--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:08:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/otsB2/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1748.38         -1751.59
2      -1748.43         -1751.00
--------------------------------------
TOTAL    -1748.40         -1751.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.903838    0.091739    0.353282    1.499609    0.872794   1200.21   1210.17    1.000
r(A<->C){all}   0.159427    0.018839    0.000006    0.441860    0.125648    199.81    208.61    1.001
r(A<->G){all}   0.177927    0.021438    0.000128    0.477441    0.144306    164.85    215.50    1.007
r(A<->T){all}   0.158823    0.018068    0.000044    0.431896    0.121688    209.20    214.28    1.000
r(C<->G){all}   0.169356    0.019839    0.000046    0.455606    0.133889    207.10    281.51    1.000
r(C<->T){all}   0.162327    0.020186    0.000065    0.463136    0.120667    182.20    203.36    1.003
r(G<->T){all}   0.172141    0.021455    0.000024    0.470087    0.132252    184.72    196.46    1.000
pi(A){all}      0.212740    0.000134    0.190668    0.235156    0.212740   1088.18   1110.49    1.000
pi(C){all}      0.324149    0.000165    0.300682    0.349884    0.323973   1189.79   1263.36    1.000
pi(G){all}      0.289625    0.000164    0.265348    0.315199    0.289593   1210.57   1262.96    1.000
pi(T){all}      0.173486    0.000106    0.153448    0.193097    0.173313   1310.23   1313.18    1.000
alpha{1,2}      0.446404    0.254345    0.000150    1.474748    0.270252   1297.94   1341.29    1.001
alpha{3}        0.469237    0.265013    0.000100    1.490845    0.300688   1308.83   1356.58    1.000
pinvar{all}     0.998882    0.000002    0.996615    1.000000    0.999264   1097.47   1239.58    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1679.227196
Model 2: PositiveSelection	-1679.227402
Model 0: one-ratio	-1679.227531
Model 7: beta	-1679.227279
Model 8: beta&w>1	-1679.22736


Model 0 vs 1	6.699999999000283E-4

Model 2 vs 1	4.119999998692947E-4

Model 8 vs 7	1.6200000027311035E-4
>C1
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C2
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C3
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C4
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C5
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C6
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=429 

C1              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C2              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C3              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C4              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C5              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C6              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
                **************************************************

C1              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C2              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C3              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C4              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C5              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C6              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
                **************************************************

C1              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C2              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C3              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C4              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C5              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C6              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
                **************************************************

C1              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C2              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C3              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C4              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C5              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C6              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
                **************************************************

C1              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C2              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C3              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C4              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C5              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C6              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
                **************************************************

C1              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C2              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C3              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C4              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C5              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C6              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
                **************************************************

C1              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C2              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C3              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C4              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C5              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C6              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
                **************************************************

C1              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C2              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C3              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C4              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C5              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C6              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
                **************************************************

C1              TAALFTLDSPMHVSEFTERLARQLSDTQR
C2              TAALFTLDSPMHVSEFTERLARQLSDTQR
C3              TAALFTLDSPMHVSEFTERLARQLSDTQR
C4              TAALFTLDSPMHVSEFTERLARQLSDTQR
C5              TAALFTLDSPMHVSEFTERLARQLSDTQR
C6              TAALFTLDSPMHVSEFTERLARQLSDTQR
                *****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  429 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  429 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12870]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12870]--->[12870]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.541 Mb, Max= 31.015 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C2              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C3              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C4              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C5              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
C6              MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
                **************************************************

C1              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C2              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C3              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C4              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C5              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
C6              NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
                **************************************************

C1              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C2              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C3              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C4              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C5              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
C6              AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
                **************************************************

C1              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C2              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C3              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C4              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C5              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
C6              GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
                **************************************************

C1              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C2              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C3              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C4              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C5              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
C6              GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
                **************************************************

C1              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C2              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C3              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C4              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C5              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
C6              THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
                **************************************************

C1              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C2              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C3              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C4              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C5              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
C6              DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
                **************************************************

C1              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C2              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C3              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C4              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C5              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
C6              HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
                **************************************************

C1              TAALFTLDSPMHVSEFTERLARQLSDTQR
C2              TAALFTLDSPMHVSEFTERLARQLSDTQR
C3              TAALFTLDSPMHVSEFTERLARQLSDTQR
C4              TAALFTLDSPMHVSEFTERLARQLSDTQR
C5              TAALFTLDSPMHVSEFTERLARQLSDTQR
C6              TAALFTLDSPMHVSEFTERLARQLSDTQR
                *****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
C2              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
C3              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
C4              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
C5              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
C6              ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
                **************************************************

C1              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
C2              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
C3              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
C4              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
C5              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
C6              CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
                **************************************************

C1              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
C2              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
C3              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
C4              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
C5              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
C6              GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
                **************************************************

C1              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
C2              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
C3              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
C4              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
C5              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
C6              AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
                **************************************************

C1              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
C2              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
C3              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
C4              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
C5              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
C6              CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
                **************************************************

C1              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
C2              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
C3              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
C4              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
C5              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
C6              CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
                **************************************************

C1              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
C2              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
C3              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
C4              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
C5              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
C6              GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
                **************************************************

C1              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
C2              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
C3              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
C4              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
C5              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
C6              CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
                **************************************************

C1              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
C2              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
C3              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
C4              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
C5              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
C6              CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
                **************************************************

C1              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
C2              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
C3              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
C4              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
C5              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
C6              GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
                **************************************************

C1              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
C2              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
C3              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
C4              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
C5              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
C6              AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
                **************************************************

C1              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
C2              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
C3              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
C4              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
C5              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
C6              GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
                **************************************************

C1              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
C2              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
C3              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
C4              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
C5              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
C6              GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
                **************************************************

C1              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
C2              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
C3              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
C4              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
C5              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
C6              ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
                **************************************************

C1              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
C2              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
C3              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
C4              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
C5              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
C6              GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
                **************************************************

C1              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
C2              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
C3              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
C4              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
C5              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
C6              ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
                **************************************************

C1              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
C2              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
C3              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
C4              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
C5              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
C6              AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
                **************************************************

C1              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
C2              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
C3              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
C4              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
C5              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
C6              TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
                **************************************************

C1              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
C2              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
C3              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
C4              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
C5              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
C6              GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
                **************************************************

C1              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
C2              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
C3              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
C4              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
C5              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
C6              CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
                **************************************************

C1              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
C2              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
C3              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
C4              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
C5              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
C6              TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
                **************************************************

C1              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
C2              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
C3              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
C4              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
C5              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
C6              CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
                **************************************************

C1              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
C2              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
C3              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
C4              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
C5              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
C6              CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
                **************************************************

C1              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
C2              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
C3              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
C4              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
C5              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
C6              TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
                **************************************************

C1              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
C2              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
C3              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
C4              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
C5              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
C6              ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
                **************************************************

C1              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
C2              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
C3              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
C4              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
C5              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
C6              CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
                *************************************



