCGTCCCTTGTGTCCGTGATCTCGGCGGCCAAAC CCAAGATTGCCGACTACCCGTTCACTACGCTTGTTCCCAATCTCGGCGTG GTCTCGGTCGGCGAACACGCGTTCACCGTCGCTGATGTGCCTGGTTTAAT CCCGGGAGCTTCGGCGGGGCGCGGCCTGGGTCTGGACTTTTTACGGCATA TCGAGCGGTGCGCGGTGCTGGTGCACGTGGTGGATTGTACGAGTGTAGAA CCGGGGCGTGATCCGATCTTGGACATCGCCGCGCTGGAGGCCGAACTCGC AGCTTATACCCCGACACTGCAAGGAGATACGACTTTGGGTGACTTTGCTG AGCGGCCCCGTGCGGTGGTGCTCAACAAAATCGATGTGCCGGACGCCCGC GAGCTCGCTGAATTCGTTTGCGACAACATTGCTGCCGAGCGCGGTTGGCC GGTGTTTAGTGTGTCGACGGTCACTCGAGAAAACCTGCAGTCATTGATTT TCGGGCTGTGGCAGATGATCTCAGCGTACCACGCCGCGAGGTCGGAGCCG GCGCCGGGACGGTCGCTGATTCGTCCGGTGCCTGTCGATGACAGCGGCTT TACCGTTGAACCGGACGGACAGGGCGGCTTTGTGGTTACCGGTACGCGAC CCGAACGTTGGATTCATCAGACCAACTTCGATAACGCCGAAGCGGTCGGC TATCTCGCCGACCGGCTGGCACGCCTCGGGGTAGAGGACGAACTGCTGCG GGTGGGTGCACAGCCGGGGTGTACAGTAAGCATTGGTGGGATGACGTTCG ATTGGGAGCCACAAAAGCCTGCGGGCCATCCGGTCGCAATGTCAGGCCGG GGTACCGACGCGAGGTTGGAAAGTACCGACCCCGTTGGTACCGCTGAACG CAAGGTTGCGCGGCATCAGCGTCACAAACACGGTGGA >C1 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C2 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C3 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C4 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C5 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG >C6 MPRFVDRVVIHTWAGSGGNGCASIHRSKFKPLGGPDGGNGGRGGSVVFVV DPHVHTLLDFHFRPHITAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE DGRLLADLVGAGTRFQAAAGGRGGLGNAALASRTRKVPGFALLGEQGESR DLTLELKSVADVGLIGFPSAGKSSLVSVISAAKPKIADYPFTTLVPNLGV VSVGEHAFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVVDCTSVE PGRDPILDIAALEAELAAYTPTLQGDTTLGDFAERPRAVVLNKIDVPDAR ELAEFVCDNIAAERGWPVFSVSTVTRENLQSLIFGLWQMISAYHAARSEP APGRSLIRPVPVDDSGFTVEPDGQGGFVVTGTRPERWIHQTNFDNAEAVG YLADRLARLGVEDELLRVGAQPGCTVSIGGMTFDWEPQKPAGHPVAMSGR GTDARLESTDPVGTAERKVARHQRHKHGG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1437 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579784736 Setting output file names to "/data/10res/obgE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 404495868 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9945536518 Seed = 1287227091 Swapseed = 1579784736 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3216.074884 -- -24.965149 Chain 2 -- -3216.074884 -- -24.965149 Chain 3 -- -3216.074698 -- -24.965149 Chain 4 -- -3216.074884 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3216.074884 -- -24.965149 Chain 2 -- -3216.074884 -- -24.965149 Chain 3 -- -3216.074698 -- -24.965149 Chain 4 -- -3216.074884 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3216.075] (-3216.075) (-3216.075) (-3216.075) * [-3216.075] (-3216.075) (-3216.075) (-3216.075) 500 -- (-1962.988) (-1970.250) [-1978.191] (-1958.156) * (-1961.100) (-1982.229) (-2003.770) [-1954.739] -- 0:00:00 1000 -- (-1952.033) (-1959.243) (-1962.519) [-1964.051] * (-1961.212) [-1964.636] (-1961.493) (-1961.987) -- 0:00:00 1500 -- (-1958.617) (-1957.851) [-1954.754] (-1956.563) * [-1964.124] (-1959.816) (-1954.444) (-1953.620) -- 0:00:00 2000 -- (-1956.414) (-1963.801) [-1959.709] (-1959.520) * (-1957.863) [-1952.316] (-1956.401) (-1953.622) -- 0:00:00 2500 -- (-1957.439) (-1958.929) [-1959.760] (-1966.653) * (-1959.840) [-1955.430] (-1954.220) (-1956.670) -- 0:00:00 3000 -- (-1957.952) (-1954.182) [-1959.639] (-1955.235) * [-1956.474] (-1964.774) (-1957.692) (-1954.693) -- 0:00:00 3500 -- [-1958.390] (-1955.243) (-1954.369) (-1955.001) * (-1956.201) [-1958.476] (-1963.694) (-1955.154) -- 0:00:00 4000 -- (-1959.662) (-1959.592) [-1956.479] (-1960.359) * (-1959.549) (-1956.170) (-1961.153) [-1955.721] -- 0:00:00 4500 -- [-1958.004] (-1962.768) (-1965.174) (-1956.666) * [-1956.610] (-1953.968) (-1962.851) (-1958.424) -- 0:00:00 5000 -- (-1955.174) (-1960.092) [-1957.990] (-1956.545) * (-1960.102) (-1956.771) [-1960.184] (-1957.885) -- 0:00:00 Average standard deviation of split frequencies: 0.074826 5500 -- (-1958.187) (-1966.734) [-1965.486] (-1955.248) * (-1968.863) [-1953.029] (-1957.499) (-1956.309) -- 0:00:00 6000 -- (-1959.332) (-1957.199) (-1965.383) [-1956.581] * (-1967.631) [-1961.720] (-1962.531) (-1955.501) -- 0:00:00 6500 -- [-1953.999] (-1959.252) (-1957.509) (-1954.762) * (-1968.205) [-1955.127] (-1952.347) (-1953.004) -- 0:00:00 7000 -- (-1955.049) (-1963.374) (-1964.832) [-1961.699] * (-1960.872) [-1953.378] (-1957.963) (-1954.119) -- 0:00:00 7500 -- [-1951.414] (-1959.229) (-1960.374) (-1959.766) * (-1956.554) [-1952.836] (-1958.220) (-1962.377) -- 0:00:00 8000 -- [-1953.474] (-1962.717) (-1961.702) (-1951.446) * (-1958.650) (-1952.620) (-1954.328) [-1962.378] -- 0:00:00 8500 -- (-1968.201) [-1957.359] (-1970.435) (-1958.677) * (-1955.315) (-1956.525) [-1962.443] (-1962.954) -- 0:01:56 9000 -- (-1967.848) (-1957.097) (-1953.407) [-1952.934] * (-1956.128) (-1954.109) [-1956.912] (-1958.534) -- 0:01:50 9500 -- [-1961.518] (-1955.620) (-1956.459) (-1968.536) * [-1955.447] (-1955.734) (-1962.836) (-1956.750) -- 0:01:44 10000 -- (-1953.869) [-1954.180] (-1957.353) (-1958.900) * (-1955.641) [-1958.546] (-1957.033) (-1956.628) -- 0:01:39 Average standard deviation of split frequencies: 0.071202 10500 -- (-1965.567) (-1959.474) (-1955.095) [-1959.743] * (-1958.362) [-1954.199] (-1957.132) (-1958.121) -- 0:01:34 11000 -- (-1958.707) (-1960.335) [-1960.087] (-1956.266) * [-1956.081] (-1959.874) (-1957.927) (-1953.832) -- 0:01:29 11500 -- (-1964.049) [-1957.272] (-1958.852) (-1956.076) * (-1958.293) [-1959.420] (-1957.612) (-1956.493) -- 0:01:25 12000 -- (-1956.295) (-1961.976) [-1956.400] (-1954.162) * (-1955.776) [-1952.636] (-1958.820) (-1960.435) -- 0:01:22 12500 -- [-1955.503] (-1957.871) (-1960.662) (-1956.434) * (-1968.232) (-1949.854) [-1953.585] (-1959.040) -- 0:01:19 13000 -- (-1965.048) (-1959.065) [-1954.104] (-1950.652) * (-1953.635) (-1949.573) (-1963.245) [-1954.531] -- 0:01:15 13500 -- (-1957.273) (-1958.234) (-1959.459) [-1952.556] * (-1972.958) [-1949.227] (-1965.768) (-1953.879) -- 0:01:13 14000 -- [-1957.210] (-1956.701) (-1958.480) (-1953.624) * [-1955.744] (-1949.154) (-1956.182) (-1959.637) -- 0:01:10 14500 -- (-1961.798) [-1956.631] (-1957.178) (-1955.863) * (-1959.559) (-1948.887) (-1955.085) [-1955.720] -- 0:01:07 15000 -- (-1956.732) [-1954.634] (-1950.238) (-1950.980) * (-1965.683) [-1948.600] (-1955.268) (-1958.342) -- 0:01:05 Average standard deviation of split frequencies: 0.054274 15500 -- (-1958.215) (-1969.012) (-1951.053) [-1952.035] * (-1955.808) (-1948.226) [-1955.341] (-1963.561) -- 0:01:03 16000 -- [-1959.445] (-1969.491) (-1950.532) (-1959.008) * (-1958.633) [-1950.831] (-1966.402) (-1964.261) -- 0:01:01 16500 -- (-1960.744) [-1956.011] (-1950.837) (-1954.718) * (-1961.682) (-1950.654) [-1953.986] (-1961.596) -- 0:00:59 17000 -- [-1958.575] (-1965.155) (-1953.398) (-1957.332) * (-1964.523) (-1949.985) [-1957.725] (-1958.622) -- 0:00:57 17500 -- (-1966.873) [-1955.595] (-1955.468) (-1960.290) * (-1965.050) (-1948.654) [-1963.628] (-1959.930) -- 0:00:56 18000 -- (-1958.907) [-1959.982] (-1954.520) (-1962.160) * (-1955.413) (-1949.490) (-1960.419) [-1954.751] -- 0:00:54 18500 -- [-1960.204] (-1959.034) (-1948.624) (-1954.244) * (-1961.721) (-1950.818) [-1966.848] (-1962.810) -- 0:00:53 19000 -- [-1958.802] (-1954.881) (-1948.624) (-1954.848) * (-1963.532) (-1951.938) (-1959.306) [-1956.961] -- 0:00:51 19500 -- [-1954.021] (-1954.076) (-1953.267) (-1959.442) * (-1962.941) (-1948.577) (-1957.097) [-1954.702] -- 0:00:50 20000 -- (-1963.391) [-1951.491] (-1948.620) (-1955.525) * (-1962.853) (-1948.475) [-1958.183] (-1960.483) -- 0:00:49 Average standard deviation of split frequencies: 0.056424 20500 -- (-1967.624) [-1959.450] (-1948.596) (-1958.468) * (-1957.597) (-1948.499) [-1962.142] (-1960.073) -- 0:00:47 21000 -- [-1954.126] (-1962.267) (-1947.869) (-1958.248) * [-1957.648] (-1947.818) (-1958.506) (-1955.050) -- 0:00:46 21500 -- (-1954.462) (-1955.044) (-1949.202) [-1955.595] * (-1951.291) (-1948.763) (-1958.675) [-1953.536] -- 0:00:45 22000 -- (-1954.263) (-1967.646) (-1950.534) [-1959.616] * (-1956.152) (-1947.143) (-1963.938) [-1954.686] -- 0:00:44 22500 -- (-1956.885) [-1955.344] (-1950.710) (-1956.329) * (-1959.810) (-1948.042) [-1960.348] (-1956.718) -- 0:00:43 23000 -- [-1958.119] (-1961.925) (-1949.500) (-1957.628) * [-1957.244] (-1953.649) (-1957.941) (-1957.671) -- 0:01:24 23500 -- (-1954.645) (-1966.929) (-1950.300) [-1958.084] * (-1957.632) (-1949.571) (-1964.560) [-1953.236] -- 0:01:23 24000 -- (-1954.436) (-1962.092) (-1950.018) [-1956.513] * (-1961.499) (-1949.004) (-1960.199) [-1956.026] -- 0:01:21 24500 -- [-1952.343] (-1957.704) (-1947.786) (-1958.230) * [-1960.514] (-1951.066) (-1958.324) (-1954.597) -- 0:01:19 25000 -- [-1956.104] (-1956.676) (-1947.077) (-1958.972) * (-1956.351) (-1950.858) (-1954.670) [-1953.204] -- 0:01:18 Average standard deviation of split frequencies: 0.043679 25500 -- [-1962.142] (-1955.939) (-1948.925) (-1956.219) * (-1963.381) (-1948.175) [-1951.516] (-1954.661) -- 0:01:16 26000 -- (-1960.217) (-1966.025) [-1947.623] (-1957.401) * (-1960.910) (-1948.529) [-1952.464] (-1954.439) -- 0:01:14 26500 -- (-1957.900) (-1968.456) (-1948.536) [-1956.074] * (-1955.684) [-1947.194] (-1957.719) (-1964.136) -- 0:01:13 27000 -- [-1961.062] (-1950.815) (-1948.601) (-1955.327) * [-1953.227] (-1949.375) (-1963.305) (-1964.297) -- 0:01:12 27500 -- [-1955.217] (-1948.189) (-1946.598) (-1957.023) * (-1958.371) (-1947.607) [-1961.777] (-1956.665) -- 0:01:10 28000 -- (-1959.301) (-1950.627) [-1947.262] (-1957.044) * (-1956.317) (-1950.515) [-1958.275] (-1958.452) -- 0:01:09 28500 -- (-1960.408) [-1948.891] (-1948.212) (-1972.412) * (-1956.712) [-1951.686] (-1955.363) (-1957.844) -- 0:01:08 29000 -- (-1962.613) [-1948.300] (-1947.640) (-1953.406) * (-1952.076) (-1951.036) (-1959.352) [-1958.417] -- 0:01:06 29500 -- [-1952.147] (-1952.474) (-1947.640) (-1964.258) * [-1958.375] (-1950.708) (-1956.646) (-1957.637) -- 0:01:05 30000 -- (-1962.928) (-1951.261) (-1951.460) [-1955.671] * (-1962.575) [-1947.468] (-1954.086) (-1961.041) -- 0:01:04 Average standard deviation of split frequencies: 0.038430 30500 -- (-1954.788) (-1950.904) [-1948.012] (-1956.681) * (-1959.595) [-1947.851] (-1954.630) (-1958.595) -- 0:01:03 31000 -- [-1954.397] (-1953.421) (-1950.384) (-1954.159) * [-1955.986] (-1947.790) (-1957.265) (-1954.804) -- 0:01:02 31500 -- (-1967.321) (-1948.202) (-1947.600) [-1963.993] * (-1959.156) (-1947.835) (-1958.968) [-1956.253] -- 0:01:01 32000 -- [-1954.666] (-1947.027) (-1947.480) (-1968.819) * (-1958.999) (-1948.004) (-1955.730) [-1958.290] -- 0:01:00 32500 -- (-1963.645) (-1947.848) [-1949.759] (-1958.391) * [-1958.232] (-1948.004) (-1956.703) (-1956.127) -- 0:00:59 33000 -- (-1956.397) (-1946.930) (-1949.773) [-1954.601] * (-1957.685) (-1947.693) (-1956.394) [-1975.379] -- 0:00:58 33500 -- [-1955.495] (-1947.944) (-1954.728) (-1949.164) * [-1954.523] (-1947.175) (-1952.302) (-1970.501) -- 0:00:57 34000 -- (-1960.913) [-1950.120] (-1954.457) (-1950.970) * (-1958.476) [-1947.132] (-1956.471) (-1950.297) -- 0:00:56 34500 -- (-1958.307) (-1948.467) [-1948.264] (-1948.804) * (-1960.445) [-1946.785] (-1953.106) (-1954.348) -- 0:00:55 35000 -- [-1961.916] (-1950.241) (-1949.777) (-1948.390) * (-1962.145) [-1947.666] (-1957.328) (-1949.562) -- 0:00:55 Average standard deviation of split frequencies: 0.037974 35500 -- (-1953.832) [-1949.130] (-1949.253) (-1951.051) * (-1960.900) (-1947.080) (-1959.868) [-1948.533] -- 0:00:54 36000 -- (-1952.837) [-1948.837] (-1947.676) (-1951.289) * (-1955.959) (-1947.335) [-1955.505] (-1947.512) -- 0:00:53 36500 -- (-1952.723) (-1948.189) [-1947.733] (-1950.009) * (-1958.549) (-1947.708) (-1958.258) [-1947.592] -- 0:00:52 37000 -- [-1954.164] (-1947.198) (-1949.828) (-1949.259) * [-1950.542] (-1948.875) (-1961.671) (-1947.610) -- 0:00:52 37500 -- (-1953.983) (-1947.761) (-1954.830) [-1949.670] * (-1949.541) (-1951.189) [-1956.033] (-1947.363) -- 0:00:51 38000 -- (-1955.042) [-1947.695] (-1954.056) (-1947.571) * (-1949.736) (-1947.605) (-1957.451) [-1948.062] -- 0:01:15 38500 -- (-1954.784) (-1950.417) [-1947.427] (-1948.610) * (-1948.890) (-1949.061) (-1953.690) [-1950.582] -- 0:01:14 39000 -- (-1957.013) (-1948.996) (-1948.736) [-1948.344] * (-1949.664) (-1950.814) [-1957.075] (-1947.583) -- 0:01:13 39500 -- (-1957.204) (-1950.674) [-1949.829] (-1950.212) * (-1949.321) (-1946.840) [-1954.976] (-1948.101) -- 