>C1
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C2
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C3
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C4
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C5
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C6
ATGCCGGTCACCATAGACCCGCGGCGCCACAGCGCAGCACTGTTCGACCT
CGACGCCGTAGTGACCGACACCCCACTCGACTCCACAGTGACGCTGGTCC
GGCAACTTCAGGGGATCGGTGTGGGTACCGCCGTTTTTTCGACCAACCGC
AACAGCCAGGGCGTGCTGACTGCAACCGGCCTCGACCATCTGTTCCCCGT
CCACGTTGACGGCCTAGCTAGCGGAAAAGTCACCATCCTAGTCGCCGCGG
CCAACCGCTTAATGGCGCAACCAGGCCGGTGCGTCGTCGTCGCAGTCGAC
GCGGCCGGCATAACGGCCGCACGCTATGGCGGTTTCGCGCTGGTGCTCGG
CCTAGTAATAGGGGAAGATCAGACAGGCCACCGCGACACACTGCGTAACT
CCGGCGCCGACACGGTAGTTGCCGACCTAGGTGAGGTCATCGTCCGAACC
GGGGACCGCCGGATGTCGGAACTTCCCGACGCGCTGCAGACCCTCGGCTT
AACTGACGACCTCACCGCTCGGCAGCCGGCGGTGTTCTTCGACTTCGACG
GCACACTGTCAGACATCGTCGATGATCCCGACTCGGCCAGACCCGTTCCC
GGCGCGACCGAAGCATTGCAGAAGTTGGCCACACATTGTCCAGTGGCCAT
ACTGTCTGGTCGCGATCTCGCAGATGTAATCAAGCGCATCGGCGTGCCCG
GAATCTGGTATTCCGGCAGTCATGGTTTTGAGTCAACTGCACCCGACGGC
ACACATCATCAAAACGACGCAGCGGAAGCGACGATACCCATACTGGAGCA
AGCGGCGACCCAGCTACGCGACCAACTCGGACCAATTCCGGGAGTCATGG
TGGAACACAAGCGTTTTGGCGTAGCAGTGCACTACCGTAACGTCGCGCGT
GACCGCGTCAACGAGGTCGCAGTGGCGGTGCGCACAGCAGGCCAGCGCAA
CGCACTTCGGGTGACAACAGGTCGCGAGGTCATCGAGCTGCGTCCCGACA
TCGACTGGGACAAGGGAAAAACACTCCATTGGGTGATCGATCGCCTGCAC
CATGCCGGCACTCAAGTAGGCTCAGCTTCGCTCATGCCGATCTGTCTCGG
CGACGACATAACCGACGAGGACGCGTTCGACGCAGTGCGCCACACCGACG
TTGGGGGTATTCCGATCGTGGTACGACACACTGAAGACGGTAACCGCGCA
ACAGCCGCATTGTTCACGTTGGACAGTCCTATGCACGTCAGTGAATTCAC
CGAACGGTTGGCACGCCAGCTTAGTGACACTCAACGC
>C1
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C2
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C3
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C4
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C5
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR
>C6
MPVTIDPRRHSAALFDLDAVVTDTPLDSTVTLVRQLQGIGVGTAVFSTNR
NSQGVLTATGLDHLFPVHVDGLASGKVTILVAAANRLMAQPGRCVVVAVD
AAGITAARYGGFALVLGLVIGEDQTGHRDTLRNSGADTVVADLGEVIVRT
GDRRMSELPDALQTLGLTDDLTARQPAVFFDFDGTLSDIVDDPDSARPVP
GATEALQKLATHCPVAILSGRDLADVIKRIGVPGIWYSGSHGFESTAPDG
THHQNDAAEATIPILEQAATQLRDQLGPIPGVMVEHKRFGVAVHYRNVAR
DRVNEVAVAVRTAGQRNALRVTTGREVIELRPDIDWDKGKTLHWVIDRLH
HAGTQVGSASLMPICLGDDITDEDAFDAVRHTDVGGIPIVVRHTEDGNRA
TAALFTLDSPMHVSEFTERLARQLSDTQR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1287 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579784831
      Setting output file names to "/data/10res/otsB2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1245164847
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9421110066
      Seed = 2078034101
      Swapseed = 1579784831
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2880.367708 -- -24.965149
         Chain 2 -- -2880.367543 -- -24.965149
         Chain 3 -- -2880.367708 -- -24.965149
         Chain 4 -- -2880.367708 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2880.367708 -- -24.965149
         Chain 2 -- -2880.367708 -- -24.965149
         Chain 3 -- -2880.367543 -- -24.965149
         Chain 4 -- -2880.367708 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2880.368] (-2880.368) (-2880.368) (-2880.368) * [-2880.368] (-2880.368) (-2880.368) (-2880.368) 
        500 -- (-1799.155) (-1777.999) [-1757.218] (-1763.934) * (-1759.542) (-1756.364) [-1768.119] (-1764.826) -- 0:00:00
       1000 -- (-1766.730) (-1764.085) (-1753.492) [-1754.744] * (-1759.510) (-1758.474) [-1760.784] (-1761.069) -- 0:00:00
       1500 -- [-1760.199] (-1759.408) (-1755.000) (-1754.420) * (-1756.653) (-1769.579) (-1759.332) [-1764.423] -- 0:00:00
       2000 -- (-1761.645) (-1759.514) (-1760.763) [-1759.735] * (-1767.239) (-1757.734) [-1764.919] (-1758.604) -- 0:00:00
       2500 -- (-1757.506) (-1758.876) (-1770.049) [-1755.514] * (-1760.781) (-1757.161) (-1754.849) [-1752.851] -- 0:00:00
       3000 -- (-1763.482) (-1762.030) (-1756.420) [-1756.091] * [-1756.408] (-1756.811) (-1761.109) (-1760.149) -- 0:00:00
       3500 -- (-1756.373) (-1758.196) (-1759.076) [-1753.102] * (-1761.915) (-1757.701) [-1759.046] (-1771.208) -- 0:00:00
       4000 -- (-1756.983) (-1758.682) [-1757.423] (-1759.772) * (-1755.464) [-1761.395] (-1761.035) (-1756.311) -- 0:00:00
       4500 -- (-1759.331) (-1763.223) (-1756.623) [-1760.608] * (-1758.259) (-1761.909) [-1764.874] (-1762.078) -- 0:00:00
       5000 -- (-1759.789) (-1755.278) [-1756.559] (-1757.241) * (-1758.968) (-1757.180) [-1756.002] (-1757.461) -- 0:00:00

      Average standard deviation of split frequencies: 0.135707

       5500 -- (-1769.006) [-1758.329] (-1758.252) (-1758.906) * (-1758.914) (-1765.422) [-1758.129] (-1755.506) -- 0:00:00
       6000 -- (-1762.252) (-1756.553) [-1756.701] (-1765.637) * (-1756.678) [-1759.954] (-1757.533) (-1756.644) -- 0:00:00
       6500 -- (-1758.114) (-1755.169) (-1762.355) [-1765.304] * (-1756.901) (-1754.392) (-1753.874) [-1761.295] -- 0:00:00
       7000 -- (-1755.260) [-1761.738] (-1758.572) (-1762.882) * (-1758.010) [-1759.654] (-1758.565) (-1759.132) -- 0:02:21
       7500 -- (-1755.975) [-1754.512] (-1763.727) (-1758.579) * (-1756.158) (-1758.941) [-1758.211] (-1760.929) -- 0:02:12
       8000 -- (-1764.577) [-1753.431] (-1759.641) (-1762.711) * (-1755.350) [-1758.805] (-1779.079) (-1752.996) -- 0:02:04
       8500 -- (-1758.499) (-1758.395) [-1753.968] (-1761.709) * (-1756.767) [-1758.384] (-1761.000) (-1753.784) -- 0:01:56
       9000 -- [-1755.071] (-1756.920) (-1754.918) (-1763.987) * (-1756.614) [-1757.248] (-1765.650) (-1759.207) -- 0:01:50
       9500 -- (-1760.682) [-1757.717] (-1756.415) (-1758.597) * [-1755.870] (-1757.028) (-1763.015) (-1763.629) -- 0:01:44
      10000 -- (-1756.491) (-1764.732) [-1752.174] (-1761.244) * [-1761.551] (-1765.346) (-1769.619) (-1755.804) -- 0:01:39

      Average standard deviation of split frequencies: 0.074432

      10500 -- (-1759.423) (-1762.083) (-1760.284) [-1756.609] * (-1766.559) (-1757.318) [-1758.685] (-1761.089) -- 0:01:34
      11000 -- [-1762.383] (-1759.076) (-1759.170) (-1766.423) * (-1760.843) [-1759.665] (-1761.288) (-1756.611) -- 0:01:29
      11500 -- [-1756.427] (-1757.125) (-1759.659) (-1757.705) * (-1765.413) (-1753.608) [-1755.568] (-1758.718) -- 0:01:25
      12000 -- [-1763.526] (-1756.309) (-1765.766) (-1754.934) * (-1764.799) (-1755.001) [-1756.293] (-1758.993) -- 0:01:22
      12500 -- [-1761.372] (-1758.858) (-1760.501) (-1761.574) * (-1764.515) (-1758.941) [-1753.531] (-1764.312) -- 0:01:19
      13000 -- [-1757.569] (-1761.502) (-1757.397) (-1765.051) * [-1761.964] (-1758.754) (-1761.221) (-1763.972) -- 0:01:15
      13500 -- (-1764.373) [-1752.285] (-1757.234) (-1756.018) * (-1755.491) (-1760.855) [-1754.917] (-1760.782) -- 0:01:13
      14000 -- (-1768.516) [-1760.591] (-1763.910) (-1755.827) * [-1753.882] (-1767.187) (-1752.387) (-1756.508) -- 0:01:10
      14500 -- (-1764.893) (-1751.707) (-1762.025) [-1757.300] * (-1757.565) (-1755.300) (-1768.563) [-1756.775] -- 0:01:07
      15000 -- (-1756.336) (-1767.406) [-1755.495] (-1762.914) * (-1756.203) [-1757.241] (-1765.031) (-1759.433) -- 0:01:05

      Average standard deviation of split frequencies: 0.063578

      15500 -- (-1764.284) [-1757.011] (-1759.292) (-1754.888) * (-1761.709) (-1765.027) (-1763.467) [-1755.910] -- 0:01:03
      16000 -- [-1752.708] (-1751.338) (-1757.284) (-1758.646) * (-1768.387) [-1761.875] (-1762.613) (-1764.660) -- 0:01:01
      16500 -- [-1758.602] (-1751.021) (-1754.632) (-1759.474) * (-1770.818) [-1771.943] (-1758.197) (-1759.418) -- 0:00:59
      17000 -- (-1765.870) (-1751.402) (-1760.446) [-1757.877] * (-1756.246) [-1754.133] (-1757.618) (-1764.050) -- 0:00:57
      17500 -- (-1755.372) (-1750.273) (-1756.098) [-1752.694] * (-1756.414) [-1753.892] (-1761.092) (-1758.498) -- 0:00:56
      18000 -- (-1767.436) (-1752.460) [-1754.111] (-1757.943) * (-1759.194) (-1767.371) [-1754.034] (-1760.101) -- 0:00:54
      18500 -- (-1762.674) (-1750.702) [-1755.269] (-1764.833) * (-1762.434) (-1759.548) (-1756.582) [-1758.096] -- 0:00:53
      19000 -- [-1752.912] (-1751.214) (-1755.515) (-1760.469) * (-1755.312) [-1757.425] (-1760.765) (-1761.141) -- 0:00:51
      19500 -- (-1749.914) (-1752.722) [-1752.095] (-1755.357) * (-1756.701) (-1762.602) (-1766.476) [-1760.062] -- 0:00:50
      20000 -- [-1749.868] (-1750.539) (-1756.198) (-1763.251) * [-1753.026] (-1758.165) (-1763.635) (-1759.988) -- 0:00:49

      Average standard deviation of split frequencies: 0.046820

      20500 -- [-1750.400] (-1749.255) (-1762.070) (-1761.722) * (-1755.531) [-1753.703] (-1766.870) (-1760.296) -- 0:00:47
      21000 -- [-1751.423] (-1752.372) (-1757.012) (-1759.591) * (-1755.959) (-1754.829) (-1763.853) [-1754.738] -- 0:00:46
      21500 -- [-1748.449] (-1753.018) (-1760.823) (-1759.822) * (-1755.069) (-1754.676) [-1759.125] (-1763.073) -- 0:00:45
      22000 -- (-1751.175) (-1749.400) (-1756.590) [-1754.845] * (-1757.312) (-1752.183) (-1758.955) [-1759.712] -- 0:01:28
      22500 -- (-1753.363) [-1752.836] (-1760.044) (-1763.100) * (-1764.845) (-1751.834) [-1757.721] (-1750.275) -- 0:01:26
      23000 -- (-1750.257) (-1751.645) [-1754.527] (-1763.208) * [-1757.374] (-1748.570) (-1760.638) (-1751.175) -- 0:01:24
      23500 -- (-1749.985) (-1750.003) (-1763.176) [-1757.350] * (-1762.074) (-1749.343) (-1761.922) [-1753.223] -- 0:01:23
      24000 -- (-1751.751) (-1748.859) (-1756.251) [-1761.682] * (-1763.638) [-1748.787] (-1762.027) (-1754.298) -- 0:01:21
      24500 -- (-1747.390) (-1748.104) (-1759.843) [-1760.302] * (-1755.580) (-1748.071) (-1754.879) [-1748.807] -- 0:01:19
      25000 -- (-1749.516) (-1750.396) (-1765.279) [-1752.436] * (-1771.739) (-1749.173) (-1750.632) [-1749.429] -- 0:01:18

      Average standard deviation of split frequencies: 0.038982

      25500 -- (-1749.157) (-1749.661) [-1758.150] (-1757.785) * (-1758.394) (-1750.813) (-1751.307) [-1749.646] -- 0:01:16
      26000 -- (-1749.275) (-1750.151) [-1758.984] (-1758.246) * (-1752.843) (-1750.131) [-1750.436] (-1750.655) -- 0:01:14
      26500 -- (-1750.846) (-1749.622) [-1757.838] (-1751.325) * [-1753.611] (-1748.879) (-1751.021) (-1753.018) -- 0:01:13
      27000 -- (-1749.230) [-1749.740] (-1758.783) (-1760.338) * (-1758.669) [-1750.596] (-1750.653) (-1752.225) -- 0:01:12
      27500 -- (-1750.380) [-1750.610] (-1756.097) (-1760.845) * (-1751.792) [-1749.676] (-1752.188) (-1748.127) -- 0:01:10
      28000 -- (-1747.679) [-1748.099] (-1755.378) (-1755.420) * (-1751.778) [-1749.230] (-1747.559) (-1748.616) -- 0:01:09
      28500 -- (-1747.679) (-1751.317) [-1758.572] (-1760.137) * (-1749.501) (-1750.201) [-1750.073] (-1753.260) -- 0:01:08
      29000 -- (-1747.314) (-1747.811) [-1759.777] (-1758.008) * (-1750.353) (-1747.283) [-1750.073] (-1753.606) -- 0:01:06
      29500 -- (-1749.806) [-1748.323] (-1765.084) (-1754.597) * (-1749.025) (-1749.629) (-1752.875) [-1748.577] -- 0:01:05
      30000 -- (-1749.941) (-1747.493) [-1755.804] (-1756.466) * [-1748.259] (-1749.701) (-1749.388) (-1749.689) -- 0:01:04

      Average standard deviation of split frequencies: 0.030744

      30500 -- (-1753.557) (-1748.523) [-1754.341] (-1762.954) * (-1748.391) (-1749.336) [-1750.537] (-1747.577) -- 0:01:03
      31000 -- (-1749.808) (-1748.132) [-1759.374] (-1760.373) * (-1752.350) (-1748.039) [-1750.460] (-1747.821) -- 0:01:02
      31500 -- (-1749.509) [-1747.202] (-1760.994) (-1751.587) * (-1752.936) (-1750.024) (-1748.967) [-1747.069] -- 0:01:01
      32000 -- (-1754.486) [-1748.260] (-1764.726) (-1756.528) * [-1751.582] (-1748.950) (-1749.073) (-1746.927) -- 0:01:00
      32500 -- (-1749.168) (-1750.623) [-1762.455] (-1758.459) * [-1748.671] (-1747.638) (-1749.082) (-1747.383) -- 0:00:59
      33000 -- (-1749.373) [-1750.943] (-1762.874) (-1758.076) * (-1751.682) (-1747.386) (-1748.963) [-1747.809] -- 0:00:58
      33500 -- [-1746.960] (-1748.260) (-1765.585) (-1759.428) * (-1750.885) (-1751.256) (-1750.921) [-1748.218] -- 0:00:57
      34000 -- (-1748.976) [-1748.381] (-1763.676) (-1764.978) * (-1750.322) [-1754.745] (-1750.932) (-1748.055) -- 0:00:56
      34500 -- [-1748.582] (-1749.466) (-1756.249) (-1762.503) * [-1751.121] (-1746.906) (-1750.245) (-1748.251) -- 0:00:55
      35000 -- (-1749.745) (-1750.215) (-1755.912) [-1756.321] * (-1748.684) (-1747.624) [-1750.882] (-1750.544) -- 0:00:55

      Average standard deviation of split frequencies: 0.025534

      35500 -- (-1748.787) [-1747.665] (-1759.912) (-1759.121) * (-1747.917) (-1749.225) [-1747.790] (-1748.307) -- 0:00:54
      36000 -- (-1749.479) [-1747.768] (-1759.163) (-1756.440) * (-1751.669) [-1749.241] (-1747.647) (-1748.719) -- 0:00:53
      36500 -- (-1749.917) (-1749.102) (-1759.207) [-1758.908] * (-1752.369) (-1750.146) [-1747.936] (-1749.246) -- 0:00:52
      37000 -- (-1751.814) [-1749.488] (-1759.391) (-1760.280) * (-1748.965) [-1748.942] (-1751.982) (-1749.439) -- 0:01:18
      37500 -- (-1750.239) (-1751.240) (-1755.414) [-1757.929] * (-1748.777) [-1750.553] (-1747.536) (-1749.159) -- 0:01:17
      38000 -- (-1750.620) (-1748.215) [-1753.485] (-1764.956) * (-1748.707) [-1748.613] (-1748.715) (-1749.556) -- 0:01:15
      38500 -- (-1749.418) (-1749.985) (-1759.033) [-1756.243] * [-1754.790] (-1748.100) (-1747.790) (-1752.151) -- 0:01:14
      39000 -- (-1749.114) (-1752.068) (-1761.691) [-1761.581] * (-1750.906) [-1747.102] (-1747.377) (-1752.194) -- 0:01:13
      39500 -- (-1748.170) (-1748.083) [-1758.470] (-1753.179) * (-1749.331) (-1748.257) (-1749.198) [-1751.157] -- 0:01:12
      40000 -- [-1748.555] (-1748.068) (-1762.727) (-1748.970) * (-1752.049) (-1747.411) [-1748.023] (-1750.172) -- 0:01:12

      Average standard deviation of split frequencies: 0.032457

      40500 -- [-1749.706] (-1750.371) (-1757.982) (-1752.029) * [-1747.821] (-1748.141) (-1747.512) (-1751.834) -- 0:01:11
      41000 -- [-1748.557] (-1748.715) (-1762.714) (-1749.149) * (-1748.668) [-1747.385] (-1748.042) (-1752.362) -- 0:01:10
      41500 -- (-1752.671) [-1748.499] (-1747.765) (-1749.287) * (-1748.670) [-1749.233] (-1748.445) (-1749.427) -- 0:01:09
      42000 -- (-1753.105) (-1756.062) [-1747.528] (-1747.940) * (-1748.510) (-1751.491) [-1748.268] (-1749.319) -- 0:01:08
      42500 -- [-1748.190] (-1751.474) (-1746.887) (-1748.324) * (-1748.141) (-1750.235) (-1747.434) [-1749.330] -- 0:01:07
      43000 -- [-1748.390] (-1746.903) (-1747.923) (-1748.768) * (-1747.853) (-1750.439) (-1748.088) [-1748.056] -- 0:01:06
      43500 -- (-1752.051) (-1747.661) (-1758.667) [-1749.626] * [-1747.293] (-1748.632) (-1749.478) (-1748.085) -- 0:01:05
      44000 -- (-1752.775) (-1752.859) (-1751.036) [-1749.630] * (-1747.673) (-1749.467) [-1748.795] (-1748.641) -- 0:01:05
      44500 -- (-1751.942) [-1749.872] (-1750.022) (-1751.117) * (-1747.923) [-1749.314] (-1750.105) (-1750.256) -- 0:01:04
      45000 -- [-1751.339] (-1749.596) (-1750.702) (-1748.374) * [-1747.923] (-1748.070) (-1750.072) (-1751.030) -- 0:01:03

      Average standard deviation of split frequencies: 0.026645

      45500 -- (-1755.278) (-1752.121) [-1747.894] (-1748.441) * (-1749.484) (-1751.294) (-1749.333) [-1750.355] -- 0:01:02
      46000 -- (-1753.044) (-1756.865) [-1748.274] (-1750.441) * [-1754.086] (-1748.615) (-1749.667) (-1752.874) -- 0:01:02
      46500 -- (-1752.959) (-1748.218) (-1749.120) [-1750.005] * (-1754.206) [-1748.002] (-1750.431) (-1748.897) -- 0:01:01
      47000 -- (-1752.390) [-1748.118] (-1749.499) (-1748.429) * (-1753.178) (-1748.966) (-1749.521) [-1754.254] -- 0:01:00
      47500 -- [-1751.609] (-1747.779) (-1747.594) (-1751.928) * (-1750.971) (-1749.256) (-1750.569) [-1749.061] -- 0:01:00
      48000 -- (-1752.681) [-1749.106] (-1747.868) (-1747.889) * (-1748.325) (-1748.367) (-1749.480) [-1747.631] -- 0:00:59
      48500 -- (-1752.143) (-1752.852) (-1748.876) [-1747.709] * (-1749.956) (-1747.793) [-1750.395] (-1747.491) -- 0:00:58
      49000 -- (-1748.484) (-1754.628) [-1748.693] (-1747.588) * (-1749.378) (-1747.757) (-1752.864) [-1747.147] -- 0:00:58
      49500 -- (-1748.437) [-1748.132] (-1748.721) (-1750.167) * (-1748.745) (-1747.773) [-1751.531] (-1751.030) -- 0:00:57
      50000 -- [-1749.147] (-1747.861) (-1749.117) (-1749.236) * (-1750.498) [-1747.992] (-1751.475) (-1748.659) -- 0:00:57