0:01:12 40000 -- (-1959.490) [-1950.241] (-1949.465) (-1947.590) * (-1950.405) [-1946.810] (-1958.654) (-1951.859) -- 0:01:12 Average standard deviation of split frequencies: 0.034776 40500 -- (-1957.052) (-1948.021) [-1948.753] (-1949.145) * (-1952.857) [-1946.639] (-1967.697) (-1948.520) -- 0:01:11 41000 -- (-1957.605) (-1948.708) [-1949.479] (-1949.827) * (-1954.850) [-1947.597] (-1957.546) (-1948.025) -- 0:01:10 41500 -- (-1959.784) (-1947.513) [-1949.136] (-1949.949) * [-1950.137] (-1956.160) (-1965.427) (-1949.763) -- 0:01:09 42000 -- (-1966.986) (-1948.454) (-1948.860) [-1950.400] * (-1951.472) (-1951.818) (-1952.774) [-1951.508] -- 0:01:08 42500 -- [-1965.016] (-1951.110) (-1949.178) (-1949.064) * (-1951.400) (-1951.041) [-1951.506] (-1946.589) -- 0:01:07 43000 -- [-1954.762] (-1951.409) (-1951.874) (-1951.320) * (-1953.821) (-1951.609) [-1952.000] (-1948.491) -- 0:01:06 43500 -- (-1960.056) [-1952.837] (-1946.926) (-1950.393) * [-1953.138] (-1951.007) (-1948.358) (-1950.304) -- 0:01:05 44000 -- (-1963.936) (-1954.955) (-1948.146) [-1953.818] * [-1949.426] (-1949.038) (-1951.586) (-1947.790) -- 0:01:05 44500 -- [-1954.955] (-1952.378) (-1946.897) (-1950.064) * (-1949.923) (-1950.509) [-1947.927] (-1948.344) -- 0:01:04 45000 -- [-1954.249] (-1948.646) (-1948.976) (-1951.225) * (-1951.073) (-1955.783) [-1947.367] (-1948.619) -- 0:01:03 Average standard deviation of split frequencies: 0.037088 45500 -- (-1954.454) (-1947.920) [-1947.746] (-1950.524) * (-1950.115) (-1949.250) [-1948.624] (-1949.077) -- 0:01:02 46000 -- (-1957.383) [-1947.629] (-1948.587) (-1951.353) * (-1952.376) (-1948.756) (-1950.377) [-1952.013] -- 0:01:02 46500 -- (-1961.717) (-1949.972) (-1947.719) [-1949.283] * (-1953.005) (-1949.338) (-1949.521) [-1946.691] -- 0:01:01 47000 -- (-1962.655) [-1949.972] (-1949.653) (-1949.344) * (-1954.306) [-1948.727] (-1950.702) (-1951.269) -- 0:01:00 47500 -- (-1955.101) (-1954.312) [-1950.225] (-1947.831) * (-1949.005) (-1948.806) (-1949.530) [-1948.627] -- 0:01:00 48000 -- (-1953.346) [-1951.589] (-1950.068) (-1947.943) * [-1950.724] (-1948.014) (-1950.801) (-1947.340) -- 0:00:59 48500 -- (-1961.428) (-1948.995) (-1949.302) [-1948.435] * (-1951.946) (-1948.988) (-1949.007) [-1949.061] -- 0:00:58 49000 -- (-1952.073) (-1948.634) [-1946.561] (-1949.540) * (-1953.351) (-1949.417) (-1950.645) [-1948.539] -- 0:00:58 49500 -- [-1956.226] (-1949.128) (-1946.525) (-1948.415) * (-1950.752) (-1949.036) [-1947.791] (-1948.533) -- 0:00:57 50000 -- (-1954.426) [-1946.748] (-1946.592) (-1947.743) * (-1949.136) (-1948.319) (-1951.775) [-1951.436] -- 0:00:57 Average standard deviation of split frequencies: 0.029381 50500 -- (-1962.705) [-1948.525] (-1949.607) (-1947.925) * (-1947.637) [-1949.367] (-1950.896) (-1949.506) -- 0:00:56 51000 -- (-1960.084) (-1950.118) (-1951.855) [-1947.365] * (-1947.745) [-1950.848] (-1951.868) (-1950.457) -- 0:00:55 51500 -- (-1954.972) (-1947.972) [-1947.843] (-1949.461) * (-1950.369) (-1950.194) (-1950.063) [-1948.606] -- 0:00:55 52000 -- (-1961.757) [-1947.865] (-1950.060) (-1948.400) * (-1950.740) (-1946.738) [-1950.805] (-1950.837) -- 0:00:54 52500 -- (-1961.354) (-1948.040) (-1949.227) [-1948.246] * [-1949.603] (-1947.012) (-1949.480) (-1950.034) -- 0:00:54 53000 -- [-1967.436] (-1950.193) (-1947.569) (-1950.619) * [-1949.613] (-1947.310) (-1948.709) (-1948.480) -- 0:01:11 53500 -- (-1954.345) (-1950.424) [-1952.515] (-1948.441) * (-1950.340) (-1947.316) [-1948.987] (-1946.993) -- 0:01:10 54000 -- (-1961.312) (-1949.852) (-1950.547) [-1950.533] * (-1948.505) (-1952.650) [-1948.571] (-1949.973) -- 0:01:10 54500 -- (-1956.192) (-1951.493) (-1954.736) [-1950.760] * (-1947.440) (-1949.518) [-1948.768] (-1949.785) -- 0:01:09 55000 -- (-1963.830) (-1951.834) [-1949.005] (-1954.367) * (-1948.514) [-1948.037] (-1950.830) (-1950.551) -- 0:01:08 Average standard deviation of split frequencies: 0.029663 55500 -- (-1958.328) (-1953.053) (-1947.251) [-1947.631] * (-1949.989) (-1947.885) [-1949.292] (-1946.897) -- 0:01:08 56000 -- (-1969.685) (-1951.761) [-1946.935] (-1951.169) * (-1950.223) (-1947.067) (-1948.358) [-1950.349] -- 0:01:07 56500 -- (-1962.704) (-1947.236) (-1949.568) [-1947.188] * (-1947.736) (-1947.465) (-1947.626) [-1952.636] -- 0:01:06 57000 -- (-1954.774) (-1948.043) (-1952.052) [-1947.595] * (-1948.378) (-1947.465) [-1947.488] (-1950.125) -- 0:01:06 57500 -- [-1954.425] (-1949.363) (-1955.905) (-1947.147) * (-1949.161) (-1949.310) (-1947.183) [-1949.118] -- 0:01:05 58000 -- (-1959.719) (-1947.960) [-1950.043] (-1947.942) * (-1951.865) [-1948.241] (-1948.473) (-1948.636) -- 0:01:04 58500 -- (-1962.297) [-1949.352] (-1949.746) (-1949.187) * (-1949.065) (-1946.885) (-1947.287) [-1947.536] -- 0:01:04 59000 -- [-1956.712] (-1948.643) (-1951.387) (-1948.585) * (-1948.249) (-1947.272) (-1947.372) [-1947.517] -- 0:01:03 59500 -- (-1960.830) (-1948.707) [-1952.362] (-1949.575) * (-1947.505) (-1946.672) [-1948.818] (-1947.160) -- 0:01:03 60000 -- (-1960.658) [-1948.957] (-1950.801) (-1950.203) * [-1947.744] (-1948.041) (-1950.698) (-1949.054) -- 0:01:02 Average standard deviation of split frequencies: 0.028121 60500 -- [-1961.667] (-1949.582) (-1950.336) (-1950.954) * (-1948.177) (-1949.304) [-1947.354] (-1948.659) -- 0:01:02 61000 -- (-1961.008) (-1947.480) [-1951.526] (-1950.090) * [-1947.764] (-1951.260) (-1947.318) (-1947.518) -- 0:01:01 61500 -- (-1954.642) (-1951.460) [-1954.754] (-1949.293) * (-1946.444) (-1948.043) (-1947.491) [-1947.379] -- 0:01:01 62000 -- [-1959.769] (-1947.516) (-1952.665) (-1947.769) * (-1946.464) (-1947.647) (-1950.454) [-1947.815] -- 0:01:00 62500 -- [-1958.640] (-1950.090) (-1952.957) (-1947.306) * (-1946.587) [-1947.578] (-1950.893) (-1947.899) -- 0:01:00 63000 -- (-1953.984) (-1947.931) [-1948.845] (-1948.708) * (-1950.258) (-1948.246) (-1949.953) [-1947.595] -- 0:00:59 63500 -- (-1961.125) [-1948.501] (-1947.483) (-1947.094) * [-1947.171] (-1948.003) (-1948.131) (-1948.068) -- 0:00:58 64000 -- (-1959.656) [-1948.361] (-1950.017) (-1946.690) * [-1948.171] (-1947.639) (-1947.454) (-1947.621) -- 0:00:58 64500 -- (-1961.772) (-1952.448) [-1947.946] (-1946.690) * (-1948.549) (-1949.365) [-1947.622] (-1948.270) -- 0:00:58 65000 -- [-1958.810] (-1947.231) (-1946.777) (-1947.066) * (-1950.521) (-1958.024) [-1947.573] (-1952.133) -- 0:00:57 Average standard deviation of split frequencies: 0.026529 65500 -- (-1959.370) (-1947.095) [-1948.244] (-1948.010) * [-1949.396] (-1951.681) (-1947.976) (-1948.888) -- 0:00:57 66000 -- (-1957.457) (-1946.893) (-1947.425) [-1948.543] * (-1948.121) (-1947.684) [-1948.285] (-1948.454) -- 0:00:56 66500 -- [-1958.093] (-1948.258) (-1949.808) (-1948.119) * (-1947.654) [-1947.758] (-1950.230) (-1948.485) -- 0:00:56 67000 -- (-1959.767) (-1949.940) (-1948.300) [-1948.905] * (-1947.509) [-1950.518] (-1948.804) (-1949.737) -- 0:00:55 67500 -- (-1962.528) (-1948.124) (-1947.695) [-1947.805] * [-1947.449] (-1948.180) (-1949.508) (-1948.246) -- 0:01:09 68000 -- (-1957.705) [-1947.266] (-1947.796) (-1947.581) * [-1948.785] (-1949.071) (-1949.919) (-1947.992) -- 0:01:08 68500 -- [-1952.016] (-1948.634) (-1949.057) (-1949.758) * [-1949.135] (-1948.402) (-1948.096) (-1948.081) -- 0:01:07 69000 -- [-1960.440] (-1948.255) (-1951.393) (-1947.753) * (-1948.714) (-1949.598) [-1949.089] (-1948.318) -- 0:01:07 69500 -- [-1954.427] (-1949.224) (-1950.987) (-1947.889) * [-1949.583] (-1953.006) (-1948.514) (-1950.146) -- 0:01:06 70000 -- (-1953.274) [-1949.359] (-1947.543) (-1946.879) * (-1947.941) (-1952.851) (-1950.434) [-1949.399] -- 0:01:06 Average standard deviation of split frequencies: 0.022119 70500 -- (-1959.022) [-1950.198] (-1947.411) (-1950.810) * (-1947.453) (-1950.418) (-1948.370) [-1948.894] -- 0:01:05 71000 -- (-1957.117) [-1948.698] (-1949.381) (-1952.045) * [-1947.453] (-1950.425) (-1948.447) (-1949.617) -- 0:01:05 71500 -- (-1952.296) (-1951.267) (-1947.348) [-1946.615] * (-1947.535) (-1951.062) [-1947.925] (-1949.368) -- 0:01:04 72000 -- (-1958.268) [-1949.737] (-1948.438) (-1946.683) * (-1948.245) [-1950.971] (-1948.018) (-1950.371) -- 0:01:04 72500 -- [-1953.633] (-1947.576) (-1948.854) (-1949.091) * (-1949.002) (-1952.474) [-1949.702] (-1948.996) -- 0:01:03 73000 -- (-1956.665) (-1949.101) [-1948.845] (-1947.317) * (-1948.589) (-1948.670) (-1952.165) [-1948.436] -- 0:01:03 73500 -- (-1961.719) (-1949.959) (-1947.527) [-1947.920] * (-1948.964) (-1947.771) (-1947.004) [-1951.544] -- 0:01:03 74000 -- [-1953.140] (-1952.001) (-1947.691) (-1946.792) * [-1947.321] (-1947.654) (-1949.462) (-1948.654) -- 0:01:02 74500 -- (-1949.680) (-1950.738) [-1947.646] (-1947.174) * [-1947.251] (-1948.384) (-1947.955) (-1950.440) -- 0:01:02 75000 -- (-1949.509) [-1947.935] (-1947.477) (-1948.418) * (-1949.772) [-1947.095] (-1949.440) (-1947.168) -- 0:01:01 Average standard deviation of split frequencies: 0.024158 75500 -- (-1951.463) (-1949.948) [-1947.804] (-1948.986) * (-1948.395) (-1948.954) (-1951.268) [-1947.888] -- 0:01:01 76000 -- (-1952.981) (-1949.247) [-1948.371] (-1950.060) * (-1948.021) [-1951.575] (-1947.923) (-1952.793) -- 0:01:00 76500 -- (-1949.814) (-1947.474) [-1947.506] (-1948.360) * (-1946.806) (-1948.311) (-1948.002) [-1947.206] -- 0:01:00 77000 -- (-1950.947) [-1947.192] (-1947.899) (-1950.486) * (-1952.212) [-1951.441] (-1950.193) (-1948.006) -- 0:00:59 77500 -- (-1953.155) (-1948.223) [-1947.698] (-1948.275) * [-1948.971] (-1949.926) (-1950.009) (-1948.775) -- 0:00:59 78000 -- (-1947.768) (-1947.858) (-1947.253) [-1950.824] * (-1955.503) (-1951.511) (-1948.964) [-1950.499] -- 0:00:59 78500 -- (-1947.844) [-1947.300] (-1947.751) (-1950.831) * (-1955.752) [-1947.960] (-1949.565) (-1951.199) -- 0:00:58 79000 -- [-1948.837] (-1948.077) (-1947.612) (-1948.627) * (-1951.525) (-1948.533) [-1948.397] (-1950.247) -- 0:00:58 79500 -- (-1947.480) (-1948.349) (-1947.486) [-1950.971] * (-1947.359) (-1947.275) [-1947.790] (-1951.776) -- 0:00:57 80000 -- (-1951.715) [-1948.882] (-1947.454) (-1951.553) * [-1947.347] (-1950.962) (-1948.666) (-1952.299) -- 0:00:57 Average standard deviation of split frequencies: 0.022726 80500 -- (-1953.083) (-1949.412) [-1947.546] (-1949.904) * (-1948.035) (-1951.592) [-1948.782] (-1949.495) -- 0:00:57 81000 -- (-1949.214) [-1947.391] (-1947.509) (-1950.579) * (-1955.302) (-1951.248) (-1949.619) [-1950.462] -- 0:00:56 81500 -- (-1949.705) (-1947.925) [-1948.139] (-1950.778) * (-1954.627) (-1949.948) (-1949.733) [-1947.630] -- 0:00:56 82000 -- (-1947.912) (-1949.777) [-1948.112] (-1948.754) * (-1954.814) [-1950.197] (-1949.965) (-1947.743) -- 0:00:55 82500 -- (-1950.098) (-1954.956) (-1947.702) [-1948.374] * (-1951.916) [-1948.693] (-1948.569) (-1948.896) -- 0:00:55 83000 -- (-1948.766) (-1951.740) [-1947.828] (-1954.556) * (-1953.341) (-1950.749) [-1947.417] (-1949.473) -- 0:01:06 83500 -- (-1948.378) (-1952.430) [-1950.124] (-1954.215) * [-1947.059] (-1948.375) (-1947.312) (-1949.169) -- 0:01:05 84000 -- [-1949.736] (-1948.192) (-1950.448) (-1953.423) * (-1947.042) (-1946.687) [-1946.524] (-1949.231) -- 0:01:05 84500 -- (-1948.010) [-1949.182] (-1950.856) (-1949.829) * (-1951.857) (-1947.802) (-1947.976) [-1949.496] -- 0:01:05 85000 -- (-1951.295) [-1949.335] (-1950.829) (-1949.393) * (-1949.940) (-1948.082) (-1948.461) [-1948.764] -- 0:01:04 Average standard deviation of split frequencies: 0.022474 85500 -- (-1948.670) (-1949.117) [-1950.541] (-1951.093) * (-1948.304) [-1950.781] (-1949.657) (-1948.417) -- 0:01:04 86000 -- (-1951.585) (-1948.474) [-1949.446] (-1948.381) * [-1949.748] (-1948.259) (-1946.934) (-1950.330) -- 0:01:03 86500 -- (-1947.138) (-1949.552) (-1949.540) [-1948.870] * (-1948.992) (-1950.057) [-1947.793] (-1950.494) -- 0:01:03 87000 -- [-1948.063] (-1949.103) (-1949.619) (-1951.689) * (-1949.602) (-1949.223) [-1947.248] (-1948.684) -- 0:01:02 87500 -- (-1947.933) [-1947.055] (-1949.219) (-1949.248) * (-1950.671) (-1949.336) (-1952.006) [-1949.624] -- 0:01:02 88000 -- (-1947.205) (-1952.345) (-1949.420) [-1948.351] * (-1948.395) (-1947.538) [-1949.783] (-1949.321) -- 0:01:02 88500 -- (-1947.865) (-1951.976) (-1950.488) [-1948.339] * (-1947.951) (-1948.972) (-1952.980) [-1948.735] -- 0:01:01 89000 -- (-1950.964) (-1952.414) (-1951.593) [-1949.573] * [-1948.366] (-1948.268) (-1951.104) (-1949.281) -- 