      Average standard deviation of split frequencies: 0.031457

      50500 -- (-1749.487) [-1747.861] (-1747.695) (-1748.911) * (-1749.012) [-1748.700] (-1750.852) (-1751.535) -- 0:00:56
      51000 -- (-1748.852) (-1748.166) (-1748.863) [-1748.116] * (-1749.512) [-1751.627] (-1749.338) (-1748.340) -- 0:00:55
      51500 -- (-1748.816) (-1751.524) [-1750.455] (-1748.199) * (-1749.420) (-1752.599) [-1747.386] (-1748.371) -- 0:01:13
      52000 -- [-1749.661] (-1749.708) (-1750.695) (-1747.369) * (-1748.547) (-1748.039) (-1746.988) [-1748.469] -- 0:01:12
      52500 -- (-1749.072) (-1748.129) [-1747.714] (-1750.045) * (-1748.224) (-1747.905) (-1749.356) [-1749.358] -- 0:01:12
      53000 -- (-1750.481) [-1748.126] (-1748.740) (-1749.991) * (-1749.424) (-1748.015) (-1749.351) [-1750.810] -- 0:01:11
      53500 -- (-1747.683) (-1749.689) [-1748.077] (-1750.164) * [-1749.229] (-1747.665) (-1749.325) (-1750.383) -- 0:01:10
      54000 -- (-1748.056) (-1747.690) (-1749.493) [-1747.545] * (-1747.554) (-1747.417) [-1748.051] (-1753.095) -- 0:01:10
      54500 -- (-1750.946) (-1749.735) (-1748.547) [-1747.768] * (-1747.665) [-1747.882] (-1748.384) (-1749.017) -- 0:01:09
      55000 -- (-1749.509) (-1747.500) (-1748.614) [-1750.171] * (-1747.878) (-1750.968) (-1750.904) [-1750.759] -- 0:01:08

      Average standard deviation of split frequencies: 0.032786

      55500 -- (-1749.057) [-1746.970] (-1747.987) (-1752.642) * (-1747.963) [-1748.518] (-1751.193) (-1748.928) -- 0:01:08
      56000 -- (-1749.134) (-1746.970) (-1749.332) [-1749.791] * [-1747.327] (-1748.357) (-1749.075) (-1747.772) -- 0:01:07
      56500 -- [-1750.249] (-1747.121) (-1749.500) (-1747.631) * (-1749.562) [-1747.446] (-1753.536) (-1747.520) -- 0:01:06
      57000 -- (-1748.460) (-1747.530) (-1749.925) [-1747.691] * (-1748.328) [-1747.679] (-1751.550) (-1747.520) -- 0:01:06
      57500 -- (-1747.697) (-1747.560) (-1749.017) [-1748.950] * (-1748.329) [-1747.637] (-1749.075) (-1746.986) -- 0:01:05
      58000 -- (-1749.007) (-1752.245) (-1750.145) [-1748.950] * (-1748.493) [-1747.200] (-1751.614) (-1749.730) -- 0:01:04
      58500 -- (-1759.794) [-1747.311] (-1749.522) (-1750.967) * (-1751.406) (-1747.074) [-1749.023] (-1752.043) -- 0:01:04
      59000 -- [-1747.148] (-1748.685) (-1748.425) (-1750.237) * [-1749.362] (-1747.221) (-1748.413) (-1749.072) -- 0:01:03
      59500 -- (-1747.342) (-1748.459) [-1749.477] (-1750.138) * (-1751.751) [-1747.994] (-1748.302) (-1751.451) -- 0:01:03
      60000 -- (-1747.558) [-1748.332] (-1750.974) (-1750.845) * (-1748.543) [-1747.228] (-1748.123) (-1751.976) -- 0:01:02

      Average standard deviation of split frequencies: 0.033535

      60500 -- (-1747.637) (-1748.596) [-1752.662] (-1752.558) * (-1752.119) (-1747.623) (-1748.167) [-1752.635] -- 0:01:02
      61000 -- (-1747.237) (-1749.360) [-1748.317] (-1749.654) * [-1749.316] (-1748.576) (-1748.903) (-1752.768) -- 0:01:01
      61500 -- (-1748.252) [-1747.157] (-1747.137) (-1747.727) * (-1748.735) [-1747.376] (-1748.469) (-1749.163) -- 0:01:01
      62000 -- (-1748.764) [-1746.712] (-1747.130) (-1749.814) * (-1749.796) (-1747.021) [-1747.683] (-1752.319) -- 0:01:00
      62500 -- (-1748.910) (-1747.389) [-1747.075] (-1748.278) * (-1750.013) [-1747.690] (-1747.682) (-1756.565) -- 0:01:00
      63000 -- (-1748.716) (-1748.984) (-1747.957) [-1748.403] * (-1750.560) (-1747.798) [-1750.020] (-1750.754) -- 0:00:59
      63500 -- (-1748.396) [-1750.015] (-1748.272) (-1752.171) * (-1749.476) (-1747.797) (-1751.976) [-1752.125] -- 0:00:58
      64000 -- (-1748.815) (-1747.427) (-1747.893) [-1748.127] * (-1748.247) [-1748.592] (-1752.913) (-1750.270) -- 0:00:58
      64500 -- (-1749.224) (-1750.759) (-1750.022) [-1749.694] * (-1749.180) [-1756.240] (-1748.536) (-1749.533) -- 0:00:58
      65000 -- (-1748.193) [-1750.072] (-1751.217) (-1752.306) * (-1748.223) (-1748.950) [-1750.360] (-1749.772) -- 0:00:57

      Average standard deviation of split frequencies: 0.030713

      65500 -- (-1748.999) (-1749.391) (-1752.338) [-1747.468] * (-1748.421) (-1749.613) (-1753.337) [-1748.474] -- 0:00:57
      66000 -- (-1748.666) (-1748.055) [-1747.452] (-1752.264) * (-1749.920) (-1747.701) (-1748.135) [-1753.417] -- 0:00:56
      66500 -- [-1747.712] (-1748.057) (-1751.567) (-1751.296) * (-1751.178) (-1750.262) [-1747.711] (-1750.427) -- 0:00:56
      67000 -- (-1749.841) (-1748.091) [-1747.881] (-1748.535) * (-1749.652) (-1749.030) [-1747.639] (-1749.429) -- 0:01:09
      67500 -- [-1748.694] (-1747.658) (-1748.147) (-1748.748) * (-1748.424) (-1748.757) [-1747.539] (-1750.228) -- 0:01:09
      68000 -- [-1748.349] (-1746.789) (-1747.513) (-1750.593) * (-1749.446) (-1748.369) [-1747.848] (-1751.955) -- 0:01:08
      68500 -- (-1750.377) [-1751.916] (-1749.816) (-1749.562) * [-1751.514] (-1749.138) (-1748.938) (-1749.998) -- 0:01:07
      69000 -- (-1749.188) [-1749.372] (-1750.099) (-1749.986) * (-1750.302) (-1748.903) [-1750.807] (-1748.165) -- 0:01:07
      69500 -- (-1752.063) (-1749.144) [-1747.975] (-1750.342) * (-1749.506) (-1747.802) (-1751.850) [-1749.240] -- 0:01:06
      70000 -- (-1750.063) [-1750.085] (-1748.133) (-1751.370) * (-1749.490) [-1748.039] (-1751.400) (-1749.788) -- 0:01:06

      Average standard deviation of split frequencies: 0.034056

      70500 -- (-1751.076) (-1750.248) (-1748.967) [-1751.061] * (-1749.545) [-1752.358] (-1751.785) (-1749.604) -- 0:01:05
      71000 -- (-1749.083) (-1749.455) (-1753.226) [-1749.927] * (-1749.824) [-1754.120] (-1752.665) (-1749.210) -- 0:01:05
      71500 -- (-1751.851) (-1748.675) (-1750.472) [-1754.568] * (-1749.414) (-1751.751) (-1752.767) [-1749.228] -- 0:01:04
      72000 -- (-1752.221) [-1748.331] (-1751.576) (-1753.811) * [-1748.117] (-1753.985) (-1753.571) (-1749.285) -- 0:01:04
      72500 -- (-1749.808) (-1747.021) (-1748.969) [-1751.107] * (-1750.307) [-1749.939] (-1749.728) (-1751.344) -- 0:01:03
      73000 -- (-1748.154) (-1750.713) (-1749.354) [-1752.745] * (-1751.672) (-1748.283) (-1749.115) [-1754.982] -- 0:01:03
      73500 -- (-1751.625) (-1749.051) (-1753.071) [-1749.643] * (-1749.883) (-1747.778) (-1750.498) [-1750.700] -- 0:01:03
      74000 -- (-1748.228) [-1749.224] (-1747.855) (-1748.778) * (-1748.935) [-1748.369] (-1751.762) (-1751.142) -- 0:01:02
      74500 -- (-1748.748) [-1747.629] (-1747.325) (-1748.058) * (-1748.059) (-1748.578) [-1749.188] (-1748.642) -- 0:01:02
      75000 -- (-1751.234) (-1748.156) [-1748.156] (-1748.070) * (-1748.450) (-1748.874) (-1749.869) [-1748.987] -- 0:01:01

      Average standard deviation of split frequencies: 0.033184

      75500 -- (-1751.735) [-1749.508] (-1752.340) (-1749.102) * (-1748.936) (-1748.867) [-1748.300] (-1749.903) -- 0:01:01
      76000 -- (-1751.486) (-1749.047) (-1749.305) [-1753.020] * (-1753.202) [-1748.458] (-1748.479) (-1749.662) -- 0:01:00
      76500 -- [-1747.039] (-1748.750) (-1748.216) (-1748.102) * (-1757.451) [-1748.136] (-1750.107) (-1750.049) -- 0:01:00
      77000 -- [-1747.737] (-1747.338) (-1749.805) (-1749.104) * (-1748.568) (-1748.280) [-1747.446] (-1749.266) -- 0:00:59
      77500 -- [-1748.954] (-1747.440) (-1753.024) (-1749.177) * (-1749.779) (-1750.223) [-1747.325] (-1752.297) -- 0:00:59
      78000 -- [-1747.529] (-1748.562) (-1747.585) (-1751.575) * (-1749.048) [-1748.526] (-1754.036) (-1753.172) -- 0:00:59
      78500 -- (-1747.669) [-1748.733] (-1747.750) (-1751.862) * (-1747.627) (-1751.505) (-1753.397) [-1752.486] -- 0:00:58
      79000 -- (-1748.957) (-1748.236) [-1747.917] (-1751.427) * (-1750.611) (-1748.466) (-1752.474) [-1750.947] -- 0:00:58
      79500 -- (-1751.493) (-1748.842) [-1749.023] (-1749.524) * (-1747.946) [-1747.334] (-1749.324) (-1748.866) -- 0:00:57
      80000 -- (-1750.429) [-1752.101] (-1748.357) (-1754.245) * (-1748.694) (-1747.840) [-1747.370] (-1751.449) -- 0:00:57