0:01:01 89500 -- (-1951.153) (-1947.382) (-1952.839) [-1948.524] * [-1950.309] (-1950.397) (-1947.677) (-1952.060) -- 0:01:01 90000 -- (-1952.330) [-1947.489] (-1951.797) (-1948.034) * [-1951.642] (-1951.052) (-1948.486) (-1951.587) -- 0:01:00 Average standard deviation of split frequencies: 0.023273 90500 -- (-1948.853) (-1947.590) (-1948.365) [-1947.771] * (-1949.099) (-1950.149) [-1949.875] (-1954.433) -- 0:01:00 91000 -- [-1949.810] (-1947.619) (-1947.533) (-1947.719) * [-1952.993] (-1950.439) (-1950.196) (-1947.387) -- 0:00:59 91500 -- (-1951.843) [-1950.555] (-1949.328) (-1947.818) * (-1954.069) (-1948.183) [-1948.212] (-1946.804) -- 0:00:59 92000 -- (-1949.811) (-1949.926) (-1948.360) [-1951.043] * (-1949.793) (-1948.118) (-1947.312) [-1947.505] -- 0:00:59 92500 -- (-1951.383) (-1947.092) (-1949.780) [-1948.638] * (-1952.026) (-1948.724) (-1951.009) [-1948.323] -- 0:00:58 93000 -- (-1949.305) (-1947.777) [-1947.852] (-1950.383) * (-1949.994) (-1948.727) (-1951.103) [-1946.940] -- 0:00:58 93500 -- (-1951.500) (-1948.181) [-1949.469] (-1947.091) * (-1953.252) (-1947.502) (-1948.027) [-1947.363] -- 0:00:58 94000 -- (-1951.019) [-1948.557] (-1949.086) (-1947.083) * (-1952.039) [-1947.822] (-1953.657) (-1949.359) -- 0:00:57 94500 -- (-1959.694) (-1947.202) (-1946.753) [-1946.990] * (-1950.689) (-1950.111) (-1955.313) [-1949.161] -- 0:00:57 95000 -- (-1952.530) (-1953.605) (-1948.512) [-1947.088] * (-1949.039) [-1950.275] (-1949.616) (-1949.552) -- 0:00:57 Average standard deviation of split frequencies: 0.026762 95500 -- (-1951.162) (-1953.315) (-1948.553) [-1947.777] * [-1948.168] (-1949.229) (-1951.766) (-1947.795) -- 0:00:56 96000 -- (-1950.628) (-1952.741) (-1948.482) [-1948.142] * (-1948.051) [-1949.222] (-1952.444) (-1948.196) -- 0:00:56 96500 -- [-1948.443] (-1952.343) (-1948.019) (-1947.214) * [-1953.692] (-1949.562) (-1952.120) (-1950.937) -- 0:00:56 97000 -- (-1952.367) (-1951.620) [-1947.854] (-1947.651) * (-1951.699) [-1949.082] (-1951.503) (-1948.013) -- 0:00:55 97500 -- [-1947.931] (-1952.501) (-1949.338) (-1949.132) * [-1948.311] (-1949.525) (-1949.125) (-1947.882) -- 0:00:55 98000 -- (-1948.565) [-1950.274] (-1948.712) (-1949.229) * [-1949.676] (-1950.005) (-1950.183) (-1950.254) -- 0:00:55 98500 -- (-1948.335) [-1947.921] (-1948.241) (-1949.004) * (-1947.226) (-1952.319) [-1948.084] (-1952.939) -- 0:01:04 99000 -- (-1949.548) [-1953.314] (-1948.369) (-1949.059) * (-1947.434) [-1949.672] (-1947.732) (-1951.385) -- 0:01:03 99500 -- (-1948.489) [-1948.573] (-1947.475) (-1949.098) * (-1947.410) (-1950.630) [-1951.110] (-1949.468) -- 0:01:03 100000 -- (-1948.927) [-1947.848] (-1947.468) (-1950.548) * (-1948.788) (-1949.659) [-1948.138] (-1947.835) -- 0:01:02 Average standard deviation of split frequencies: 0.026865 100500 -- (-1948.136) (-1948.152) (-1948.825) [-1949.953] * (-1953.529) (-1949.568) [-1949.119] (-1949.125) -- 0:01:02 101000 -- (-1948.476) [-1949.310] (-1947.557) (-1952.575) * (-1951.203) (-1948.382) (-1949.820) [-1949.508] -- 0:01:02 101500 -- (-1952.223) [-1947.526] (-1948.191) (-1946.960) * (-1947.845) (-1948.549) [-1950.176] (-1948.202) -- 0:01:01 102000 -- (-1950.250) (-1949.239) [-1949.255] (-1946.961) * (-1947.339) [-1948.189] (-1950.519) (-1950.640) -- 0:01:01 102500 -- (-1950.640) (-1947.245) [-1949.221] (-1947.404) * [-1948.057] (-1948.125) (-1951.812) (-1950.100) -- 0:01:01 103000 -- (-1949.670) (-1947.392) [-1949.022] (-1947.950) * [-1947.880] (-1949.661) (-1951.940) (-1949.884) -- 0:01:00 103500 -- (-1950.039) [-1946.778] (-1949.070) (-1949.631) * (-1947.629) [-1948.696] (-1947.597) (-1949.502) -- 0:01:00 104000 -- (-1950.026) (-1946.839) (-1947.287) [-1947.620] * (-1947.488) [-1948.512] (-1947.604) (-1950.693) -- 0:01:00 104500 -- (-1948.146) (-1947.638) (-1948.927) [-1948.331] * (-1947.487) (-1948.213) [-1947.061] (-1949.789) -- 0:00:59 105000 -- (-1948.757) (-1948.543) (-1947.945) [-1950.319] * (-1948.433) (-1948.033) [-1947.001] (-1950.229) -- 0:00:59 Average standard deviation of split frequencies: 0.024811 105500 -- (-1947.150) [-1947.944] (-1947.383) (-1948.050) * (-1948.907) [-1947.847] (-1947.724) (-1949.654) -- 0:00:59 106000 -- (-1947.213) [-1947.673] (-1947.286) (-1947.885) * (-1948.371) [-1947.907] (-1947.391) (-1949.825) -- 0:00:59 106500 -- (-1947.818) [-1948.801] (-1953.195) (-1947.885) * [-1948.070] (-1947.383) (-1948.691) (-1950.464) -- 0:00:58 107000 -- (-1948.518) (-1949.477) [-1949.316] (-1949.295) * (-1949.653) (-1947.346) [-1947.957] (-1948.660) -- 0:00:58 107500 -- (-1947.336) [-1948.952] (-1948.892) (-1946.653) * (-1949.691) [-1948.512] (-1948.758) (-1951.565) -- 0:00:58 108000 -- (-1946.651) (-1948.616) [-1950.542] (-1947.694) * (-1948.253) (-1950.512) [-1947.350] (-1952.150) -- 0:00:57 108500 -- (-1946.692) [-1948.543] (-1951.972) (-1947.264) * (-1948.522) (-1951.170) (-1950.860) [-1949.335] -- 0:00:57 109000 -- [-1947.050] (-1951.935) (-1949.886) (-1946.694) * [-1947.072] (-1948.368) (-1947.399) (-1948.279) -- 0:00:57 109500 -- (-1949.737) [-1949.904] (-1950.715) (-1946.611) * [-1946.833] (-1949.478) (-1949.042) (-1948.590) -- 0:00:56 110000 -- (-1947.897) (-1948.126) (-1950.431) [-1946.996] * (-1948.696) (-1950.851) [-1947.131] (-1948.593) -- 0:00:56 Average standard deviation of split frequencies: 0.021747 110500 -- [-1946.579] (-1950.450) (-1949.932) (-1948.235) * (-1950.416) (-1948.528) [-1947.923] (-1948.597) -- 0:00:56 111000 -- [-1947.227] (-1950.472) (-1947.555) (-1949.612) * (-1950.128) (-1947.952) (-1948.799) [-1947.546] -- 0:00:56 111500 -- (-1948.116) (-1950.444) [-1947.619] (-1947.607) * (-1949.381) [-1947.275] (-1949.903) (-1948.343) -- 0:00:55 112000 -- (-1947.616) [-1948.550] (-1947.664) (-1947.607) * (-1950.106) (-1947.945) (-1947.434) [-1947.374] -- 0:00:55 112500 -- (-1947.612) (-1948.788) (-1948.846) [-1949.568] * (-1949.738) (-1948.466) (-1950.736) [-1947.301] -- 0:00:55 113000 -- (-1947.848) (-1952.520) [-1950.341] (-1951.235) * [-1949.196] (-1948.355) (-1951.085) (-1949.181) -- 0:00:54 113500 -- (-1950.090) (-1953.049) [-1947.949] (-1948.955) * [-1950.518] (-1950.051) (-1948.288) (-1948.497) -- 0:01:02 114000 -- [-1948.938] (-1952.402) (-1947.473) (-1950.133) * (-1954.690) (-1949.418) [-1947.398] (-1947.568) -- 0:01:02 114500 -- (-1951.344) (-1949.879) [-1947.571] (-1948.322) * (-1947.178) (-1950.568) (-1947.432) [-1947.371] -- 0:01:01 115000 -- [-1947.173] (-1952.211) (-1947.049) (-1951.655) * (-1947.744) (-1949.178) [-1947.495] (-1947.465) -- 0:01:01 Average standard deviation of split frequencies: 0.020319 115500 -- [-1948.453] (-1951.281) (-1947.240) (-1950.579) * (-1947.686) [-1950.235] (-1948.141) (-1949.496) -- 0:01:01 116000 -- (-1948.905) (-1952.321) [-1947.151] (-1949.422) * [-1946.679] (-1952.627) (-1947.901) (-1947.742) -- 0:01:00 116500 -- (-1946.972) (-1950.322) (-1947.277) [-1949.249] * (-1947.176) [-1951.666] (-1950.755) (-1947.845) -- 0:01:00 117000 -- (-1947.326) (-1947.992) (-1947.560) [-1948.593] * (-1947.956) [-1952.093] (-1950.788) (-1950.107) -- 0:01:00 117500 -- (-1948.469) (-1947.045) [-1947.638] (-1950.595) * (-1950.937) (-1947.548) [-1950.003] (-1953.911) -- 0:01:00 118000 -- (-1947.806) (-1947.047) (-1947.643) [-1949.952] * (-1949.250) (-1949.672) [-1950.920] (-1950.201) -- 0:00:59 118500 -- (-1949.693) (-1947.207) [-1948.631] (-1949.892) * (-1952.145) (-1950.287) (-1953.039) [-1950.468] -- 0:00:59 119000 -- (-1949.610) (-1947.193) (-1952.293) [-1949.382] * (-1946.910) [-1948.576] (-1948.275) (-1947.637) -- 0:00:59 119500 -- (-1949.451) [-1947.496] (-1948.450) (-1952.495) * (-1948.688) [-1947.734] (-1948.554) (-1949.966) -- 0:00:58 120000 -- (-1950.447) (-1947.073) (-1949.886) [-1952.215] * (-1949.792) (-1947.668) [-1952.260] (-1947.430) -- 0:00:58 Average standard deviation of split frequencies: 0.019739 120500 -- (-1951.931) [-1947.260] (-1950.321) (-1947.679) * (-1947.247) (-1947.417) (-1948.393) [-1947.185] -- 0:00:58 121000 -- (-1949.778) (-1947.463) [-1948.422] (-1949.138) * (-1946.709) (-1947.919) (-1947.251) [-1948.967] -- 0:00:58 121500 -- (-1949.713) [-1947.948] (-1949.247) (-1947.714) * (-1946.639) (-1948.436) [-1947.108] (-1948.959) -- 0:00:57 122000 -- (-1956.207) [-1950.515] (-1947.698) (-1947.126) * (-1947.834) (-1947.570) (-1947.469) [-1948.661] -- 0:00:57 122500 -- [-1950.641] (-1947.167) (-1949.458) (-1947.096) * (-1950.979) (-1947.778) (-1946.765) [-1949.225] -- 0:00:57 123000 -- (-1951.498) [-1947.515] (-1954.564) (-1946.666) * (-1952.734) [-1949.050] (-1947.396) (-1949.201) -- 0:00:57 123500 -- [-1950.295] (-1947.813) (-1953.499) (-1947.233) * (-1948.217) (-1949.347) [-1947.959] (-1948.247) -- 0:00:56 124000 -- (-1952.451) (-1948.760) [-1951.552] (-1947.194) * (-1953.929) (-1948.067) (-1948.678) [-1948.448] -- 0:00:56 124500 -- (-1951.243) [-1948.552] (-1952.509) (-1947.891) * (-1947.748) (-1947.792) (-1946.803) [-1948.793] -- 0:00:56 125000 -- (-1950.422) (-1948.711) [-1947.960] (-1950.099) * (-1952.437) (-1946.895) (-1949.858) [-1949.394] -- 0:00:56 Average standard deviation of split frequencies: 0.020161 125500 -- (-1952.053) [-1949.936] (-1948.259) (-1951.179) * [-1947.297] (-1949.413) (-1949.527) (-1948.112) -- 0:00:55 126000 -- (-1948.593) (-1956.851) [-1947.167] (-1955.951) * (-1947.269) [-1948.587] (-1948.804) (-1947.926) -- 0:00:55 126500 -- (-1948.156) (-1948.550) (-1947.167) [-1955.415] * (-1948.782) [-1947.131] (-1949.243) (-1947.939) -- 0:00:55 127000 -- (-1948.211) [-1947.488] (-1947.533) (-1952.903) * (-1946.748) (-1948.912) (-1949.272) [-1947.014] -- 0:00:54 127500 -- (-1948.659) (-1948.352) (-1947.533) [-1950.773] * [-1946.699] (-1947.107) (-1948.903) (-1947.820) -- 0:00:54 128000 -- (-1948.332) [-1952.586] (-1947.803) (-1952.064) * (-1946.635) (-1947.462) [-1949.818] (-1950.916) -- 0:00:54 128500 -- (-1948.338) [-1950.179] (-1948.043) (-1948.505) * (-1948.004) (-1948.349) (-1948.890) [-1951.569] -- 0:00:54 129000 -- (-1949.248) [-1951.982] (-1948.917) (-1951.678) * (-1947.821) (-1949.554) (-1947.650) [-1947.653] -- 0:01:00 129500 -- [-1948.459] (-1951.951) (-1946.704) (-1953.860) * (-1954.277) (-1946.618) (-1947.968) [-1947.423] -- 0:01:00 130000 -- [-1948.395] (-1946.713) (-1947.794) (-1952.828) * [-1952.234] (-1946.535) (-1950.134) (-1950.930) -- 0:01:00 Average standard deviation of split frequencies: 0.019842 130500 -- (-1947.677) (-1946.961) [-1947.320] (-1952.340) * (-1952.130) (-1950.625) [-1947.836] (-1949.227) -- 0:00:59 131000 -- (-1947.546) [-1947.085] (-1947.285) (-1950.486) * (-1951.403) (-1947.280) (-1947.904) [-1950.636] -- 0:00:59 131500 -- (-1947.324) [-1946.863] (-1947.995) (-1949.773) * [-1949.475] (-1948.091) (-1949.603) (-1950.803) -- 0:00:59 132000 -- (-1949.467) [-1946.888] (-1947.995) (-1951.807) * (-1948.197) (-1947.452) (-1948.111) [-1948.293] -- 0:00:59 132500 -- (-1951.143) [-1948.197] (-1946.741) (-1948.941) * (-1949.970) [-1947.198] (-1949.334) (-1949.490) -- 0:00:58 133000 -- [-1948.262] (-1949.526) (-1946.741) (-1949.402) * (-1950.447) [-1947.956] (-1948.231) (-1947.496) -- 0:00:58 133500 -- [-1949.116] (-1953.081) (-1947.552) (-1948.836) * (-1951.450) (-1947.956) (-1947.893) [-1952.124] -- 0:00:58 134000 -- [-1948.533] (-1953.395) (-1947.121) (-1950.292) * [-1951.574] (-1947.179) (-1948.821) (-1951.738) -- 0:00:58 134500 -- [-1947.517] (-1951.784) (-1947.100) (-1948.194) * (-1950.225) [-1947.581] (-1947.904) (-1947.606) -- 0:00:57 135000 -- (-1947.447) (-1951.891) (-1946.955) [-1947.439] * (-1954.759) (-1948.402) (-1949.078) [-1947.570] -- 0:00:57 Average standard deviation of split frequencies: 0.017696 135500 -- (-1947.779) [-1949.969] (-1947.176) (-1947.217) * (-1952.282) [-1951.472] (-1949.137) (-1947.961) -- 0:00:57 136000 -- (-1948.175) (-1954.704) (-1947.519) [-1947.325] * (-1952.267) [-1952.352] (-1952.676) (-1949.761) -- 0:00:57 136500 -- (-1948.047) (-1954.417) [-1950.229] (-1948.305) * (-1950.722) (-1955.789) [-1950.484] (-1948.923) -- 0:00:56 137000 -- (-1948.294) (-1950.545) (-1948.626) [-1948.146] * (-1947.323) (-1953.194) [-1949.540] (-1947.291) -- 0:00:56 137500 -- [-1947.719] (-1949.263) (-1951.487) (-1948.153) * (-1946.721) (-1950.092) [-1948.925] (-1947.733) -- 0:00:56 138000 -- (-1948.859) (-1950.150) (-1952.068) [-1948.701] * (-1947.190) (-1950.133) [-1948.688] (-1947.033) -- 0:00:56 138500 -- (-1953.194) (-1949.469) (-1950.131) [-1950.672] * (-1948.125) (-1950.976) [-1950.702] (-1947.315) -- 0:00:55 139000 -- (-1952.164) (-1949.486) (-1949.318) [-1950.664] * (-1949.924) (-1950.420) [-1948.624] (-1949.906) -- 0:00:55 139500 -- [-1950.604] (-1951.794) (-1950.394) (-1947.419) * (-1949.467) [-1949.736] (-1948.749) (-1949.677) -- 0:00:55 140000 -- (-1951.866) (-1951.155) [-1949.116] (-1947.452) * [-1947.024] (-1951.599) (-1950.578) (-1947.794) -- 0:00:55 Average standard deviation of split frequencies: 0.019516 140500 -- [-1951.122] (-1955.807) (-1951.268) (-1947.270) * (-1947.920) (-1948.972) (-1948.750) [-1949.073] -- 0:00:55 141000 -- (-1951.627) [-1948.566] (-1952.940) (-1949.545) * (-1948.527) [-1950.496] (-1951.761) (-1947.280) -- 0:00:54 141500 -- (-1950.147) (-1949.772) (-1950.462) [-1951.194] * (-1948.281) (-1950.490) [-1949.091] (-1948.055) -- 0:00:54 142000 -- (-1948.188) (-1949.407) (-1949.389) [-1951.575] * (-1947.877) (-1946.822) [-1948.926] (-1947.506) -- 0:00:54 142500 -- (-1947.552) (-1949.325) [-1950.349] (-1952.778) * (-1947.601) [-1947.376] (-1947.806) (-1947.689) -- 0:00:54 143000 -- [-1947.469] (-1948.518) (-1948.470) (-1952.244) * (-1947.875) (-1948.874) [-1947.898] (-1948.291) -- 0:00:53 143500 -- (-1947.756) (-1951.070) [-1949.765] (-1947.784) * (-1947.402) (-1948.265) [-1948.042] (-1948.807) -- 0:00:53 144000 -- (-1947.190) [-1951.484] (-1950.361) (-1949.492) * (-1948.145) (-1947.490) [-1948.514] (-1950.429) -- 0:00:53 144500 -- [-1947.541] (-1950.228) (-1950.560) (-1955.097) * (-1948.083) (-1948.566) [-1949.607] (-1950.056) -- 0:00:59 145000 -- (-1948.578) [-1951.934] (-1949.898) (-1953.800) * (-1949.673) (-1947.328) [-1948.566] (-1952.669) -- 0:00:58 Average standard deviation of split frequencies: 0.019033 145500 -- (-1950.634) (-1950.038) (-1949.427) [-1949.326] * (-1951.171) (-1947.935) (-1948.966) [-1949.419] -- 0:00:58 146000 -- (-1948.270) (-1948.735) (-1952.352) [-1947.901] * (-1949.420) [-1947.202] (-1947.387) (-1955.528) -- 0:00:58 146500 -- [-1947.597] (-1952.581) (-1946.955) (-1947.599) * (-1950.095) (-1947.886) [-1947.935] (-1953.526) -- 0:00:58 147000 -- (-1948.242) (-1947.757) [-1949.210] (-1951.596) * (-1949.143) (-1956.103) [-1950.809] (-1951.617) -- 0:00:58 147500 -- [-1948.004] (-1949.079) (-1948.510) (-1949.547) * [-1948.483] (-1947.774) (-1948.774) (-1951.036) -- 0:00:57 148000 -- (-1948.198) (-1949.402) (-1948.354) [-1947.581] * (-1950.791) (-1951.683) (-1947.243) [-1947.795] -- 0:00:57 148500 -- (-1954.599) (-1948.838) [-1948.137] (-1950.280) * (-1950.047) (-1949.831) [-1947.243] (-1951.734) -- 0:00:57 149000 -- (-1949.131) [-1947.181] (-1953.013) (-1948.684) * (-1950.922) (-1949.389) [-1947.615] (-1949.052) -- 0:00:57 149500 -- (-1948.994) (-1948.345) [-1947.508] (-1949.620) * [-1949.744] (-1950.595) (-1947.743) (-1948.238) -- 0:00:56 150000 -- (-1948.590) [-1947.631] (-1949.675) (-1949.139) * (-1948.533) (-1950.103) (-1946.727) [-1948.464] -- 0:00:56 Average standard deviation of split frequencies: 0.018114 150500 -- [-1947.505] (-1947.065) (-1950.782) (-1948.441) * (-1947.457) [-1948.147] (-1947.370) (-1947.683) -- 0:00:56 151000 -- (-1951.679) (-1946.810) [-1948.725] (-1948.441) * (-1947.329) (-1948.226) (-1949.606) [-1948.334] -- 0:00:56 151500 -- [-1950.693] (-1947.895) (-1947.473) (-1951.175) * [-1947.601] (-1948.226) (-1949.091) (-1948.996) -- 0:00:56 152000 -- (-1950.059) (-1947.377) (-1946.972) [-1948.132] * [-1947.270] (-1947.994) (-1949.092) (-1948.804) -- 0:00:55 152500 -- [-1947.003] (-1951.896) (-1948.069) (-1952.611) * (-1946.568) (-1952.401) [-1952.305] (-1962.227) -- 0:00:55 153000 -- [-1947.504] (-1952.413) (-1948.069) (-1949.338) * (-1946.624) (-1951.488) (-1948.776) [-1953.117] -- 0:00:55 153500 -- (-1949.680) (-1948.162) (-1949.009) [-1948.684] * (-1946.672) (-1948.482) (-1950.718) [-1948.364] -- 0:00:55 154000 -- [-1947.543] (-1948.481) (-1948.942) (-1947.897) * (-1946.788) (-1949.476) (-1949.776) [-1950.706] -- 0:00:54 154500 -- [-1947.476] (-1948.223) (-1947.359) (-1952.943) * [-1947.127] (-1948.746) (-1947.248) (-1949.587) -- 0:00:54 155000 -- (-1946.636) (-1948.485) (-1947.004) [-1952.777] * (-1947.125) (-1947.092) (-1948.759) [-1947.624] -- 0:00:54 Average standard deviation of split frequencies: 0.018970 155500 -- (-1948.570) [-1948.234] (-1946.885) (-1951.482) * [-1949.338] (-1948.960) (-1950.779) (-1953.217) -- 0:00:54 156000 -- (-1948.692) [-1948.941] (-1947.893) (-1953.897) * (-1947.399) [-1950.926] (-1953.094) (-1953.467) -- 0:00:54 156500 -- (-1947.933) [-1947.367] (-1950.548) (-1956.697) * (-1947.994) (-1949.358) (-1949.389) [-1952.054] -- 0:00:53 157000 -- [-1948.159] (-1947.843) (-1950.849) (-1953.446) * (-1947.495) (-1948.860) [-1951.090] (-1947.165) -- 0:00:53 157500 -- (-1948.526) [-1946.935] (-1949.754) (-1949.222) * (-1947.473) (-1950.967) (-1947.305) [-1948.688] -- 0:00:53 158000 -- (-1950.398) (-1946.896) (-1949.963) [-1948.758] * (-1947.141) (-1951.985) (-1946.825) [-1950.865] -- 0:00:53 158500 -- (-1950.870) (-1947.384) (-1947.784) [-1950.642] * [-1947.986] (-1950.275) (-1947.356) (-1948.642) -- 0:00:53 159000 -- (-1947.686) [-1948.835] (-1949.724) (-1956.846) * (-1948.217) [-1947.673] (-1949.200) (-1948.672) -- 0:00:52 159500 -- (-1947.821) [-1947.446] (-1949.528) (-1949.181) * (-1947.755) (-1947.428) (-1947.832) [-1948.597] -- 0:00:52 160000 -- (-1950.456) (-1947.200) [-1948.916] (-1949.076) * (-1947.388) [-1948.242] (-1949.994) (-1954.727) -- 0:00:57 Average standard deviation of split frequencies: 0.016137 160500 -- [-1948.460] (-1947.835) (-1949.485) (-1948.358) * (-1947.008) (-1948.369) [-1948.501] (-1947.455) -- 0:00:57 161000 -- (-1948.567) [-1951.083] (-1950.147) (-1948.508) * [-1952.324] (-1947.951) (-1949.702) (-1947.338) -- 0:00:57 161500 -- [-1949.137] (-1949.149) (-1947.565) (-1949.450) * (-1950.316) (-1946.832) [-1948.551] (-1949.365) -- 0:00:57 162000 -- [-1952.016] (-1950.543) (-1948.582) (-1951.571) * (-1952.839) (-1947.521) [-1948.008] (-1949.077) -- 0:00:56 162500 -- (-1949.939) (-1950.296) (-1948.238) [-1950.799] * (-1950.254) (-1953.902) [-1947.334] (-1948.442) -- 0:00:56 163000 -- (-1949.736) (-1948.789) (-1949.183) [-1949.816] * (-1949.024) (-1947.513) (-1947.443) [-1948.088] -- 0:00:56 163500 -- [-1949.129] (-1950.123) (-1948.937) (-1952.048) * (-1948.826) [-1951.311] (-1950.300) (-1947.970) -- 0:00:56 164000 -- (-1949.471) [-1947.476] (-1949.404) (-1950.307) * (-1948.203) [-1951.194] (-1948.539) (-1948.774) -- 0:00:56 164500 -- (-1955.741) [-1949.409] (-1949.128) (-1951.760) * (-1950.472) (-1950.642) (-1948.097) [-1951.762] -- 0:00:55 165000 -- (-1953.561) [-1947.836] (-1950.363) (-1952.778) * [-1948.589] (-1949.613) (-1947.485) (-1952.081) -- 0:00:55 Average standard deviation of split frequencies: 0.017354 165500 -- (-1949.571) (-1948.675) (-1948.903) [-1950.334] * [-1948.903] (-1949.324) (-1950.035) (-1952.451) -- 0:00:55 166000 -- (-1951.802) [-1947.850] (-1951.641) (-1947.076) * (-1950.236) (-1947.761) [-1949.470] (-1951.096) -- 0:00:55 166500 -- (-1948.521) (-1948.271) [-1950.289] (-1947.508) * (-1951.452) (-1948.195) [-1950.381] (-1952.208) -- 0:00:55 167000 -- (-1949.054) [-1947.710] (-1949.807) (-1949.326) * [-1949.589] (-1947.402) (-1950.837) (-1949.415) -- 0:00:54 167500 -- [-1947.077] (-1947.391) (-1949.698) (-1949.810) * (-1950.413) (-1949.710) (-1948.953) [-1949.959] -- 0:00:54 168000 -- (-1948.276) (-1948.829) (-1947.661) [-1948.972] * (-1951.545) (-1947.465) (-1949.051) [-1950.617] -- 0:00:54 168500 -- [-1949.541] (-1949.758) (-1947.663) (-1949.155) * (-1948.107) (-1947.630) [-1948.259] (-1949.556) -- 0:00:54 169000 -- [-1949.670] (-1950.898) (-1947.566) (-1948.552) * [-1947.977] (-1947.300) (-1950.743) (-1947.766) -- 0:00:54 169500 -- [-1951.806] (-1948.639) (-1947.644) (-1949.226) * (-1950.150) [-1947.268] (-1953.324) (-1947.873) -- 0:00:53 170000 -- [-1952.317] (-1957.211) (-1948.540) (-1952.884) * (-1948.858) (-1950.501) [-1953.393] (-1950.067) -- 0:00:53 Average standard deviation of split frequencies: 0.017187 170500 -- (-1952.438) [-1950.435] (-1948.507) (-1950.707) * (-1951.878) (-1953.347) (-1948.553) [-1946.906] -- 0:00:53 171000 -- (-1951.291) (-1946.709) [-1948.464] (-1947.372) * (-1948.769) (-1955.736) (-1947.789) [-1947.894] -- 0:00:53 171500 -- (-1948.515) [-1946.707] (-1948.642) (-1947.370) * (-1949.082) [-1948.026] (-1947.786) (-1950.268) -- 0:00:53 172000 -- (-1948.317) (-1946.768) [-1947.537] (-1947.483) * (-1949.072) [-1946.855] (-1947.264) (-1948.538) -- 0:00:52 172500 -- (-1952.828) [-1946.637] (-1947.443) (-1949.173) * (-1949.847) (-1947.433) (-1947.924) [-1947.475] -- 0:00:52 173000 -- (-1953.090) (-1946.767) [-1947.269] (-1948.224) * (-1948.096) (-1948.256) (-1950.640) [-1948.365] -- 0:00:52 173500 -- (-1957.398) (-1946.813) (-1947.427) [-1948.719] * (-1948.631) [-1948.007] (-1950.875) (-1949.306) -- 0:00:52 174000 -- (-1949.280) (-1949.818) [-1947.363] (-1948.987) * (-1947.960) [-1949.075] (-1948.358) (-1948.632) -- 0:00:52 174500 -- [-1949.113] (-1951.208) (-1949.470) (-1949.402) * (-1950.277) [-1950.043] (-1948.697) (-1949.222) -- 0:00:52 175000 -- (-1948.909) (-1947.962) (-1949.096) [-1949.629] * [-1946.934] (-1950.862) (-1948.436) (-1948.265) -- 0:00:51 Average standard deviation of split frequencies: 0.016071 175500 -- (-1950.655) (-1948.821) (-1950.890) [-1950.501] * [-1948.430] (-1952.152) (-1949.295) (-1951.299) -- 0:00:56 176000 -- (-1951.529) [-1948.917] (-1947.268) (-1954.695) * (-1948.998) (-1954.031) (-1951.069) [-1947.353] -- 0:00:56 176500 -- (-1948.672) (-1947.410) [-1947.282] (-1952.133) * (-1948.436) (-1949.956) (-1948.346) [-1948.051] -- 0:00:55 177000 -- (-1949.527) [-1949.807] (-1949.243) (-1950.211) * (-1948.974) (-1948.640) [-1949.891] (-1948.091) -- 0:00:55 177500 -- (-1949.527) (-1947.332) [-1948.424] (-1947.528) * (-1946.868) (-1950.048) (-1947.954) [-1948.039] -- 0:00:55 178000 -- (-1952.890) (-1952.754) [-1949.097] (-1948.724) * (-1947.389) [-1947.588] (-1950.476) (-1947.471) -- 0:00:55 178500 -- [-1948.911] (-1952.761) (-1949.288) (-1948.665) * [-1947.354] (-1947.559) (-1948.190) (-1949.155) -- 0:00:55 179000 -- (-1949.841) (-1950.499) [-1949.146] (-1946.648) * (-1947.594) [-1947.557] (-1951.468) (-1953.456) -- 0:00:55 179500 -- (-1950.042) [-1948.336] (-1949.231) (-1946.638) * (-1948.938) (-1947.560) (-1947.712) [-1949.395] -- 0:00:54 180000 -- (-1950.232) (-1948.305) (-1948.175) [-1947.101] * (-1947.612) (-1947.093) (-1948.692) [-1951.541] -- 0:00:54 Average standard deviation of split frequencies: 0.015076 180500 -- (-1953.429) [-1947.027] (-1947.841) (-1947.005) * (-1949.150) (-1948.596) (-1947.159) [-1948.700] -- 0:00:54 181000 -- (-1948.743) [-1947.036] (-1949.364) (-1947.016) * [-1948.716] (-1948.176) (-1947.152) (-1947.698) -- 0:00:54 181500 -- (-1950.331) (-1948.260) [-1948.812] (-1947.083) * (-1948.944) (-1947.069) [-1946.392] (-1947.816) -- 0:00:54 182000 -- (-1949.792) (-1946.862) [-1948.027] (-1949.154) * (-1948.935) (-1948.781) [-1947.172] (-1948.391) -- 0:00:53 182500 -- (-1948.172) (-1946.875) (-1948.679) [-1947.503] * (-1948.752) (-1948.680) (-1946.393) [-1947.710] -- 0:00:53 183000 -- (-1948.921) (-1946.630) [-1946.863] (-1947.889) * (-1949.343) (-1947.877) (-1946.391) [-1947.704] -- 0:00:53 183500 -- (-1949.650) [-1948.051] (-1950.620) (-1950.581) * (-1951.568) (-1949.118) [-1947.247] (-1947.784) -- 0:00:53 184000 -- (-1949.352) (-1947.405) [-1950.071] (-1950.896) * [-1946.783] (-1950.958) (-1946.880) (-1947.998) -- 0:00:53 184500 -- (-1947.825) (-1947.613) [-1948.124] (-1950.043) * (-1947.833) (-1948.125) (-1946.880) [-1948.118] -- 0:00:53 185000 -- (-1948.029) (-1950.838) [-1947.513] (-1947.937) * (-1950.709) [-1948.368] (-1948.236) (-1948.907) -- 0:00:52 Average standard deviation of split frequencies: 0.014540 185500 -- (-1948.492) (-1950.471) [-1948.041] (-1953.397) * (-1950.236) [-1948.453] (-1948.213) (-1949.031) -- 0:00:52 186000 -- (-1949.348) [-1948.358] (-1947.935) (-1953.019) * (-1947.479) (-1947.523) [-1947.660] (-1949.498) -- 0:00:52 186500 -- (-1949.633) [-1948.873] (-1947.446) (-1947.001) * (-1947.926) (-1950.979) [-1946.864] (-1947.552) -- 0:00:52 187000 -- [-1947.644] (-1949.912) (-1948.063) (-1946.791) * (-1948.719) (-1948.454) [-1946.979] (-1949.066) -- 