      Average standard deviation of split frequencies: 0.033602

      80500 -- [-1750.126] (-1751.923) (-1748.251) (-1749.223) * [-1751.143] (-1747.453) (-1747.739) (-1750.096) -- 0:00:57
      81000 -- (-1749.980) (-1750.136) (-1748.318) [-1750.720] * [-1749.143] (-1749.671) (-1749.786) (-1750.159) -- 0:00:56
      81500 -- (-1749.119) (-1753.206) (-1748.690) [-1750.985] * (-1750.310) (-1749.410) (-1751.536) [-1749.439] -- 0:00:56
      82000 -- (-1748.776) [-1749.646] (-1749.519) (-1750.170) * (-1753.157) [-1747.706] (-1749.038) (-1748.469) -- 0:00:55
      82500 -- [-1748.271] (-1752.660) (-1749.670) (-1753.257) * (-1751.823) (-1749.341) (-1748.273) [-1749.547] -- 0:01:06
      83000 -- (-1749.684) (-1752.996) (-1749.615) [-1752.350] * (-1750.386) (-1747.409) (-1747.315) [-1748.038] -- 0:01:06
      83500 -- (-1749.835) (-1748.049) [-1749.543] (-1751.333) * (-1749.206) [-1749.616] (-1747.832) (-1748.028) -- 0:01:05
      84000 -- (-1750.715) (-1748.545) (-1750.859) [-1750.465] * (-1750.649) [-1750.955] (-1751.082) (-1746.857) -- 0:01:05
      84500 -- [-1750.484] (-1752.856) (-1750.713) (-1749.982) * (-1750.514) (-1747.525) (-1747.633) [-1749.304] -- 0:01:05
      85000 -- (-1748.322) (-1752.025) (-1749.397) [-1747.659] * (-1749.630) (-1748.054) (-1747.526) [-1747.531] -- 0:01:04

      Average standard deviation of split frequencies: 0.030278

      85500 -- [-1748.083] (-1751.483) (-1750.259) (-1750.687) * (-1750.542) (-1748.002) [-1747.254] (-1750.778) -- 0:01:04
      86000 -- [-1748.077] (-1749.369) (-1755.754) (-1748.520) * (-1749.648) (-1747.549) (-1750.459) [-1747.155] -- 0:01:03
      86500 -- [-1749.328] (-1747.761) (-1748.925) (-1747.572) * [-1748.727] (-1749.281) (-1746.870) (-1747.214) -- 0:01:03
      87000 -- [-1750.061] (-1750.286) (-1748.154) (-1748.629) * (-1747.537) (-1748.903) [-1748.297] (-1747.113) -- 0:01:02
      87500 -- [-1749.724] (-1749.039) (-1748.427) (-1751.623) * (-1748.393) [-1749.076] (-1750.735) (-1747.916) -- 0:01:02
      88000 -- (-1748.889) [-1748.583] (-1748.570) (-1752.945) * (-1748.387) (-1748.340) [-1750.629] (-1750.066) -- 0:01:02
      88500 -- (-1750.636) [-1749.899] (-1748.387) (-1751.872) * (-1747.655) [-1748.898] (-1750.097) (-1752.253) -- 0:01:01
      89000 -- [-1749.062] (-1754.228) (-1747.281) (-1749.938) * (-1747.293) [-1748.506] (-1750.874) (-1753.552) -- 0:01:01
      89500 -- (-1750.946) (-1750.805) [-1748.115] (-1751.181) * [-1750.334] (-1749.057) (-1751.651) (-1753.522) -- 0:01:01
      90000 -- (-1750.679) (-1750.181) [-1748.983] (-1750.818) * (-1749.058) [-1749.863] (-1750.617) (-1747.222) -- 0:01:00

      Average standard deviation of split frequencies: 0.028336

      90500 -- (-1750.545) [-1751.006] (-1750.899) (-1750.732) * [-1749.027] (-1749.904) (-1752.937) (-1747.105) -- 0:01:00
      91000 -- (-1750.016) (-1749.677) [-1748.518] (-1750.604) * (-1749.092) (-1748.530) (-1749.413) [-1748.363] -- 0:00:59
      91500 -- (-1748.830) (-1748.807) [-1749.965] (-1748.650) * (-1750.260) (-1754.012) [-1748.241] (-1747.820) -- 0:00:59
      92000 -- [-1749.658] (-1748.323) (-1748.636) (-1747.767) * (-1750.144) (-1748.936) [-1747.251] (-1747.820) -- 0:00:59
      92500 -- (-1748.686) (-1750.688) [-1749.628] (-1754.467) * (-1748.882) (-1751.954) [-1747.580] (-1747.907) -- 0:00:58
      93000 -- [-1749.588] (-1751.550) (-1751.349) (-1747.845) * (-1749.787) [-1748.718] (-1747.907) (-1751.461) -- 0:00:58
      93500 -- (-1750.275) (-1750.103) (-1749.082) [-1747.694] * (-1748.602) (-1750.377) [-1749.733] (-1752.652) -- 0:00:58
      94000 -- (-1749.996) (-1751.240) (-1748.442) [-1747.998] * (-1748.540) (-1749.116) [-1749.586] (-1751.857) -- 0:00:57
      94500 -- (-1747.309) (-1754.078) (-1750.115) [-1747.399] * (-1752.352) [-1747.459] (-1748.623) (-1748.315) -- 0:00:57
      95000 -- (-1748.778) (-1751.334) [-1753.830] (-1748.586) * (-1750.115) (-1750.286) (-1747.000) [-1747.221] -- 0:00:57

      Average standard deviation of split frequencies: 0.027395

      95500 -- (-1746.802) (-1751.649) (-1751.668) [-1750.123] * (-1747.700) [-1747.696] (-1746.982) (-1747.234) -- 0:00:56
      96000 -- [-1748.341] (-1751.753) (-1750.404) (-1747.745) * (-1749.720) (-1747.790) [-1748.543] (-1747.578) -- 0:00:56
      96500 -- (-1748.401) [-1749.912] (-1748.237) (-1749.024) * (-1747.537) (-1747.801) [-1749.961] (-1747.578) -- 0:00:56
      97000 -- (-1747.377) (-1749.856) [-1749.694] (-1749.713) * (-1747.984) (-1748.694) [-1749.156] (-1749.759) -- 0:00:55
      97500 -- [-1748.599] (-1750.039) (-1749.072) (-1749.204) * (-1748.865) [-1748.637] (-1750.913) (-1748.264) -- 0:00:55
      98000 -- (-1747.296) (-1749.317) [-1748.980] (-1747.487) * (-1749.237) (-1748.582) (-1747.824) [-1747.477] -- 0:00:55
      98500 -- [-1747.318] (-1749.927) (-1749.756) (-1747.690) * (-1752.825) (-1753.396) [-1748.037] (-1752.049) -- 0:01:04
      99000 -- [-1749.904] (-1749.316) (-1749.195) (-1749.574) * (-1752.399) (-1750.741) [-1747.764] (-1754.057) -- 0:01:03
      99500 -- (-1747.109) (-1748.035) [-1753.003] (-1751.062) * (-1755.176) (-1750.520) (-1747.078) [-1749.609] -- 0:01:03
      100000 -- (-1747.198) (-1749.213) [-1749.092] (-1751.062) * (-1756.918) [-1749.738] (-1747.354) (-1756.497) -- 0:01:02

      Average standard deviation of split frequencies: 0.025235

      100500 -- (-1749.278) (-1748.697) [-1747.254] (-1748.858) * [-1751.655] (-1752.218) (-1747.066) (-1749.576) -- 0:01:02
      101000 -- (-1750.196) (-1750.053) [-1748.517] (-1746.955) * (-1752.512) [-1753.215] (-1747.666) (-1751.059) -- 0:01:02
      101500 -- (-1750.841) [-1747.073] (-1749.183) (-1748.425) * (-1747.781) (-1749.111) (-1746.968) [-1750.208] -- 0:01:01
      102000 -- (-1752.168) [-1747.073] (-1749.383) (-1746.836) * (-1749.719) [-1753.418] (-1748.847) (-1750.877) -- 0:01:01
      102500 -- (-1751.391) [-1751.627] (-1749.692) (-1750.962) * (-1749.199) (-1749.110) [-1749.343] (-1750.027) -- 0:01:01
      103000 -- (-1752.317) (-1748.432) [-1748.294] (-1753.889) * (-1748.059) [-1748.827] (-1751.812) (-1750.115) -- 0:01:00
      103500 -- (-1751.526) [-1748.354] (-1747.863) (-1751.481) * (-1747.004) (-1752.531) (-1751.827) [-1748.033] -- 0:01:00
      104000 -- [-1750.257] (-1749.568) (-1749.071) (-1749.395) * (-1747.829) (-1749.400) (-1751.622) [-1748.186] -- 0:01:00
      104500 -- (-1747.645) (-1752.960) (-1748.508) [-1748.689] * (-1749.400) (-1748.838) [-1747.730] (-1748.057) -- 0:00:59
      105000 -- [-1748.558] (-1750.835) (-1753.516) (-1747.253) * (-1747.524) (-1749.865) [-1747.093] (-1748.691) -- 0:00:59