0:00:52 187500 -- [-1948.278] (-1947.407) (-1946.791) (-1948.339) * (-1947.658) (-1948.646) (-1946.851) [-1948.771] -- 0:00:52 188000 -- (-1948.469) (-1947.861) (-1946.694) [-1947.934] * (-1948.042) (-1948.581) [-1947.277] (-1952.288) -- 0:00:51 188500 -- [-1946.696] (-1948.259) (-1946.825) (-1947.841) * [-1948.899] (-1947.630) (-1947.006) (-1953.276) -- 0:00:51 189000 -- (-1946.856) [-1948.760] (-1947.306) (-1949.518) * [-1948.925] (-1947.630) (-1947.004) (-1952.456) -- 0:00:51 189500 -- (-1946.820) (-1949.657) [-1946.590] (-1949.516) * (-1949.266) [-1947.657] (-1949.017) (-1948.146) -- 0:00:51 190000 -- (-1947.013) (-1948.040) [-1947.252] (-1949.369) * (-1952.538) (-1950.427) [-1949.356] (-1948.377) -- 0:00:51 Average standard deviation of split frequencies: 0.013663 190500 -- [-1947.023] (-1950.267) (-1948.152) (-1948.253) * (-1951.307) (-1948.112) [-1948.937] (-1947.480) -- 0:00:55 191000 -- [-1948.250] (-1948.620) (-1947.233) (-1953.192) * [-1949.343] (-1947.949) (-1949.020) (-1948.045) -- 0:00:55 191500 -- (-1947.463) [-1949.214] (-1946.671) (-1948.315) * [-1948.079] (-1950.243) (-1949.761) (-1947.875) -- 0:00:54 192000 -- (-1948.125) (-1949.982) (-1946.671) [-1947.599] * (-1948.849) (-1946.926) (-1952.084) [-1950.060] -- 0:00:54 192500 -- (-1947.782) (-1949.982) [-1946.695] (-1947.862) * (-1950.633) [-1947.092] (-1950.482) (-1950.820) -- 0:00:54 193000 -- (-1947.561) [-1948.255] (-1947.384) (-1947.796) * [-1951.567] (-1946.924) (-1950.777) (-1950.524) -- 0:00:54 193500 -- (-1947.063) (-1947.930) (-1946.852) [-1948.426] * (-1948.837) [-1946.827] (-1951.019) (-1948.170) -- 0:00:54 194000 -- [-1947.986] (-1947.368) (-1948.355) (-1947.198) * (-1950.448) (-1947.048) [-1953.736] (-1949.734) -- 0:00:54 194500 -- (-1949.476) (-1947.217) (-1946.735) [-1946.883] * (-1952.198) [-1947.312] (-1951.137) (-1951.197) -- 0:00:53 195000 -- (-1947.073) (-1949.315) (-1946.723) [-1947.416] * (-1950.227) (-1948.796) [-1949.309] (-1950.266) -- 0:00:53 Average standard deviation of split frequencies: 0.014557 195500 -- (-1951.905) (-1949.264) [-1947.670] (-1946.844) * (-1950.227) [-1948.405] (-1947.627) (-1947.128) -- 0:00:53 196000 -- (-1951.642) [-1949.773] (-1948.931) (-1948.987) * (-1952.524) (-1948.981) (-1948.907) [-1946.933] -- 0:00:53 196500 -- (-1952.857) (-1947.581) (-1949.686) [-1948.649] * (-1952.271) [-1947.173] (-1949.284) (-1947.406) -- 0:00:53 197000 -- [-1950.886] (-1948.699) (-1951.640) (-1951.818) * (-1954.448) (-1947.137) (-1947.748) [-1948.879] -- 0:00:52 197500 -- (-1947.898) (-1948.384) (-1955.351) [-1948.270] * (-1953.668) (-1949.217) (-1947.856) [-1949.513] -- 0:00:52 198000 -- (-1947.667) (-1948.439) (-1951.013) [-1951.817] * (-1952.318) [-1947.708] (-1947.968) (-1949.620) -- 0:00:52 198500 -- [-1948.045] (-1947.870) (-1951.388) (-1948.781) * [-1950.171] (-1949.157) (-1949.210) (-1948.883) -- 0:00:52 199000 -- (-1948.021) [-1947.317] (-1952.380) (-1948.735) * [-1949.636] (-1948.330) (-1950.291) (-1951.747) -- 0:00:52 199500 -- (-1947.434) (-1947.434) (-1951.952) [-1950.067] * (-1947.767) (-1947.166) [-1948.850] (-1949.254) -- 0:00:52 200000 -- [-1949.638] (-1947.875) (-1952.683) (-1949.487) * [-1947.506] (-1947.150) (-1948.560) (-1949.341) -- 0:00:51 Average standard deviation of split frequencies: 0.015579 200500 -- (-1948.109) (-1950.087) (-1951.697) [-1949.078] * [-1948.797] (-1947.467) (-1952.540) (-1951.322) -- 0:00:51 201000 -- (-1950.855) (-1948.801) (-1950.675) [-1948.898] * (-1947.609) (-1947.249) (-1952.765) [-1947.621] -- 0:00:51 201500 -- (-1949.565) (-1951.855) (-1949.504) [-1948.165] * (-1949.279) [-1947.083] (-1957.772) (-1947.368) -- 0:00:51 202000 -- (-1947.473) [-1948.538] (-1948.559) (-1948.380) * (-1947.660) (-1947.513) (-1951.065) [-1949.836] -- 0:00:51 202500 -- (-1949.312) [-1949.724] (-1948.177) (-1948.220) * (-1948.017) (-1947.537) [-1951.191] (-1948.478) -- 0:00:51 203000 -- (-1951.077) (-1948.212) [-1952.204] (-1947.964) * (-1950.158) (-1949.122) [-1951.208] (-1950.053) -- 0:00:51 203500 -- (-1948.517) [-1952.548] (-1953.377) (-1953.238) * (-1949.647) [-1947.452] (-1950.429) (-1953.259) -- 0:00:50 204000 -- (-1951.052) (-1953.377) (-1949.864) [-1952.820] * (-1950.961) (-1947.847) [-1950.240] (-1950.769) -- 0:00:50 204500 -- (-1947.198) (-1951.025) (-1950.338) [-1950.525] * (-1951.088) (-1947.688) [-1948.573] (-1950.545) -- 0:00:50 205000 -- (-1948.527) (-1948.502) [-1948.854] (-1950.569) * (-1949.185) (-1948.753) [-1948.782] (-1948.963) -- 0:00:50 Average standard deviation of split frequencies: 0.014814 205500 -- (-1947.696) (-1950.012) (-1950.879) [-1950.636] * (-1948.079) (-1949.464) [-1949.286] (-1947.631) -- 0:00:50 206000 -- [-1946.864] (-1946.712) (-1949.277) (-1954.650) * (-1948.716) (-1950.389) (-1951.985) [-1950.485] -- 0:00:53 206500 -- (-1946.850) (-1946.482) [-1947.942] (-1955.229) * (-1949.202) (-1953.318) [-1947.989] (-1950.250) -- 0:00:53 207000 -- (-1954.446) (-1948.160) (-1948.483) [-1949.948] * (-1948.968) (-1949.776) (-1949.998) [-1947.131] -- 0:00:53 207500 -- (-1947.198) (-1948.556) (-1947.925) [-1949.476] * (-1950.610) (-1950.375) [-1948.926] (-1947.253) -- 0:00:53 208000 -- (-1946.961) (-1949.887) [-1948.171] (-1950.586) * (-1947.990) (-1948.253) [-1950.304] (-1948.100) -- 0:00:53 208500 -- (-1947.237) (-1949.609) [-1947.316] (-1951.777) * (-1948.473) (-1953.442) (-1953.622) [-1947.972] -- 0:00:53 209000 -- [-1946.849] (-1948.497) (-1948.899) (-1950.220) * (-1948.892) (-1950.963) [-1949.955] (-1949.109) -- 0:00:52 209500 -- (-1947.308) [-1948.362] (-1948.228) (-1950.318) * (-1949.882) (-1951.342) [-1950.319] (-1951.072) -- 0:00:52 210000 -- (-1947.801) [-1948.294] (-1948.117) (-1948.122) * (-1949.089) (-1952.372) (-1948.412) [-1948.405] -- 0:00:52 Average standard deviation of split frequencies: 0.014839 210500 -- (-1947.199) [-1947.500] (-1947.102) (-1949.049) * (-1949.031) (-1952.707) [-1947.536] (-1948.090) -- 0:00:52 211000 -- [-1948.076] (-1948.493) (-1949.148) (-1949.439) * (-1948.692) (-1949.142) [-1953.660] (-1951.626) -- 0:00:52 211500 -- (-1948.733) (-1947.588) (-1947.261) [-1947.573] * (-1949.760) [-1950.834] (-1948.323) (-1951.041) -- 0:00:52 212000 -- [-1948.249] (-1949.740) (-1947.287) (-1947.897) * [-1951.662] (-1947.578) (-1948.117) (-1948.869) -- 0:00:52 212500 -- (-1947.852) (-1947.414) [-1947.248] (-1948.681) * (-1948.517) [-1948.825] (-1947.870) (-1948.905) -- 0:00:51 213000 -- (-1947.168) (-1947.390) (-1947.627) [-1948.362] * (-1952.552) (-1947.918) (-1948.446) [-1948.820] -- 0:00:51 213500 -- (-1947.494) (-1950.666) (-1947.627) [-1949.389] * (-1950.306) (-1947.583) (-1948.501) [-1948.220] -- 0:00:51 214000 -- (-1948.141) (-1949.421) [-1948.623] (-1948.640) * (-1947.100) [-1947.879] (-1950.869) (-1951.081) -- 0:00:51 214500 -- [-1947.985] (-1948.180) (-1947.967) (-1948.255) * (-1947.447) [-1948.004] (-1951.359) (-1950.659) -- 0:00:51 215000 -- (-1948.136) (-1947.096) [-1949.965] (-1948.242) * (-1947.286) (-1947.367) (-1948.582) [-1949.231] -- 0:00:51 Average standard deviation of split frequencies: 0.013324 215500 -- [-1948.088] (-1947.096) (-1948.763) (-1948.252) * [-1947.732] (-1947.532) (-1947.200) (-1950.520) -- 0:00:50 216000 -- [-1948.040] (-1947.373) (-1950.655) (-1950.732) * (-1948.319) [-1948.856] (-1947.252) (-1950.347) -- 0:00:50 216500 -- (-1948.382) [-1947.373] (-1952.479) (-1948.424) * (-1948.824) (-1950.583) [-1949.314] (-1947.861) -- 0:00:50 217000 -- (-1948.085) (-1947.217) [-1951.505] (-1949.148) * (-1947.977) (-1952.516) [-1950.728] (-1951.481) -- 0:00:50 217500 -- (-1947.204) [-1947.983] (-1947.912) (-1949.105) * (-1947.457) (-1953.778) [-1949.400] (-1948.602) -- 0:00:50 218000 -- (-1947.183) (-1947.323) [-1953.929] (-1948.961) * (-1947.427) (-1947.853) [-1948.389] (-1949.553) -- 0:00:50 218500 -- [-1949.261] (-1947.266) (-1947.153) (-1948.630) * (-1947.143) [-1948.806] (-1948.694) (-1950.244) -- 0:00:50 219000 -- (-1947.577) [-1946.877] (-1948.929) (-1951.547) * [-1947.772] (-1947.243) (-1947.063) (-1947.919) -- 0:00:49 219500 -- (-1950.616) (-1950.615) [-1947.789] (-1948.522) * (-1947.281) (-1947.456) (-1950.436) [-1948.231] -- 0:00:49 220000 -- (-1955.051) (-1950.371) (-1948.348) [-1948.842] * [-1948.463] (-1946.856) (-1950.712) (-1949.017) -- 0:00:49 Average standard deviation of split frequencies: 0.012930 220500 -- (-1950.471) (-1950.277) [-1948.506] (-1952.599) * (-1947.295) (-1947.106) [-1950.304] (-1948.301) -- 0:00:49 221000 -- (-1955.218) (-1950.512) (-1950.935) [-1949.173] * (-1947.755) (-1947.334) (-1951.743) [-1946.993] -- 0:00:49 221500 -- [-1950.528] (-1950.260) (-1947.891) (-1949.540) * (-1947.177) (-1949.757) (-1950.835) [-1947.330] -- 0:00:52 222000 -- (-1949.481) (-1949.647) (-1947.694) [-1950.622] * (-1947.040) (-1947.508) [-1949.721] (-1948.662) -- 0:00:52 222500 -- (-1946.959) (-1948.195) [-1948.300] (-1951.407) * (-1948.256) (-1947.363) (-1951.033) [-1950.367] -- 0:00:52 223000 -- [-1949.686] (-1949.619) (-1950.016) (-1949.354) * [-1948.146] (-1951.280) (-1952.011) (-1950.536) -- 0:00:52 223500 -- (-1949.218) [-1948.254] (-1950.959) (-1948.982) * (-1947.651) [-1952.219] (-1952.298) (-1949.510) -- 0:00:52 224000 -- (-1949.144) (-1948.584) (-1949.104) [-1947.309] * (-1951.551) [-1947.418] (-1949.394) (-1950.873) -- 0:00:51 224500 -- (-1951.548) (-1949.841) [-1949.786] (-1948.704) * (-1948.936) (-1947.761) [-1948.717] (-1947.783) -- 0:00:51 225000 -- [-1948.784] (-1952.101) (-1950.266) (-1949.186) * [-1948.020] (-1950.018) (-1949.569) (-1947.798) -- 0:00:51 Average standard deviation of split frequencies: 0.011856 225500 -- (-1948.141) [-1947.602] (-1950.050) (-1947.072) * [-1949.220] (-1946.952) (-1950.548) (-1947.937) -- 0:00:51 226000 -- (-1948.976) [-1947.155] (-1950.592) (-1948.110) * (-1948.193) [-1947.486] (-1948.502) (-1947.898) -- 0:00:51 226500 -- [-1948.387] (-1948.753) (-1949.319) (-1947.678) * (-1948.333) (-1947.429) [-1948.023] (-1948.734) -- 0:00:51 227000 -- (-1948.668) (-1947.826) (-1949.434) [-1947.756] * (-1949.090) (-1952.137) (-1949.551) [-1948.451] -- 0:00:51 227500 -- (-1948.308) (-1947.804) [-1948.274] (-1947.747) * (-1949.288) [-1949.461] (-1950.089) (-1948.709) -- 0:00:50 228000 -- (-1949.242) (-1947.984) (-1948.399) [-1948.416] * [-1948.426] (-1949.599) (-1948.696) (-1948.379) -- 0:00:50 228500 -- (-1950.196) [-1947.436] (-1947.828) (-1952.301) * (-1949.191) (-1950.233) [-1952.946] (-1950.723) -- 0:00:50 229000 -- (-1949.675) [-1949.139] (-1950.565) (-1951.896) * (-1952.093) (-1948.593) [-1950.336] (-1949.920) -- 0:00:50 229500 -- (-1948.681) (-1947.681) [-1947.190] (-1949.272) * (-1951.869) (-1949.081) [-1949.829] (-1947.895) -- 0:00:50 230000 -- [-1948.278] (-1947.438) (-1947.917) (-1951.197) * (-1950.725) [-1947.405] (-1948.040) (-1949.950) -- 0:00:50 Average standard deviation of split frequencies: 0.010332 230500 -- [-1948.810] (-1947.915) (-1948.801) (-1953.905) * (-1950.907) [-1949.695] (-1947.312) (-1947.378) -- 0:00:50 231000 -- (-1947.899) (-1946.470) (-1949.342) [-1948.160] * [-1948.897] (-1949.688) (-1946.954) (-1947.839) -- 0:00:49 231500 -- [-1947.899] (-1948.263) (-1948.223) (-1948.742) * (-1948.366) (-1949.221) [-1946.908] (-1947.815) -- 0:00:49 232000 -- (-1948.052) (-1948.109) [-1948.625] (-1948.698) * (-1950.120) (-1950.006) [-1947.262] (-1950.552) -- 0:00:49 232500 -- (-1948.763) (-1946.596) [-1950.131] (-1949.438) * (-1951.213) (-1949.178) [-1948.402] (-1947.585) -- 0:00:49 233000 -- (-1949.462) (-1947.210) (-1951.128) [-1947.553] * (-1951.956) (-1947.998) [-1947.924] (-1950.928) -- 0:00:49 233500 -- (-1947.832) (-1950.264) (-1950.714) [-1949.119] * (-1950.890) [-1947.734] (-1947.638) (-1947.524) -- 0:00:49 234000 -- (-1948.132) (-1948.333) [-1948.659] (-1949.061) * (-1948.259) (-1949.237) [-1947.404] (-1952.824) -- 0:00:49 234500 -- (-1947.596) (-1950.703) [-1949.032] (-1949.331) * (-1952.202) (-1949.698) [-1947.019] (-1948.938) -- 0:00:48 235000 -- (-1947.703) [-1948.021] (-1947.926) (-1950.003) * [-1950.919] (-1950.484) (-1948.141) (-1948.589) -- 0:00:48 Average standard deviation of split frequencies: 0.011236 235500 -- (-1949.229) [-1947.387] (-1952.373) (-1949.911) * (-1949.432) (-1947.252) [-1947.517] (-1949.278) -- 0:00:48 236000 -- [-1949.088] (-1947.904) (-1948.272) (-1950.845) * (-1952.104) (-1947.604) (-1948.484) [-1948.799] -- 0:00:48 