      Average standard deviation of split frequencies: 0.023172

      105500 -- [-1748.740] (-1750.724) (-1751.968) (-1747.129) * [-1746.934] (-1750.871) (-1747.472) (-1748.789) -- 0:00:59
      106000 -- (-1747.193) (-1748.980) (-1751.206) [-1749.702] * (-1747.788) [-1749.878] (-1751.272) (-1748.386) -- 0:00:59
      106500 -- (-1747.827) (-1749.003) (-1751.040) [-1750.973] * [-1747.206] (-1749.997) (-1748.182) (-1748.308) -- 0:00:58
      107000 -- [-1749.034] (-1751.331) (-1751.107) (-1749.343) * (-1747.729) (-1749.794) [-1747.441] (-1750.431) -- 0:00:58
      107500 -- (-1748.860) (-1751.863) [-1748.896] (-1748.390) * (-1747.618) [-1752.423] (-1748.999) (-1749.412) -- 0:00:58
      108000 -- (-1748.978) [-1747.840] (-1748.488) (-1748.830) * (-1748.085) [-1752.096] (-1748.728) (-1747.179) -- 0:00:57
      108500 -- [-1750.072] (-1749.009) (-1750.915) (-1749.040) * (-1753.146) (-1750.041) [-1748.407] (-1749.147) -- 0:00:57
      109000 -- [-1748.767] (-1749.082) (-1753.548) (-1754.280) * (-1750.935) (-1748.743) [-1748.964] (-1750.564) -- 0:00:57
      109500 -- [-1749.452] (-1749.081) (-1753.653) (-1752.680) * (-1749.258) [-1750.491] (-1747.912) (-1751.454) -- 0:00:56
      110000 -- (-1749.136) (-1749.210) (-1751.813) [-1748.537] * (-1747.590) [-1750.232] (-1751.270) (-1748.942) -- 0:00:56

      Average standard deviation of split frequencies: 0.022363

      110500 -- (-1751.730) (-1748.512) [-1751.262] (-1748.980) * (-1748.273) [-1750.237] (-1749.332) (-1747.974) -- 0:00:56
      111000 -- (-1751.456) [-1748.564] (-1749.407) (-1749.360) * (-1751.949) (-1749.612) (-1749.289) [-1748.176] -- 0:00:56
      111500 -- (-1751.521) [-1753.278] (-1752.748) (-1752.803) * (-1750.792) (-1749.138) [-1750.435] (-1751.517) -- 0:00:55
      112000 -- [-1749.030] (-1750.573) (-1758.193) (-1749.247) * (-1748.740) (-1749.551) (-1753.288) [-1751.587] -- 0:00:55
      112500 -- (-1753.902) (-1751.695) [-1748.684] (-1752.246) * (-1749.589) (-1750.060) [-1747.412] (-1753.390) -- 0:00:55
      113000 -- (-1752.006) [-1751.427] (-1749.187) (-1753.443) * (-1750.023) (-1749.936) [-1747.459] (-1748.546) -- 0:00:54
      113500 -- [-1753.197] (-1749.585) (-1749.285) (-1749.328) * (-1750.690) [-1755.350] (-1747.853) (-1751.045) -- 0:01:02
      114000 -- (-1749.969) [-1750.996] (-1751.955) (-1749.402) * [-1749.849] (-1751.432) (-1746.833) (-1749.369) -- 0:01:02
      114500 -- (-1748.426) [-1748.056] (-1749.100) (-1748.330) * (-1750.730) [-1750.747] (-1749.386) (-1749.451) -- 0:01:01
      115000 -- (-1747.400) (-1749.638) (-1748.065) [-1747.816] * (-1749.441) (-1752.350) (-1750.429) [-1749.301] -- 0:01:01

      Average standard deviation of split frequencies: 0.019891

      115500 -- (-1750.370) (-1751.017) [-1747.996] (-1749.470) * (-1749.242) (-1752.811) [-1748.078] (-1749.465) -- 0:01:01
      116000 -- (-1750.518) (-1748.903) (-1748.262) [-1750.346] * (-1748.596) (-1752.250) [-1747.720] (-1748.510) -- 0:01:00
      116500 -- (-1749.897) [-1747.289] (-1747.834) (-1748.548) * (-1748.068) (-1748.045) [-1749.227] (-1748.336) -- 0:01:00
      117000 -- [-1749.632] (-1747.235) (-1747.976) (-1748.363) * (-1748.100) (-1749.139) [-1746.956] (-1749.407) -- 0:01:00
      117500 -- (-1747.876) (-1748.000) (-1751.273) [-1747.541] * (-1749.657) (-1748.073) [-1746.999] (-1749.495) -- 0:01:00
      118000 -- (-1748.906) (-1748.589) (-1751.374) [-1747.521] * (-1750.822) (-1747.799) [-1748.949] (-1747.875) -- 0:00:59
      118500 -- (-1752.391) [-1748.079] (-1748.374) (-1748.166) * [-1749.605] (-1750.285) (-1747.582) (-1747.615) -- 0:00:59
      119000 -- (-1747.910) (-1748.737) [-1749.676] (-1748.354) * (-1747.634) (-1748.068) (-1749.734) [-1747.226] -- 0:00:59
      119500 -- [-1748.833] (-1751.053) (-1751.841) (-1748.439) * (-1746.901) (-1747.080) [-1747.735] (-1750.054) -- 0:00:58
      120000 -- (-1749.520) [-1750.336] (-1751.621) (-1751.450) * [-1747.973] (-1748.654) (-1748.472) (-1749.372) -- 0:00:58

      Average standard deviation of split frequencies: 0.019945

      120500 -- (-1750.057) (-1750.213) (-1750.093) [-1748.142] * (-1750.969) (-1749.530) [-1750.269] (-1747.836) -- 0:00:58
      121000 -- (-1751.798) (-1749.949) (-1748.891) [-1748.708] * (-1750.969) [-1750.693] (-1747.900) (-1747.116) -- 0:00:58
      121500 -- [-1748.890] (-1749.052) (-1747.718) (-1748.919) * (-1749.043) [-1748.509] (-1751.597) (-1748.096) -- 0:00:57
      122000 -- (-1749.366) (-1748.418) (-1747.246) [-1747.802] * (-1749.623) [-1748.960] (-1749.971) (-1748.421) -- 0:00:57
      122500 -- (-1748.074) (-1754.442) [-1746.810] (-1748.011) * (-1748.471) (-1750.142) [-1750.142] (-1748.074) -- 0:00:57
      123000 -- (-1748.866) (-1755.554) [-1755.744] (-1748.412) * (-1755.673) (-1748.673) (-1752.587) [-1748.114] -- 0:00:57
      123500 -- [-1748.467] (-1750.279) (-1751.123) (-1749.099) * [-1751.765] (-1747.948) (-1750.960) (-1747.501) -- 0:00:56
      124000 -- [-1749.405] (-1751.092) (-1754.463) (-1750.183) * [-1750.419] (-1748.492) (-1752.038) (-1746.870) -- 0:00:56
      124500 -- (-1747.872) [-1750.602] (-1750.861) (-1748.503) * (-1750.086) [-1750.232] (-1750.184) (-1746.876) -- 0:00:56
      125000 -- [-1747.530] (-1748.635) (-1750.578) (-1747.385) * (-1749.158) (-1751.129) (-1751.326) [-1746.896] -- 0:00:56

      Average standard deviation of split frequencies: 0.019081

      125500 -- (-1754.442) [-1750.796] (-1748.881) (-1750.500) * [-1750.202] (-1753.925) (-1750.400) (-1747.890) -- 0:00:55
      126000 -- (-1754.674) (-1751.477) (-1749.853) [-1749.157] * [-1750.497] (-1747.956) (-1752.505) (-1749.499) -- 0:00:55
      126500 -- [-1750.656] (-1749.026) (-1749.917) (-1747.610) * (-1748.543) (-1748.176) (-1753.498) [-1749.052] -- 0:00:55
      127000 -- (-1749.805) (-1749.164) [-1751.208] (-1747.915) * (-1750.163) [-1748.828] (-1751.466) (-1749.360) -- 0:00:54
      127500 -- (-1749.752) (-1750.211) (-1748.753) [-1747.748] * (-1748.643) (-1748.996) [-1748.468] (-1752.054) -- 0:00:54
      128000 -- (-1748.722) (-1751.567) (-1749.070) [-1747.707] * (-1748.307) (-1748.684) (-1748.461) [-1751.244] -- 0:00:54
      128500 -- (-1748.895) (-1751.731) [-1748.905] (-1747.759) * [-1747.113] (-1748.439) (-1748.233) (-1748.735) -- 0:00:54
      129000 -- (-1747.904) (-1750.636) [-1748.525] (-1748.759) * (-1746.952) (-1748.345) [-1748.202] (-1748.030) -- 0:01:00
      129500 -- [-1748.702] (-1753.206) (-1750.738) (-1748.212) * (-1747.166) [-1747.683] (-1750.344) (-1748.297) -- 0:01:00
      130000 -- (-1750.239) [-1748.931] (-1750.755) (-1747.585) * (-1748.058) [-1748.729] (-1751.547) (-1751.759) -- 0:01:00

      Average standard deviation of split frequencies: 0.022368

      130500 -- (-1749.196) [-1747.391] (-1747.752) (-1748.133) * (-1748.058) (-1747.778) (-1752.834) [-1749.587] -- 0:00:59
      131000 -- [-1749.202] (-1747.574) (-1747.930) (-1748.414) * (-1746.903) (-1748.398) [-1754.874] (-1751.146) -- 0:00:59
      131500 -- [-1748.736] (-1748.535) (-1747.616) (-1748.212) * (-1746.985) (-1747.615) (-1750.672) [-1747.324] -- 0:00:59
      132000 -- (-1748.629) [-1747.548] (-1751.147) (-1749.687) * [-1747.597] (-1747.441) (-1753.337) (-1748.405) -- 0:00:59
      132500 -- (-1748.187) [-1748.262] (-1750.931) (-1750.490) * [-1748.136] (-1749.884) (-1749.121) (-1749.897) -- 0:00:58
      133000 -- (-1751.014) (-1748.435) (-1753.586) [-1748.498] * (-1749.930) (-1748.702) (-1748.233) [-1752.277] -- 0:00:58
      133500 -- (-1752.267) (-1748.191) [-1747.730] (-1759.719) * (-1750.075) [-1748.269] (-1748.754) (-1749.787) -- 0:00:58
      134000 -- (-1750.629) (-1747.313) (-1751.768) [-1749.048] * (-1748.071) (-1748.442) (-1747.730) [-1750.263] -- 0:00:58
      134500 -- (-1750.034) (-1746.850) (-1750.462) [-1748.062] * [-1746.716] (-1748.427) (-1747.597) (-1750.161) -- 0:00:57
      135000 -- (-1750.543) (-1747.818) (-1747.558) [-1749.186] * (-1747.393) [-1747.099] (-1748.796) (-1748.987) -- 0:00:57