236500 -- (-1949.020) [-1947.958] (-1949.756) (-1948.403) * (-1950.464) (-1948.346) [-1950.443] (-1949.801) -- 0:00:48 237000 -- [-1948.267] (-1948.598) (-1948.874) (-1948.861) * (-1948.711) (-1948.316) (-1949.385) [-1948.173] -- 0:00:51 237500 -- [-1947.938] (-1952.341) (-1950.178) (-1949.924) * [-1951.433] (-1947.370) (-1948.218) (-1947.717) -- 0:00:51 238000 -- [-1947.381] (-1948.773) (-1951.423) (-1948.304) * (-1947.676) [-1947.857] (-1951.044) (-1947.686) -- 0:00:51 238500 -- (-1948.537) (-1956.703) (-1947.592) [-1947.567] * (-1947.004) (-1947.535) (-1951.754) [-1947.797] -- 0:00:51 239000 -- [-1949.450] (-1951.734) (-1947.273) (-1949.022) * [-1946.895] (-1952.186) (-1952.409) (-1948.240) -- 0:00:50 239500 -- [-1949.152] (-1950.733) (-1948.215) (-1954.114) * (-1952.445) (-1951.554) (-1951.560) [-1947.623] -- 0:00:50 240000 -- (-1948.650) (-1948.115) [-1947.152] (-1951.681) * [-1951.382] (-1950.360) (-1949.699) (-1946.929) -- 0:00:50 Average standard deviation of split frequencies: 0.010773 240500 -- (-1948.386) (-1949.763) (-1947.107) [-1948.904] * (-1948.945) [-1950.386] (-1950.455) (-1946.954) -- 0:00:50 241000 -- (-1949.191) [-1948.162] (-1947.314) (-1949.622) * (-1951.859) [-1951.492] (-1953.965) (-1946.862) -- 0:00:50 241500 -- [-1950.555] (-1950.011) (-1947.729) (-1948.626) * [-1950.095] (-1950.325) (-1950.865) (-1946.865) -- 0:00:50 242000 -- (-1950.133) (-1948.365) [-1948.324] (-1949.036) * (-1953.073) [-1948.713] (-1949.630) (-1946.865) -- 0:00:50 242500 -- [-1949.776] (-1949.112) (-1947.036) (-1948.732) * (-1951.368) [-1948.155] (-1948.540) (-1951.489) -- 0:00:49 243000 -- (-1950.392) [-1948.919] (-1948.687) (-1948.172) * [-1952.485] (-1948.403) (-1947.051) (-1949.725) -- 0:00:49 243500 -- (-1947.648) (-1949.065) [-1948.235] (-1948.704) * (-1949.793) [-1947.830] (-1949.067) (-1951.165) -- 0:00:49 244000 -- (-1947.744) (-1949.687) (-1948.170) [-1946.928] * (-1951.295) [-1951.002] (-1947.637) (-1951.705) -- 0:00:49 244500 -- (-1948.786) (-1948.057) (-1946.928) [-1948.427] * (-1952.234) [-1949.597] (-1952.739) (-1948.478) -- 0:00:49 245000 -- (-1947.644) (-1947.647) (-1946.679) [-1951.658] * (-1949.392) (-1947.216) [-1947.118] (-1949.246) -- 0:00:49 Average standard deviation of split frequencies: 0.011019 245500 -- (-1948.168) (-1948.669) (-1952.712) [-1953.074] * [-1947.720] (-1946.964) (-1947.519) (-1954.285) -- 0:00:49 246000 -- (-1947.999) [-1949.670] (-1950.039) (-1952.115) * (-1949.283) (-1947.270) [-1947.357] (-1946.872) -- 0:00:49 246500 -- (-1948.666) (-1946.797) (-1952.617) [-1949.106] * (-1952.446) (-1946.968) (-1947.890) [-1946.821] -- 0:00:48 247000 -- (-1951.001) (-1947.216) [-1949.569] (-1947.795) * [-1946.476] (-1947.196) (-1947.864) (-1946.698) -- 0:00:48 247500 -- (-1947.831) (-1947.221) [-1949.241] (-1947.127) * (-1946.474) (-1949.783) (-1947.187) [-1949.356] -- 0:00:48 248000 -- (-1947.459) (-1947.755) [-1954.141] (-1947.172) * (-1949.677) [-1949.964] (-1950.304) (-1948.583) -- 0:00:48 248500 -- [-1947.434] (-1948.969) (-1950.994) (-1947.150) * [-1948.989] (-1950.766) (-1950.657) (-1947.830) -- 0:00:48 249000 -- (-1946.731) (-1954.487) [-1949.155] (-1946.881) * (-1947.399) [-1954.399] (-1950.265) (-1946.601) -- 0:00:48 249500 -- (-1947.679) [-1948.858] (-1947.966) (-1954.970) * (-1948.645) (-1948.974) (-1951.044) [-1947.392] -- 0:00:48 250000 -- [-1946.640] (-1947.871) (-1948.769) (-1955.838) * (-1948.121) [-1947.595] (-1947.225) (-1947.001) -- 0:00:48 Average standard deviation of split frequencies: 0.012106 250500 -- (-1948.008) (-1947.932) [-1948.643] (-1949.408) * [-1948.869] (-1947.177) (-1951.633) (-1946.938) -- 0:00:47 251000 -- (-1946.949) [-1948.035] (-1948.172) (-1949.736) * (-1947.864) (-1948.338) [-1949.571] (-1946.959) -- 0:00:47 251500 -- [-1950.270] (-1948.198) (-1946.985) (-1950.422) * [-1948.625] (-1950.318) (-1950.459) (-1948.322) -- 0:00:47 252000 -- (-1950.370) (-1948.791) [-1946.631] (-1948.791) * (-1951.070) [-1948.401] (-1952.290) (-1950.103) -- 0:00:47 252500 -- (-1950.370) (-1949.751) (-1946.608) [-1947.103] * [-1948.518] (-1949.099) (-1948.090) (-1948.912) -- 0:00:50 253000 -- (-1947.050) (-1949.577) (-1948.298) [-1948.302] * (-1947.448) (-1952.861) [-1949.215] (-1947.990) -- 0:00:50 253500 -- (-1948.766) (-1950.666) [-1947.847] (-1950.029) * [-1947.324] (-1949.572) (-1949.648) (-1949.251) -- 0:00:50 254000 -- (-1951.149) [-1951.531] (-1948.814) (-1949.861) * (-1947.409) [-1947.684] (-1952.050) (-1950.671) -- 0:00:49 254500 -- (-1952.533) [-1950.622] (-1949.709) (-1949.729) * (-1949.231) (-1952.092) (-1948.022) [-1951.916] -- 0:00:49 255000 -- [-1948.433] (-1951.498) (-1950.255) (-1950.776) * (-1947.732) (-1951.809) [-1948.052] (-1952.354) -- 0:00:49 Average standard deviation of split frequencies: 0.011164 255500 -- (-1949.011) (-1949.869) (-1949.316) [-1949.654] * (-1947.633) [-1950.413] (-1946.941) (-1949.681) -- 0:00:49 256000 -- [-1948.941] (-1948.504) (-1949.104) (-1948.776) * (-1947.817) (-1949.929) [-1949.653] (-1950.181) -- 0:00:49 256500 -- (-1948.232) [-1947.604] (-1952.025) (-1949.140) * (-1948.884) [-1950.327] (-1951.644) (-1947.379) -- 0:00:49 257000 -- (-1948.373) (-1947.674) [-1946.970] (-1949.244) * [-1948.546] (-1950.488) (-1948.817) (-1949.865) -- 0:00:49 257500 -- (-1949.730) [-1947.275] (-1949.460) (-1949.144) * (-1954.299) [-1949.135] (-1948.908) (-1951.368) -- 0:00:49 258000 -- [-1948.135] (-1947.840) (-1949.708) (-1948.868) * [-1948.606] (-1949.600) (-1948.176) (-1950.314) -- 0:00:48 258500 -- [-1949.230] (-1947.775) (-1949.025) (-1948.319) * (-1950.890) [-1951.057] (-1948.034) (-1948.357) -- 0:00:48 259000 -- (-1947.450) (-1949.522) (-1951.933) [-1948.037] * (-1950.408) (-1950.428) (-1947.372) [-1948.043] -- 0:00:48 259500 -- [-1949.891] (-1948.683) (-1951.882) (-1951.350) * (-1950.116) (-1954.397) [-1949.310] (-1950.135) -- 0:00:48 260000 -- [-1948.163] (-1948.744) (-1954.393) (-1950.120) * [-1947.654] (-1952.714) (-1949.802) (-1947.999) -- 0:00:48 Average standard deviation of split frequencies: 0.009833 260500 -- (-1948.271) (-1948.720) (-1954.454) [-1948.103] * (-1946.791) [-1951.090] (-1951.736) (-1949.034) -- 0:00:48 261000 -- (-1947.718) (-1948.921) (-1954.509) [-1947.948] * (-1950.017) (-1949.265) (-1952.713) [-1950.873] -- 0:00:48 261500 -- (-1947.742) [-1948.023] (-1954.006) (-1950.400) * (-1952.693) (-1950.612) (-1951.286) [-1953.432] -- 0:00:48 262000 -- (-1947.742) [-1947.432] (-1949.016) (-1949.634) * [-1951.473] (-1951.034) (-1951.939) (-1946.929) -- 0:00:47 262500 -- (-1949.430) (-1948.318) [-1950.621] (-1951.253) * [-1949.911] (-1950.089) (-1949.495) (-1947.127) -- 0:00:47 263000 -- (-1947.268) [-1950.087] (-1951.036) (-1948.753) * (-1950.147) (-1950.612) (-1949.109) [-1947.707] -- 0:00:47 263500 -- (-1949.322) (-1949.149) [-1953.337] (-1948.303) * (-1948.989) (-1950.881) [-1950.500] (-1947.818) -- 0:00:47 264000 -- (-1947.075) [-1947.248] (-1951.778) (-1948.310) * (-1947.660) (-1947.646) [-1950.500] (-1946.561) -- 0:00:47 264500 -- [-1947.088] (-1947.090) (-1950.094) (-1949.864) * (-1949.969) (-1947.654) (-1948.353) [-1946.735] -- 0:00:47 265000 -- (-1949.442) [-1948.582] (-1950.233) (-1951.745) * [-1947.205] (-1947.717) (-1951.658) (-1949.985) -- 0:00:47 Average standard deviation of split frequencies: 0.009747 265500 -- (-1946.839) [-1947.728] (-1949.914) (-1950.493) * (-1946.908) [-1947.463] (-1951.149) (-1947.438) -- 0:00:47 266000 -- (-1948.132) (-1947.592) [-1947.168] (-1950.533) * (-1946.995) [-1947.282] (-1949.922) (-1946.621) -- 0:00:46 266500 -- (-1946.888) [-1946.749] (-1949.616) (-1949.766) * (-1948.580) (-1948.534) (-1948.790) [-1947.056] -- 0:00:46 267000 -- (-1947.184) (-1949.470) (-1948.963) [-1949.145] * (-1952.377) [-1951.769] (-1951.532) (-1947.180) -- 0:00:46 267500 -- [-1948.906] (-1947.475) (-1948.283) (-1949.021) * [-1949.326] (-1951.044) (-1952.200) (-1947.376) -- 0:00:46 268000 -- (-1948.106) [-1947.960] (-1948.144) (-1948.118) * (-1951.005) [-1947.227] (-1951.727) (-1948.954) -- 0:00:49 268500 -- [-1949.047] (-1947.061) (-1947.036) (-1947.508) * [-1950.907] (-1947.191) (-1949.037) (-1947.972) -- 0:00:49 269000 -- [-1946.960] (-1950.956) (-1947.097) (-1948.871) * (-1948.178) [-1946.991] (-1950.332) (-1948.986) -- 0:00:48 269500 -- (-1947.752) (-1949.656) [-1948.827] (-1948.733) * (-1948.209) (-1949.534) (-1949.624) [-1948.043] -- 0:00:48 270000 -- [-1947.791] (-1951.060) (-1948.388) (-1947.871) * (-1949.037) (-1951.699) (-1951.352) [-1947.989] -- 0:00:48 Average standard deviation of split frequencies: 0.009579 270500 -- (-1948.123) [-1948.728] (-1949.804) (-1948.879) * [-1949.802] (-1946.896) (-1955.207) (-1951.302) -- 0:00:48 271000 -- (-1946.957) [-1948.805] (-1948.844) (-1948.126) * [-1949.174] (-1947.088) (-1948.394) (-1949.113) -- 0:00:48 271500 -- (-1946.957) [-1947.696] (-1948.374) (-1948.353) * [-1950.602] (-1946.675) (-1948.016) (-1949.161) -- 0:00:48 272000 -- (-1947.739) (-1947.631) (-1949.607) [-1949.974] * [-1948.677] (-1948.219) (-1947.654) (-1947.898) -- 0:00:48 272500 -- (-1948.748) [-1948.206] (-1951.390) (-1949.664) * (-1950.641) (-1947.402) [-1949.815] (-1950.952) -- 0:00:48 273000 -- (-1951.671) (-1949.029) [-1948.981] (-1949.437) * (-1949.222) (-1948.884) (-1948.241) [-1950.551] -- 0:00:47 273500 -- (-1950.775) (-1949.456) (-1947.691) [-1946.557] * (-1948.398) (-1950.449) (-1947.692) [-1951.411] -- 0:00:47 274000 -- (-1950.915) (-1948.090) [-1946.719] (-1949.489) * (-1950.024) [-1947.560] (-1948.757) (-1948.024) -- 0:00:47 274500 -- (-1950.911) (-1948.993) (-1948.225) [-1949.691] * (-1949.917) (-1947.372) [-1946.933] (-1949.486) -- 0:00:47 275000 -- (-1951.003) (-1948.321) [-1947.905] (-1953.086) * (-1947.625) (-1948.448) (-1949.681) [-1950.404] -- 0:00:47 Average standard deviation of split frequencies: 0.010020 275500 -- [-1948.784] (-1947.566) (-1949.139) (-1952.225) * (-1947.931) [-1948.134] (-1950.261) (-1948.950) -- 0:00:47 276000 -- (-1946.608) (-1949.514) [-1951.932] (-1946.936) * [-1947.964] (-1948.019) (-1951.137) (-1949.467) -- 0:00:47 276500 -- (-1948.029) (-1949.411) [-1948.494] (-1948.317) * (-1947.966) [-1948.410] (-1952.479) (-1947.869) -- 0:00:47 277000 -- [-1948.999] (-1947.694) (-1949.813) (-1951.895) * (-1947.525) [-1946.471] (-1951.018) (-1947.845) -- 0:00:46 277500 -- [-1950.330] (-1949.999) (-1947.715) (-1948.554) * (-1948.773) [-1947.814] (-1951.375) (-1948.946) -- 0:00:46 278000 -- (-1950.431) (-1955.429) (-1951.005) [-1950.001] * (-1949.034) [-1947.917] (-1952.594) (-1949.293) -- 0:00:46 278500 -- (-1948.385) (-1953.713) (-1949.758) [-1951.725] * (-1948.999) [-1949.273] (-1949.733) (-1949.693) -- 0:00:46 279000 -- (-1947.540) (-1951.809) (-1949.081) [-1948.735] * (-1946.988) (-1955.320) [-1948.199] (-1948.151) -- 0:00:46 279500 -- (-1947.749) (-1947.575) [-1947.888] (-1949.700) * (-1948.333) (-1948.575) [-1950.138] (-1948.821) -- 0:00:46 280000 -- (-1948.231) (-1948.302) [-1947.181] (-1949.467) * (-1951.556) (-1949.422) (-1951.606) [-1948.075] -- 0:00:46 Average standard deviation of split frequencies: 0.009182 280500 -- [-1946.858] (-1950.054) (-1949.638) (-1949.332) * (-1949.440) (-1948.399) (-1951.209) [-1948.243] -- 0:00:46 281000 -- (-1947.591) (-1950.433) (-1949.395) [-1951.324] * (-1947.895) [-1947.423] (-1950.434) (-1948.564) -- 0:00:46 281500 -- (-1947.842) (-1950.476) [-1947.321] (-1948.738) * [-1947.721] (-1947.929) (-1950.795) (-1949.116) -- 0:00:45 282000 -- (-1949.247) [-1948.823] (-1946.986) (-1951.133) * [-1947.707] (-1948.401) (-1948.740) (-1952.300) -- 0:00:45 282500 -- [-1951.553] (-1949.174) (-1948.117) (-1951.527) * [-1950.074] (-1948.477) (-1947.355) (-1952.163) -- 0:00:45 283000 -- (-1947.257) (-1949.274) [-1947.273] (-1948.614) * (-1948.945) [-1949.465] (-1947.815) (-1952.805) -- 0:00:45 283500 -- (-1947.226) (-1949.985) (-1950.060) [-1948.440] * (-1950.426) [-1951.075] (-1950.429) (-1952.472) -- 0:00:48 284000 -- (-1947.251) (-1950.319) [-1949.546] (-1947.515) * (-1951.748) (-1950.864) (-1949.128) [-1949.826] -- 0:00:47 284500 -- (-1947.141) (-1950.875) [-1950.196] (-1948.672) * (-1950.350) (-1949.943) [-1948.014] (-1949.068) -- 0:00:47 285000 -- (-1947.141) (-1952.555) [-1949.913] (-1948.672) * (-1950.274) (-1948.898) (-1947.609) [-1948.965] -- 0:00:47 Average standard deviation of split frequencies: 0.007520 285500 -- (-1950.051) [-1950.978] (-1949.731) (-1947.889) * [-1951.038] (-1949.163) (-1950.467) (-1947.017) -- 0:00:47 286000 -- (-1946.897) (-1951.528) (-1949.509) [-1948.045] * (-1951.565) (-1953.905) (-1947.279) [-1947.010] -- 0:00:47 286500 -- [-1948.034] (-1951.331) (-1955.101) (-1947.977) * (-1947.590) (-1949.298) [-1947.826] (-1947.011) -- 0:00:47 287000 -- (-1948.120) (-1949.685) [-1950.702] (-1949.775) * (-1947.814) (-1952.170) [-1948.509] (-1946.958) -- 0:00:47 287500 -- (-1953.579) [-1955.225] (-1949.875) (-1951.558) * (-1947.399) [-1949.996] (-1949.018) (-1947.372) -- 0:00:47 288000 -- (-1953.769) (-1953.146) [-1948.600] (-1948.114) * (-1949.479) (-1952.833) (-1951.178) [-1947.467] -- 0:00:46 288500 -- (-1952.263) (-1953.557) (-1947.530) [-1946.912] * [-1947.470] (-1952.284) (-1947.139) (-1947.954) -- 0:00:46 289000 -- (-1951.762) (-1951.629) [-1947.309] (-1946.912) * [-1948.941] (-1954.217) (-1948.896) (-1948.986) -- 0:00:46 289500 -- (-1950.060) [-1947.746] (-1947.335) (-1950.472) * (-1948.378) (-1948.348) (-1947.186) [-1947.879] -- 0:00:46 290000 -- (-1949.560) [-1955.357] (-1947.612) (-1949.585) * (-1951.580) [-1951.136] (-1949.544) (-1949.139) -- 0:00:46 Average standard deviation of split frequencies: 0.008542 290500 -- (-1948.945) [-1953.637] (-1947.612) (-1949.706) * [-1949.213] (-1948.635) (-1947.090) (-1948.142) -- 0:00:46 291000 -- (-1947.678) [-1947.993] (-1949.211) (-1949.628) * (-1948.879) (-1950.801) [-1947.196] (-1950.506) -- 0:00:46 291500 -- [-1947.209] (-1949.057) (-1947.086) (-1949.432) * (-1947.024) (-1953.544) [-1946.949] (-1948.747) -- 0:00:46 292000 -- (-1947.212) (-1950.918) [-1948.515] (-1956.949) * (-1947.024) (-1951.743) (-1948.882) [-1947.796] -- 0:00:46 292500 -- [-1947.202] (-1949.804) (-1948.686) (-1951.708) * (-1946.667) (-1953.616) [-1949.283] (-1948.173) -- 0:00:45 293000 -- (-1948.846) (-1948.708) [-1953.481] (-1950.233) * (-1946.684) (-1949.332) [-1949.772] (-1949.274) -- 0:00:45 293500 -- [-1948.135] (-1947.468) (-1953.466) (-1950.929) * [-1947.019] (-1951.479) (-1950.112) (-1950.024) -- 0:00:45 294000 -- (-1948.135) (-1947.004) [-1951.096] (-1951.280) * (-1947.488) (-1950.677) [-1948.372] (-1948.605) -- 0:00:45 294500 -- [-1947.419] (-1948.150) (-1948.494) (-1952.235) * (-1947.142) (-1949.703) (-1952.439) [-1947.636] -- 0:00:45 295000 -- [-1948.935] (-1950.664) (-1948.902) (-1949.207) * (-1948.757) (-1949.818) (-1952.776) [-1947.968] -- 0:00:45 Average standard deviation of split frequencies: 0.009343 295500 -- [-1949.910] (-1946.839) (-1951.770) (-1949.432) * (-1948.691) (-1950.843) (-1949.677) [-1948.978] -- 0:00:45 296000 -- (-1949.998) (-1950.142) [-1951.937] (-1948.410) * (-1948.165) (-1949.186) [-1951.061] (-1950.244) -- 0:00:45 296500 -- [-1947.441] (-1950.840) (-1948.644) (-1950.393) * (-1947.906) (-1949.386) [-1949.600] (-1952.322) -- 0:00:45 297000 -- (-1948.257) (-1948.163) [-1949.428] (-1951.313) * (-1947.705) (-1948.049) (-1947.454) [-1950.314] -- 0:00:44 297500 -- (-1947.831) (-1948.215) (-1947.316) [-1950.747] * (-1947.240) (-1947.207) [-1947.471] (-1953.579) -- 0:00:44 298000 -- (-1948.402) (-1950.575) [-1948.628] (-1951.311) * (-1946.951) (-1948.607) [-1947.414] (-1948.118) -- 0:00:44 298500 -- (-1950.257) [-1947.524] (-1948.865) (-1948.881) * [-1947.374] (-1948.563) (-1949.564) (-1947.886) -- 0:00:44 299000 -- (-1948.427) [-1948.075] (-1951.439) (-1949.671) * [-1950.480] (-1949.549) (-1948.267) (-1950.490) -- 0:00:46 299500 -- [-1948.378] (-1947.313) (-1953.301) (-1950.689) * (-1949.176) [-1951.705] (-1949.201) (-1948.859) -- 0:00:46 300000 -- [-1948.029] (-1949.453) (-1953.475) (-1952.276) * (-1949.545) [-1950.260] (-1949.020) (-1948.190) -- 0:00:46 Average standard deviation of split frequencies: 0.007630 300500 -- (-1948.926) (-1947.769) [-1948.777] (-1952.045) * (-1950.391) (-1950.548) (-1949.524) [-1948.396] -- 0:00:46 301000 -- (-1948.396) (-1948.609) (-1952.330) [-1949.344] * [-1947.561] (-1949.762) (-1950.256) (-1947.890) -- 0:00:46 301500 -- (-1952.314) [-1948.861] (-1951.985) (-1951.798) * (-1950.273) (-1951.337) (-1947.943) [-1949.102] -- 0:00:46 302000 -- (-1954.542) [-1947.381] (-1948.908) (-1947.575) * (-1950.747) (-1951.086) (-1950.340) [-1949.418] -- 0:00:46 302500 -- [-1954.511] (-1949.161) (-1948.792) (-1948.023) * (-1947.901) (-1949.745) (-1949.606) [-1948.055] -- 0:00:46 303000 -- (-1948.063) [-1949.183] (-1947.460) (-1947.201) * (-1947.813) (-1949.210) [-1949.883] (-1947.417) -- 0:00:46 303500 -- (-1949.196) [-1950.926] (-1950.855) (-1947.075) * [-1947.592] (-1948.254) (-1948.062) (-1951.544) -- 0:00:45 304000 -- (-1947.513) [-1950.623] (-1951.328) (-1947.580) * (-1948.118) [-1948.293] (-1949.455) (-1950.620) -- 0:00:45 304500 -- (-1948.319) (-1949.946) (-1950.993) [-1949.289] * (-1948.435) [-1948.384] (-1951.661) (-1953.119) -- 0:00:45 305000 -- (-1947.164) [-1947.924] (-1950.117) (-1948.469) * [-1948.604] (-1951.475) (-1949.826) (-1949.504) -- 0:00:45 Average standard deviation of split frequencies: 0.006881 305500 -- (-1949.080) (-1952.014) [-1949.309] (-1948.385) * (-1948.217) (-1947.328) (-1949.226) [-1952.166] -- 0:00:45 306000 -- (-1947.862) (-1949.613) [-1948.201] (-1949.021) * (-1951.004) (-1947.694) (-1950.936) [-1951.873] -- 0:00:45 306500 -- (-1948.069) (-1948.979) (-1948.930) [-1947.557] * [-1952.644] (-1947.997) (-1948.770) (-1952.784) -- 0:00:45 307000 -- (-1951.628) [-1950.060] (-1948.657) (-1948.902) * (-1947.431) (-1948.582) (-1951.450) [-1950.561] -- 0:00:45 307500 -- (-1948.045) (-1950.387) (-1948.794) [-1949.047] * (-1952.706) [-1952.303] (-1949.634) (-1948.697) -- 0:00:45 308000 -- (-1949.229) (-1947.827) (-1949.494) [-1948.553] * [-1950.098] (-1952.949) (-1952.471) (-1948.528) -- 0:00:44 308500 -- (-1949.086) [-1949.600] (-1949.130) (-1948.737) * (-1947.704) (-1950.455) (-1952.529) [-1949.472] -- 0:00:44 309000 -- (-1950.413) [-1947.715] (-1950.084) (-1949.443) * [-1948.624] (-1953.135) (-1950.821) (-1951.118) -- 0:00:44 309500 -- (-1948.739) [-1948.786] (-1949.179) (-1948.912) * (-1949.789) (-1950.469) (-1948.862) [-1950.119] -- 0:00:44 310000 -- (-1952.522) (-1952.053) (-1947.195) [-1948.430] * (-1948.149) [-1951.277] (-1948.055) (-1947.852) -- 0:00:44 Average standard deviation of split frequencies: 0.008295 310500 -- (-1947.324) (-1953.825) (-1948.012) [-1947.611] * (-1947.793) (-1952.275) [-1947.442] (-1948.429) -- 0:00:44 311000 -- (-1947.187) (-1954.193) [-1951.686] (-1947.963) * [-1949.086] (-1948.214) (-1947.998) (-1949.251) -- 0:00:44 311500 -- (-1947.200) (-1952.546) (-1950.636) [-1947.687] * [-1947.240] (-1949.077) (-1948.382) (-1950.032) -- 0:00:44 312000 -- (-1946.712) (-1950.650) (-1948.023) [-1947.536] * (-1948.364) (-1950.338) [-1949.666] (-1951.829) -- 0:00:44 312500 -- (-1948.790) (-1952.957) [-1949.380] (-1947.525) * (-1948.445) (-1952.392) (-1949.780) [-1952.737] -- 0:00:44 313000 -- (-1946.970) [-1952.180] (-1946.955) (-1948.637) * (-1949.461) (-1951.194) [-1948.146] (-1953.304) -- 0:00:43 313500 -- (-1949.560) (-1951.059) (-1947.347) [-1947.476] * (-1949.571) (-1949.493) [-1949.110] (-1950.952) -- 0:00:43 314000 -- (-1949.267) (-1950.316) (-1947.943) [-1947.973] * (-1949.331) (-1950.101) [-1947.758] (-1949.501) -- 0:00:45 314500 -- [-1947.945] (-1948.875) (-1946.960) (-1946.635) * [-1948.828] (-1949.266) (-1949.626) (-1947.226) -- 0:00:45 315000 -- (-1948.145) (-1947.732) (-1946.994) [-1946.639] * [-1948.142] (-1950.247) (-1947.633) (-1946.661) -- 0:00:45 Average standard deviation of split frequencies: 0.009653 315500 -- (-1952.214) (-1948.030) (-1949.180) [-1948.030] * (-1949.234) (-1954.258) [-1946.472] (-1946.855) -- 0:00:45 316000 -- (-1951.664) (-1946.600) [-1947.729] (-1950.496) * [-1948.548] (-1951.439) (-1948.066) (-1947.314) -- 0:00:45 316500 -- (-1946.724) (-1946.603) (-1947.686) [-1947.116] * [-1949.191] (-1951.206) (-1947.421) (-1947.791) -- 0:00:45 317000 -- (-1949.079) (-1949.870) (-1947.860) [-1949.238] * (-1948.897) [-1949.513] (-1947.709) (-1951.295) -- 0:00:45 317500 -- (-1947.134) [-1949.550] (-1949.915) (-1950.190) * (-1947.541) [-1947.769] (-1948.203) (-1951.551) -- 0:00:45 318000 -- (-1947.002) [-1949.008] (-1948.437) (-1952.086) * (-1948.042) (-1947.478) [-1947.627] (-1947.658) -- 0:00:45 318500 -- (-1947.899) (-1948.903) (-1949.651) [-1947.093] * (-1947.863) [-1947.742] (-1947.232) (-1947.987) -- 0:00:44 319000 -- (-1948.036) (-1948.207) (-1949.248) [-1947.167] * [-1950.178] (-1947.553) (-1948.410) (-1948.027) -- 0:00:44 319500 -- (-1948.249) (-1947.880) [-1950.496] (-1947.776) * [-1952.866] (-1949.298) (-1949.034) (-1947.454) -- 0:00:44 320000 -- [-1952.875] (-1948.011) (-1948.309) (-1947.191) * [-1949.956] (-1951.334) (-1948.293) (-1947.289) -- 0:00:44 Average standard deviation of split frequencies: 0.008637 320500 -- [-1948.694] (-1950.312) (-1949.539) (-1947.630) * (-1950.064) [-1949.234] (-1950.389) (-1947.681) -- 0:00:44 321000 -- [-1948.254] (-1951.324) (-1948.270) (-1950.778) * [-1947.537] (-1948.645) (-1951.745) (-1948.671) -- 0:00:44 321500 -- [-1948.385] (-1953.567) (-1947.854) (-1950.481) * [-1947.753] (-1947.276) (-1950.289) (-1947.812) -- 0:00:44 322000 -- (-1951.050) (-1951.272) [-1948.151] (-1950.773) * (-1947.162) [-1947.289] (-1949.341) (-1950.128) -- 0:00:44 322500 -- [-1948.791] (-1951.469) (-1947.624) (-1950.767) * (-1947.162) [-1950.541] (-1951.123) (-1951.254) -- 0:00:44 323000 -- [-1950.122] (-1951.797) (-1948.941) (-1955.074) * (-1947.642) (-1948.138) (-1948.911) [-1951.102] -- 0:00:44 323500 -- (-1948.535) (-1954.217) [-1949.130] (-1951.695) * (-1948.623) (-1949.319) [-1947.744] (-1947.996) -- 0:00:43 324000 -- [-1948.136] (-1953.782) (-1947.797) (-1953.039) * (-1947.185) (-1948.859) [-1951.615] (-1952.326) -- 0:00:43 324500 -- (-1946.942) (-1948.652) [-1948.404] (-1950.856) * [-1948.619] (-1949.029) (-1954.990) (-1948.213) -- 0:00:43 325000 -- (-1949.119) (-1949.353) (-1947.574) [-1947.540] * (-1947.059) (-1950.167) (-1951.481) [-1948.636] -- 0:00:43 Average standard deviation of split frequencies: 0.008756 325500 -- [-1948.363] (-1952.547) (-1948.106) (-1947.794) * (-1947.059) [-1949.944] (-1947.515) (-1948.911) -- 0:00:43 326000 -- [-1947.730] (-1953.179) (-1948.099) (-1947.536) * [-1949.477] (-1950.462) (-1946.749) (-1948.262) -- 0:00:43 326500 -- [-1948.027] (-1949.460) (-1948.160) (-1950.175) * (-1947.341) (-1950.650) (-1948.502) [-1947.851] -- 0:00:43 327000 -- (-1947.519) (-1949.293) (-1948.088) [-1948.132] * (-1951.473) (-1947.236) [-1947.615] (-1949.705) -- 0:00:43 327500 -- (-1950.169) [-1948.705] (-1949.609) (-1950.348) * (-1950.058) (-1947.622) [-1947.631] (-1947.041) -- 0:00:43 328000 -- (-1950.646) [-1948.255] (-1952.118) (-1948.666) * (-1950.396) [-1947.782] (-1948.200) (-1948.723) -- 0:00:43 328500 -- (-1950.807) (-1948.666) [-1948.736] (-1949.442) * (-1947.594) (-1948.314) (-1948.854) [-1950.042] -- 0:00:42 329000 -- (-1949.510) (-1947.946) [-1948.089] (-1955.265) * [-1951.159] (-1948.393) (-1948.307) (-1954.929) -- 0:00:42 329500 -- (-1948.365) [-1952.683] (-1948.941) (-1953.679) * [-1950.285] (-1946.760) (-1949.620) (-1948.341) -- 0:00:44 330000 -- (-1948.836) (-1948.005) [-1947.208] (-1956.180) * (-1950.795) (-1949.427) (-1949.020) [-1948.619] -- 0:00:44 Average standard deviation of split frequencies: 0.007841 330500 -- (-1949.116) (-1948.421) [-1946.561] (-1954.541) * (-1947.876) (-1946.915) (-1950.217) [-1948.591] -- 0:00:44 331000 -- (-1949.380) (-1948.379) [-1946.533] (-1949.235) * (-1948.371) (-1953.501) (-1952.523) [-1948.398] -- 0:00:44 331500 -- [-1950.788] (-1950.554) (-1949.140) (-1950.189) * (-1946.484) (-1948.275) [-1949.878] (-1951.908) -- 0:00:44 332000 -- (-1949.245) [-1949.612] (-1949.973) (-1952.600) * (-1947.595) (-1949.363) (-1949.041) [-1951.431] -- 0:00:44 332500 -- (-1947.672) (-1951.273) (-1949.004) [-1951.646] * [-1946.384] (-1946.807) (-1952.584) (-1954.936) -- 0:00:44 333000 -- (-1947.822) (-1951.808) (-1949.362) [-1947.947] * (-1947.607) (-1952.588) (-1953.909) [-1951.529] -- 0:00:44 333500 -- [-1947.969] (-1952.579) (-1947.128) (-1947.101) * (-1950.138) [-1948.137] (-1947.460) (-1949.490) -- 0:00:43 334000 -- (-1949.247) (-1950.367) [-1950.745] (-1947.222) * (-1950.404) [-1953.544] (-1950.839) (-1949.486) -- 0:00:43 334500 -- (-1949.511) (-1950.789) [-1951.509] (-1946.823) * (-1950.460) (-1952.675) (-1950.718) [-1947.484] -- 