      Average standard deviation of split frequencies: 0.023050

      135500 -- (-1750.738) [-1748.186] (-1748.149) (-1749.647) * (-1749.549) [-1748.864] (-1751.299) (-1748.141) -- 0:00:57
      136000 -- (-1752.104) (-1747.810) (-1747.609) [-1748.830] * (-1748.014) (-1750.044) [-1747.155] (-1749.075) -- 0:00:57
      136500 -- (-1750.669) [-1748.877] (-1746.929) (-1748.829) * (-1746.893) (-1747.988) (-1748.155) [-1749.052] -- 0:00:56
      137000 -- (-1752.583) (-1755.735) [-1747.396] (-1748.555) * [-1749.125] (-1750.838) (-1748.315) (-1747.929) -- 0:00:56
      137500 -- (-1750.562) (-1750.395) [-1750.593] (-1752.777) * (-1748.462) (-1749.151) [-1751.244] (-1749.981) -- 0:00:56
      138000 -- (-1749.474) [-1748.918] (-1748.815) (-1753.253) * (-1748.517) (-1747.310) [-1747.838] (-1750.193) -- 0:00:56
      138500 -- (-1752.171) (-1748.269) (-1749.060) [-1752.752] * (-1748.482) (-1749.567) [-1747.958] (-1748.705) -- 0:00:55
      139000 -- (-1756.500) [-1750.279] (-1751.054) (-1750.156) * (-1751.055) (-1749.498) (-1747.792) [-1748.288] -- 0:00:55
      139500 -- (-1748.747) [-1749.133] (-1750.807) (-1750.819) * (-1749.022) (-1749.497) [-1749.854] (-1751.366) -- 0:00:55
      140000 -- (-1751.445) [-1748.308] (-1750.902) (-1751.107) * (-1752.365) [-1750.405] (-1747.701) (-1752.353) -- 0:00:55

      Average standard deviation of split frequencies: 0.022577

      140500 -- [-1750.408] (-1748.217) (-1752.119) (-1751.884) * (-1751.039) (-1747.847) [-1747.749] (-1751.022) -- 0:00:55
      141000 -- [-1753.073] (-1748.872) (-1748.769) (-1748.167) * (-1749.277) [-1748.393] (-1747.676) (-1748.526) -- 0:00:54
      141500 -- (-1749.697) [-1748.922] (-1751.083) (-1747.374) * (-1749.062) (-1747.530) [-1747.152] (-1751.945) -- 0:00:54
      142000 -- (-1749.416) (-1751.449) [-1751.159] (-1748.768) * (-1751.036) (-1750.237) [-1750.173] (-1751.987) -- 0:00:54
      142500 -- (-1752.693) (-1752.283) (-1748.305) [-1748.639] * (-1752.146) [-1752.158] (-1748.552) (-1753.116) -- 0:00:54
      143000 -- [-1749.319] (-1753.605) (-1749.262) (-1748.639) * (-1758.108) (-1751.583) [-1747.837] (-1747.500) -- 0:00:53
      143500 -- (-1747.806) (-1750.546) (-1750.854) [-1748.925] * (-1755.749) [-1750.170] (-1751.111) (-1756.445) -- 0:00:53
      144000 -- [-1748.310] (-1751.642) (-1748.121) (-1750.612) * [-1747.226] (-1748.676) (-1749.745) (-1753.379) -- 0:00:53
      144500 -- [-1748.001] (-1748.553) (-1747.848) (-1748.546) * (-1749.008) [-1749.438] (-1750.235) (-1750.735) -- 0:00:59
      145000 -- (-1748.997) [-1747.179] (-1748.923) (-1748.739) * (-1746.985) [-1751.445] (-1750.182) (-1748.854) -- 0:00:58

      Average standard deviation of split frequencies: 0.021633

      145500 -- (-1749.828) (-1747.421) (-1749.861) [-1747.675] * (-1750.325) (-1750.678) (-1747.635) [-1748.662] -- 0:00:58
      146000 -- (-1749.477) (-1748.209) (-1749.861) [-1748.324] * (-1749.955) [-1748.114] (-1748.715) (-1749.977) -- 0:00:58
      146500 -- [-1749.370] (-1748.092) (-1750.717) (-1748.324) * (-1750.037) (-1747.486) [-1748.535] (-1748.064) -- 0:00:58
      147000 -- (-1748.279) (-1749.110) [-1748.736] (-1749.230) * (-1747.906) (-1747.487) (-1746.993) [-1747.989] -- 0:00:58
      147500 -- (-1750.380) (-1748.987) [-1748.508] (-1751.239) * [-1746.935] (-1748.284) (-1748.438) (-1748.158) -- 0:00:57
      148000 -- (-1747.496) [-1749.985] (-1747.547) (-1750.929) * (-1747.678) (-1748.151) (-1749.668) [-1748.779] -- 0:00:57
      148500 -- (-1747.411) (-1749.966) [-1747.959] (-1749.833) * (-1748.682) (-1749.591) [-1751.582] (-1750.192) -- 0:00:57
      149000 -- (-1748.862) [-1749.530] (-1747.681) (-1750.809) * (-1748.655) [-1749.871] (-1747.656) (-1749.916) -- 0:00:57
      149500 -- [-1749.780] (-1749.721) (-1748.002) (-1749.413) * (-1747.808) [-1748.590] (-1748.592) (-1750.075) -- 0:00:56
      150000 -- (-1748.594) [-1748.132] (-1747.313) (-1749.663) * (-1748.139) [-1749.884] (-1749.720) (-1751.291) -- 0:00:56

      Average standard deviation of split frequencies: 0.020806

      150500 -- (-1748.663) [-1748.005] (-1747.920) (-1748.851) * (-1747.316) [-1752.163] (-1749.312) (-1750.504) -- 0:00:56
      151000 -- [-1747.985] (-1747.851) (-1750.770) (-1749.529) * (-1749.595) [-1749.911] (-1747.621) (-1749.910) -- 0:00:56
      151500 -- [-1748.897] (-1752.300) (-1753.609) (-1756.077) * (-1748.698) (-1748.792) (-1748.374) [-1747.431] -- 0:00:56
      152000 -- (-1748.137) [-1750.884] (-1747.326) (-1751.491) * [-1752.783] (-1750.444) (-1747.460) (-1747.090) -- 0:00:55
      152500 -- [-1747.942] (-1748.160) (-1747.325) (-1750.067) * (-1753.452) (-1748.162) [-1747.236] (-1748.921) -- 0:00:55
      153000 -- (-1747.837) (-1748.850) (-1752.953) [-1750.422] * [-1747.360] (-1749.123) (-1748.206) (-1748.768) -- 0:00:55
      153500 -- (-1748.070) (-1748.933) [-1748.266] (-1751.324) * (-1749.500) (-1749.602) (-1749.973) [-1751.621] -- 0:00:55
      154000 -- (-1755.291) [-1747.820] (-1748.949) (-1747.559) * (-1749.643) (-1748.603) (-1751.653) [-1748.808] -- 0:00:54
      154500 -- [-1748.762] (-1749.360) (-1749.875) (-1751.917) * (-1748.481) [-1749.325] (-1751.174) (-1751.184) -- 0:00:54
      155000 -- (-1749.200) (-1753.572) (-1748.123) [-1752.313] * (-1748.511) (-1749.305) (-1747.958) [-1751.409] -- 0:00:54

      Average standard deviation of split frequencies: 0.019189

      155500 -- (-1748.300) [-1748.725] (-1750.257) (-1748.755) * (-1751.762) (-1748.328) (-1751.438) [-1749.653] -- 0:00:54
      156000 -- (-1752.174) [-1748.870] (-1753.393) (-1746.779) * (-1751.646) [-1747.666] (-1751.136) (-1751.076) -- 0:00:54
      156500 -- (-1748.863) [-1748.747] (-1749.028) (-1746.916) * (-1751.716) (-1749.169) (-1752.027) [-1749.638] -- 0:00:53
      157000 -- (-1748.820) (-1748.867) [-1748.007] (-1746.924) * (-1753.176) (-1749.095) [-1750.180] (-1748.508) -- 0:00:53
      157500 -- (-1749.454) [-1748.545] (-1749.449) (-1746.924) * (-1754.982) [-1748.494] (-1747.516) (-1748.566) -- 0:00:53
      158000 -- (-1751.812) [-1750.482] (-1748.585) (-1747.325) * [-1751.936] (-1749.491) (-1747.548) (-1748.747) -- 0:00:53
      158500 -- (-1750.412) (-1748.405) [-1747.893] (-1747.548) * (-1752.471) [-1748.122] (-1748.167) (-1749.679) -- 0:00:53
      159000 -- (-1748.815) [-1748.336] (-1749.001) (-1748.749) * (-1752.469) (-1747.988) (-1748.583) [-1752.439] -- 0:00:52
      159500 -- (-1748.853) [-1748.339] (-1753.284) (-1748.817) * (-1752.688) [-1748.744] (-1750.703) (-1753.519) -- 0:00:57
      160000 -- (-1748.488) (-1748.105) [-1749.180] (-1747.251) * (-1753.326) (-1747.762) [-1749.369] (-1753.875) -- 0:00:57