0:00:43 335000 -- (-1951.569) (-1950.478) (-1950.476) [-1946.637] * (-1950.375) (-1951.120) [-1950.373] (-1947.887) -- 0:00:43 Average standard deviation of split frequencies: 0.008593 335500 -- (-1951.847) [-1950.514] (-1950.533) (-1947.404) * (-1949.084) (-1950.286) [-1955.011] (-1948.369) -- 0:00:43 336000 -- (-1950.847) (-1948.592) (-1949.191) [-1947.810] * (-1948.012) (-1950.085) [-1947.783] (-1950.727) -- 0:00:43 336500 -- (-1947.386) [-1947.844] (-1948.373) (-1947.810) * (-1948.837) (-1946.868) (-1948.392) [-1948.902] -- 0:00:43 337000 -- (-1949.161) (-1947.949) (-1949.297) [-1947.148] * (-1948.395) [-1946.607] (-1949.183) (-1946.908) -- 0:00:43 337500 -- (-1949.152) [-1948.804] (-1947.327) (-1947.138) * (-1946.814) (-1952.703) (-1948.126) [-1947.613] -- 0:00:43 338000 -- (-1947.397) (-1948.085) [-1949.132] (-1949.121) * (-1946.814) (-1949.287) (-1948.863) [-1947.304] -- 0:00:43 338500 -- (-1949.269) (-1948.389) (-1949.049) [-1949.467] * (-1946.806) (-1949.209) (-1947.741) [-1947.362] -- 0:00:42 339000 -- (-1950.980) (-1947.815) [-1948.298] (-1949.748) * (-1947.243) (-1952.349) (-1948.139) [-1948.575] -- 0:00:42 339500 -- (-1950.378) [-1947.791] (-1947.308) (-1947.972) * (-1949.520) (-1950.674) (-1947.551) [-1952.105] -- 0:00:42 340000 -- (-1950.943) (-1951.562) [-1951.235] (-1947.831) * [-1950.669] (-1949.519) (-1946.950) (-1949.768) -- 0:00:42 Average standard deviation of split frequencies: 0.008395 340500 -- (-1949.337) [-1947.564] (-1950.146) (-1948.596) * [-1949.383] (-1948.361) (-1947.246) (-1951.254) -- 0:00:42 341000 -- (-1948.981) (-1947.890) (-1949.213) [-1950.520] * (-1952.466) [-1948.137] (-1949.831) (-1953.694) -- 0:00:42 341500 -- (-1952.086) (-1955.984) (-1950.390) [-1949.352] * (-1951.171) (-1948.223) [-1948.818] (-1953.341) -- 0:00:42 342000 -- (-1955.035) (-1952.432) (-1948.785) [-1949.724] * [-1949.162] (-1948.417) (-1946.973) (-1951.885) -- 0:00:42 342500 -- (-1950.292) (-1953.687) [-1947.639] (-1948.336) * (-1949.112) (-1948.369) (-1950.240) [-1954.130] -- 0:00:42 343000 -- (-1947.312) [-1950.228] (-1947.803) (-1949.524) * (-1947.063) [-1947.676] (-1950.756) (-1952.043) -- 0:00:42 343500 -- [-1948.030] (-1947.376) (-1949.245) (-1948.538) * (-1951.152) (-1948.529) (-1947.869) [-1948.518] -- 0:00:42 344000 -- (-1948.275) (-1947.361) (-1949.977) [-1948.297] * [-1949.839] (-1947.255) (-1950.856) (-1947.334) -- 0:00:41 344500 -- (-1955.359) [-1946.760] (-1948.303) (-1946.869) * (-1947.563) (-1947.504) (-1948.584) [-1950.067] -- 0:00:43 345000 -- (-1953.176) [-1947.646] (-1950.372) (-1946.869) * (-1947.148) [-1950.403] (-1947.192) (-1948.838) -- 0:00:43 Average standard deviation of split frequencies: 0.008896 345500 -- (-1950.180) (-1947.628) [-1949.191] (-1948.410) * (-1947.225) [-1948.969] (-1948.551) (-1949.384) -- 0:00:43 346000 -- (-1947.034) (-1947.454) (-1956.738) [-1946.994] * (-1949.784) (-1948.917) (-1947.722) [-1948.636] -- 0:00:43 346500 -- (-1949.986) (-1946.872) (-1958.525) [-1950.146] * [-1949.601] (-1947.118) (-1947.733) (-1950.226) -- 0:00:43 347000 -- (-1952.958) (-1947.251) [-1948.506] (-1953.445) * (-1949.487) (-1947.398) [-1947.668] (-1948.909) -- 0:00:43 347500 -- (-1947.494) (-1947.235) (-1947.710) [-1949.058] * [-1949.956] (-1950.050) (-1947.841) (-1947.089) -- 0:00:43 348000 -- (-1948.496) [-1949.495] (-1949.565) (-1947.899) * (-1949.666) (-1947.438) [-1949.422] (-1949.500) -- 0:00:43 348500 -- (-1955.266) (-1947.011) (-1948.934) [-1948.346] * (-1949.417) (-1947.587) [-1952.532] (-1949.039) -- 0:00:42 349000 -- (-1950.112) [-1947.020] (-1948.925) (-1950.479) * (-1950.683) (-1946.743) [-1952.752] (-1949.036) -- 0:00:42 349500 -- (-1947.436) (-1949.851) [-1948.732] (-1949.332) * (-1949.766) [-1946.874] (-1950.666) (-1949.826) -- 0:00:42 350000 -- [-1948.290] (-1951.909) (-1953.692) (-1951.950) * [-1951.627] (-1949.694) (-1948.150) (-1946.795) -- 0:00:42 Average standard deviation of split frequencies: 0.008619 350500 -- (-1948.883) (-1951.958) [-1951.067] (-1949.225) * (-1948.673) [-1951.517] (-1949.528) (-1954.849) -- 0:00:42 351000 -- (-1948.072) (-1950.330) (-1951.426) [-1948.371] * (-1950.743) [-1947.571] (-1949.019) (-1947.061) -- 0:00:42 351500 -- (-1948.433) (-1948.226) [-1949.770] (-1949.009) * (-1950.506) (-1948.181) [-1948.605] (-1948.167) -- 0:00:42 352000 -- (-1947.261) (-1947.757) [-1949.103] (-1951.317) * (-1949.890) [-1947.302] (-1950.368) (-1947.330) -- 0:00:42 352500 -- (-1950.394) (-1949.073) [-1948.719] (-1950.518) * (-1951.650) (-1949.559) (-1953.980) [-1947.330] -- 0:00:42 353000 -- (-1950.344) (-1948.414) [-1948.357] (-1949.602) * (-1950.280) [-1947.173] (-1950.173) (-1947.697) -- 0:00:42 353500 -- [-1947.171] (-1949.736) (-1949.526) (-1951.044) * (-1948.225) (-1947.255) (-1949.880) [-1947.618] -- 0:00:42 354000 -- (-1947.033) (-1950.651) (-1951.945) [-1951.429] * [-1948.215] (-1947.385) (-1951.991) (-1948.073) -- 0:00:41 354500 -- (-1947.870) (-1947.777) (-1949.632) [-1951.077] * [-1950.449] (-1947.351) (-1947.513) (-1947.350) -- 0:00:41 355000 -- (-1950.884) (-1947.046) (-1949.726) [-1949.625] * [-1948.171] (-1949.126) (-1946.817) (-1948.295) -- 0:00:41 Average standard deviation of split frequencies: 0.008607 355500 -- (-1950.777) (-1950.938) (-1949.901) [-1950.371] * (-1949.080) (-1949.021) (-1946.919) [-1949.174] -- 0:00:41 356000 -- (-1950.754) [-1947.481] (-1950.330) (-1949.890) * [-1947.528] (-1947.989) (-1947.648) (-1948.517) -- 0:00:41 356500 -- [-1951.287] (-1948.416) (-1947.173) (-1952.003) * (-1948.799) (-1949.119) (-1947.612) [-1948.445] -- 0:00:41 357000 -- (-1949.453) (-1946.787) (-1947.726) [-1950.593] * (-1948.651) (-1947.186) [-1948.403] (-1949.798) -- 0:00:41 357500 -- [-1948.523] (-1946.787) (-1949.947) (-1949.126) * (-1950.212) (-1953.134) [-1951.579] (-1949.146) -- 0:00:41 358000 -- [-1946.753] (-1950.378) (-1949.531) (-1951.028) * (-1948.122) (-1948.324) (-1948.130) [-1949.779] -- 0:00:41 358500 -- [-1946.809] (-1947.870) (-1953.186) (-1949.018) * [-1950.231] (-1950.452) (-1948.579) (-1948.619) -- 0:00:41 359000 -- (-1949.555) (-1946.723) [-1951.351] (-1949.469) * (-1949.892) [-1947.528] (-1947.416) (-1948.268) -- 0:00:41 359500 -- [-1947.127] (-1947.535) (-1953.625) (-1947.317) * (-1948.380) (-1948.124) [-1947.826] (-1948.376) -- 0:00:40 360000 -- [-1948.383] (-1949.584) (-1952.992) (-1949.764) * (-1949.687) [-1952.617] (-1946.699) (-1947.879) -- 0:00:42 Average standard deviation of split frequencies: 0.008169 360500 -- [-1951.305] (-1949.097) (-1950.390) (-1947.082) * (-1948.193) (-1948.037) [-1947.614] (-1947.978) -- 0:00:42 361000 -- (-1948.907) (-1949.851) [-1947.613] (-1947.688) * (-1947.102) (-1947.641) (-1949.183) [-1948.601] -- 0:00:42 361500 -- (-1954.115) (-1951.939) [-1947.095] (-1947.068) * (-1947.219) [-1947.314] (-1949.925) (-1948.513) -- 0:00:42 362000 -- (-1948.428) (-1950.267) (-1951.622) [-1946.954] * [-1948.126] (-1948.263) (-1950.591) (-1948.673) -- 0:00:42 362500 -- (-1953.462) (-1951.938) [-1948.643] (-1947.353) * (-1954.906) [-1947.000] (-1949.840) (-1949.624) -- 0:00:42 363000 -- (-1952.968) [-1952.145] (-1950.803) (-1948.481) * (-1948.238) [-1946.652] (-1950.085) (-1953.178) -- 0:00:42 363500 -- (-1948.553) [-1950.367] (-1950.281) (-1948.522) * (-1949.608) (-1947.455) [-1950.321] (-1950.750) -- 0:00:42 364000 -- (-1947.254) [-1948.457] (-1950.357) (-1950.319) * [-1950.209] (-1947.431) (-1949.925) (-1948.956) -- 0:00:41 364500 -- (-1948.331) (-1948.880) (-1948.737) [-1950.314] * (-1947.271) (-1946.929) [-1948.520] (-1948.368) -- 0:00:41 365000 -- (-1948.663) [-1948.842] (-1951.471) (-1948.013) * [-1949.992] (-1946.891) (-1947.277) (-1948.601) -- 0:00:41 Average standard deviation of split frequencies: 0.008291 365500 -- (-1951.026) [-1948.408] (-1949.630) (-1947.741) * (-1949.432) (-1950.895) (-1947.871) [-1948.579] -- 0:00:41 366000 -- (-1948.748) (-1948.119) (-1948.343) [-1950.604] * (-1948.899) (-1951.983) (-1953.027) [-1948.652] -- 0:00:41 366500 -- (-1948.728) [-1948.727] (-1948.259) (-1948.182) * (-1948.654) [-1947.919] (-1948.149) (-1949.895) -- 0:00:41 367000 -- (-1950.096) [-1949.736] (-1951.069) (-1948.172) * (-1946.951) (-1946.881) [-1951.188] (-1947.720) -- 0:00:41 367500 -- (-1948.126) (-1950.640) (-1953.412) [-1948.434] * [-1946.790] (-1952.723) (-1948.562) (-1947.911) -- 0:00:41 368000 -- (-1952.299) (-1952.231) (-1954.054) [-1946.898] * (-1946.768) (-1946.573) [-1948.290] (-1947.443) -- 0:00:41 368500 -- (-1956.180) [-1950.314] (-1948.232) (-1946.916) * (-1948.702) [-1946.530] (-1948.262) (-1951.292) -- 0:00:41 369000 -- [-1949.776] (-1949.053) (-1947.369) (-1946.916) * [-1949.330] (-1952.817) (-1946.912) (-1947.921) -- 0:00:41 369500 -- (-1949.824) (-1949.080) [-1948.470] (-1946.922) * [-1950.038] (-1948.582) (-1947.938) (-1947.480) -- 0:00:40 370000 -- [-1947.901] (-1948.961) (-1948.542) (-1946.922) * (-1948.186) [-1947.611] (-1948.342) (-1948.930) -- 0:00:40 Average standard deviation of split frequencies: 0.009061 370500 -- (-1948.050) [-1948.087] (-1951.098) (-1946.803) * [-1948.312] (-1947.257) (-1949.039) (-1949.515) -- 0:00:40 371000 -- (-1948.005) [-1947.425] (-1947.619) (-1946.803) * [-1949.714] (-1953.915) (-1948.869) (-1948.300) -- 0:00:40 371500 -- (-1950.318) (-1947.333) (-1948.180) [-1946.922] * (-1948.219) [-1947.727] (-1948.225) (-1947.027) -- 0:00:40 372000 -- (-1951.257) [-1948.319] (-1948.181) (-1947.431) * (-1950.448) (-1948.562) (-1950.248) [-1948.578] -- 0:00:40 372500 -- (-1950.740) [-1950.480] (-1947.590) (-1947.963) * (-1950.455) [-1949.584] (-1949.868) (-1948.512) -- 0:00:40 373000 -- (-1947.608) (-1948.903) (-1950.179) [-1947.867] * (-1952.253) (-1948.767) [-1949.103] (-1947.771) -- 0:00:40 373500 -- [-1948.075] (-1949.747) (-1948.626) (-1947.199) * (-1951.828) [-1951.104] (-1949.232) (-1948.524) -- 0:00:40 374000 -- [-1947.278] (-1949.308) (-1947.224) (-1947.199) * (-1950.349) [-1948.788] (-1949.669) (-1955.394) -- 0:00:40 374500 -- (-1952.374) [-1947.264] (-1953.799) (-1951.439) * (-1949.225) [-1947.847] (-1950.773) (-1950.194) -- 0:00:40 375000 -- (-1947.703) (-1948.385) (-1957.765) [-1948.597] * (-1949.866) (-1951.905) [-1948.170] (-1949.656) -- 0:00:41 Average standard deviation of split frequencies: 0.008191 375500 -- (-1948.057) (-1949.126) [-1949.752] (-1949.557) * (-1948.719) (-1947.910) (-1948.896) [-1948.579] -- 0:00:41 376000 -- (-1951.446) [-1947.239] (-1951.282) (-1950.325) * (-1948.719) (-1952.103) [-1947.272] (-1947.737) -- 0:00:41 376500 -- (-1950.537) (-1947.525) (-1952.400) [-1948.976] * (-1947.047) [-1947.199] (-1947.278) (-1948.617) -- 0:00:41 377000 -- (-1950.669) (-1947.994) [-1947.674] (-1947.894) * (-1948.796) (-1950.751) (-1950.489) [-1949.408] -- 0:00:41 377500 -- (-1948.373) [-1949.162] (-1947.247) (-1949.996) * [-1947.762] (-1950.300) (-1950.234) (-1950.458) -- 0:00:41 378000 -- [-1947.673] (-1947.581) (-1947.492) (-1952.390) * (-1948.895) (-1947.211) [-1950.140] (-1948.941) -- 0:00:41 378500 -- [-1947.675] (-1947.794) (-1947.054) (-1952.631) * [-1947.884] (-1948.574) (-1949.067) (-1949.952) -- 0:00:41 379000 -- (-1949.792) (-1948.413) [-1946.699] (-1950.429) * (-1953.509) (-1948.596) [-1947.240] (-1947.016) -- 0:00:40 379500 -- (-1956.582) [-1947.639] (-1946.647) (-1951.057) * (-1948.199) [-1948.678] (-1947.968) (-1949.541) -- 0:00:40 380000 -- (-1951.998) (-1949.532) [-1948.336] (-1948.812) * (-1948.583) (-1948.955) [-1947.728] (-1948.719) -- 0:00:40 Average standard deviation of split frequencies: 0.008173 380500 -- (-1950.186) [-1947.785] (-1949.929) (-1954.639) * (-1947.799) (-1951.773) [-1949.104] (-1947.544) -- 0:00:40 381000 -- (-1949.718) [-1948.581] (-1952.023) (-1950.420) * [-1947.516] (-1950.352) (-1948.853) (-1949.766) -- 0:00:40 381500 -- (-1950.005) (-1948.782) (-1952.141) [-1949.721] * (-1946.910) (-1952.847) [-1948.684] (-1952.519) -- 0:00:40 382000 -- [-1950.066] (-1949.045) (-1953.737) (-1948.350) * (-1947.946) (-1952.623) (-1951.917) [-1947.217] -- 0:00:40 382500 -- [-1951.289] (-1949.834) (-1951.446) (-1949.481) * (-1949.773) [-1952.275] (-1951.595) (-1946.823) -- 0:00:40 383000 -- (-1947.847) (-1950.854) (-1954.620) [-1948.525] * [-1948.681] (-1947.998) (-1948.896) (-1947.103) -- 0:00:40 383500 -- (-1948.162) [-1950.785] (-1951.324) (-1952.068) * (-1948.298) (-1947.457) [-1957