      Average standard deviation of split frequencies: 0.018222

      160500 -- (-1750.812) [-1751.043] (-1749.827) (-1748.053) * (-1751.038) [-1748.712] (-1749.657) (-1754.186) -- 0:00:57
      161000 -- [-1749.115] (-1747.749) (-1750.415) (-1748.053) * [-1754.380] (-1749.713) (-1750.585) (-1748.099) -- 0:00:57
      161500 -- [-1750.102] (-1748.127) (-1751.234) (-1748.794) * [-1748.302] (-1747.168) (-1749.064) (-1747.532) -- 0:00:57
      162000 -- (-1756.256) (-1748.082) (-1751.577) [-1747.895] * [-1748.762] (-1747.505) (-1748.628) (-1749.458) -- 0:00:56
      162500 -- (-1749.833) (-1748.425) (-1748.206) [-1747.480] * [-1750.608] (-1748.528) (-1747.318) (-1749.295) -- 0:00:56
      163000 -- (-1751.985) (-1747.871) [-1750.675] (-1749.414) * (-1750.591) (-1752.156) (-1747.430) [-1749.904] -- 0:00:56
      163500 -- [-1753.285] (-1749.053) (-1750.056) (-1749.695) * (-1752.937) [-1751.641] (-1748.286) (-1747.917) -- 0:00:56
      164000 -- [-1749.237] (-1752.172) (-1748.313) (-1749.689) * (-1757.893) [-1749.161] (-1750.474) (-1749.216) -- 0:00:56
      164500 -- [-1747.851] (-1753.814) (-1748.483) (-1749.198) * [-1748.800] (-1751.270) (-1750.105) (-1749.005) -- 0:00:55
      165000 -- [-1752.524] (-1752.216) (-1750.482) (-1747.646) * [-1748.824] (-1748.225) (-1749.559) (-1747.422) -- 0:00:55

      Average standard deviation of split frequencies: 0.019608

      165500 -- (-1748.537) (-1751.897) [-1747.241] (-1748.518) * (-1754.487) (-1748.225) [-1750.027] (-1749.325) -- 0:00:55
      166000 -- (-1746.927) [-1748.186] (-1749.943) (-1748.362) * (-1758.696) [-1747.972] (-1750.817) (-1749.070) -- 0:00:55
      166500 -- [-1746.927] (-1748.084) (-1748.415) (-1750.962) * (-1755.249) (-1747.977) [-1749.596] (-1749.730) -- 0:00:55
      167000 -- [-1747.355] (-1747.484) (-1749.295) (-1750.366) * (-1753.416) (-1748.441) [-1748.726] (-1751.278) -- 0:00:54
      167500 -- (-1750.344) [-1747.165] (-1749.673) (-1750.045) * (-1748.945) (-1753.442) [-1748.801] (-1751.076) -- 0:00:54
      168000 -- (-1747.909) (-1747.361) (-1749.306) [-1750.015] * (-1748.047) (-1751.011) (-1750.295) [-1748.026] -- 0:00:54
      168500 -- [-1748.288] (-1750.880) (-1752.273) (-1750.654) * (-1748.546) (-1752.712) (-1749.098) [-1748.026] -- 0:00:54
      169000 -- (-1749.166) (-1750.462) (-1747.842) [-1747.207] * (-1748.679) (-1756.865) (-1748.888) [-1748.631] -- 0:00:54
      169500 -- (-1747.878) (-1747.134) [-1748.825] (-1747.207) * [-1747.220] (-1757.136) (-1752.920) (-1750.966) -- 0:00:53
      170000 -- (-1748.075) (-1748.885) (-1748.825) [-1747.207] * [-1748.794] (-1748.473) (-1754.357) (-1752.624) -- 0:00:53

      Average standard deviation of split frequencies: 0.022360

      170500 -- [-1748.261] (-1748.740) (-1748.117) (-1747.579) * (-1749.283) (-1753.192) [-1749.498] (-1750.424) -- 0:00:53
      171000 -- (-1748.918) (-1749.491) [-1747.670] (-1751.968) * (-1750.228) (-1754.917) (-1752.085) [-1748.626] -- 0:00:53
      171500 -- (-1749.800) (-1748.372) [-1748.151] (-1747.896) * [-1750.228] (-1756.122) (-1749.353) (-1747.656) -- 0:00:53
      172000 -- (-1751.023) [-1750.397] (-1753.350) (-1749.091) * (-1749.526) (-1756.624) [-1749.824] (-1748.621) -- 0:00:52
      172500 -- (-1750.969) (-1753.136) (-1751.474) [-1747.640] * (-1750.004) (-1749.136) (-1751.426) [-1747.767] -- 0:00:52
      173000 -- (-1752.601) (-1749.603) (-1751.561) [-1747.362] * (-1747.776) [-1751.034] (-1749.906) (-1747.963) -- 0:00:52
      173500 -- (-1750.110) [-1751.841] (-1748.563) (-1747.170) * (-1749.999) (-1749.426) [-1751.131] (-1749.595) -- 0:00:52
      174000 -- (-1749.105) [-1751.696] (-1751.365) (-1749.591) * [-1749.698] (-1750.261) (-1748.066) (-1749.880) -- 0:00:52
      174500 -- (-1748.553) (-1752.934) [-1748.401] (-1749.665) * (-1751.065) [-1747.567] (-1748.139) (-1748.734) -- 0:00:56
      175000 -- [-1749.409] (-1751.690) (-1754.592) (-1750.365) * (-1751.067) (-1750.105) (-1749.170) [-1748.914] -- 0:00:56

      Average standard deviation of split frequencies: 0.023436

      175500 -- (-1748.877) (-1754.660) (-1752.029) [-1749.248] * (-1749.242) [-1748.890] (-1747.025) (-1750.960) -- 0:00:56
      176000 -- (-1748.984) (-1750.127) (-1750.994) [-1748.600] * (-1747.962) (-1749.823) (-1747.841) [-1750.352] -- 0:00:56
      176500 -- (-1748.849) [-1749.932] (-1750.558) (-1748.177) * (-1747.754) (-1749.177) (-1747.852) [-1749.163] -- 0:00:55
      177000 -- (-1750.725) [-1748.155] (-1751.828) (-1748.867) * [-1747.973] (-1751.651) (-1748.173) (-1750.826) -- 0:00:55
      177500 -- (-1748.788) [-1750.513] (-1750.683) (-1750.862) * (-1747.407) (-1756.506) [-1750.945] (-1750.460) -- 0:00:55
      178000 -- (-1748.559) (-1748.442) [-1756.885] (-1759.324) * (-1748.534) (-1752.310) [-1747.227] (-1750.677) -- 0:00:55
      178500 -- [-1751.945] (-1747.205) (-1754.292) (-1753.614) * (-1749.168) (-1749.470) [-1747.230] (-1749.486) -- 0:00:55
      179000 -- [-1751.450] (-1748.399) (-1759.376) (-1748.831) * (-1748.645) (-1748.376) [-1747.533] (-1750.667) -- 0:00:55
      179500 -- (-1747.499) (-1748.173) [-1748.564] (-1748.446) * [-1750.760] (-1750.145) (-1750.989) (-1749.120) -- 0:00:54
      180000 -- (-1749.385) (-1747.655) (-1748.398) [-1748.472] * (-1752.035) (-1748.877) [-1750.448] (-1750.883) -- 0:00:54

      Average standard deviation of split frequencies: 0.023483

      180500 -- (-1748.940) (-1748.367) [-1747.236] (-1747.261) * (-1750.543) (-1748.752) [-1747.754] (-1749.516) -- 0:00:54
      181000 -- (-1748.473) [-1749.466] (-1747.901) (-1748.012) * (-1749.713) [-1748.233] (-1748.036) (-1749.047) -- 0:00:54
      181500 -- (-1748.319) [-1751.365] (-1747.018) (-1747.929) * (-1749.326) (-1750.529) [-1749.537] (-1747.721) -- 0:00:54
      182000 -- (-1746.760) (-1749.007) (-1750.465) [-1749.027] * (-1750.953) (-1750.490) [-1748.058] (-1747.625) -- 0:00:53
      182500 -- (-1750.392) (-1749.677) (-1748.364) [-1750.114] * (-1750.846) (-1751.419) (-1749.320) [-1748.997] -- 0:00:53
      183000 -- (-1748.710) (-1750.402) [-1748.830] (-1750.014) * (-1748.800) (-1751.624) [-1748.657] (-1749.557) -- 0:00:53
      183500 -- (-1747.916) [-1748.914] (-1752.914) (-1747.990) * [-1749.253] (-1751.486) (-1749.432) (-1748.146) -- 0:00:53
      184000 -- (-1747.467) [-1758.079] (-1747.129) (-1748.306) * (-1748.872) [-1747.650] (-1748.113) (-1747.494) -- 0:00:53
      184500 -- (-1748.261) [-1747.456] (-1748.913) (-1748.521) * [-1749.489] (-1747.664) (-1748.220) (-1747.514) -- 0:00:53
      185000 -- (-1748.238) [-1750.694] (-1749.065) (-1748.931) * (-1750.846) [-1747.647] (-1748.220) (-1748.673) -- 0:00:52

      Average standard deviation of split frequencies: 0.021609

      185500 -- (-1749.196) [-1747.834] (-1748.926) (-1748.782) * (-1752.580) [-1748.006] (-1750.576) (-1748.776) -- 0:00:52
      186000 -- [-1751.945] (-1748.897) (-1748.162) (-1749.796) * (-1749.206) (-1748.427) [-1749.074] (-1751.306) -- 0:00:52
      186500 -- (-1750.287) (-1748.427) [-1747.468] (-1749.801) * (-1747.900) [-1747.804] (-1747.738) (-1749.000) -- 0:00:52
      187000 -- [-1748.146] (-1751.540) (-1749.281) (-1749.699) * (-1748.336) (-1748.951) (-1747.738) [-1749.262] -- 0:00:52
      187500 -- (-1747.690) (-1751.505) (-1747.168) [-1748.872] * (-1750.390) (-1749.810) [-1747.491] (-1747.679) -- 0:00:52
      188000 -- [-1748.028] (-1754.063) (-1748.194) (-1748.553) * (-1748.373) (-1752.687) (-1748.557) [-1754.837] -- 0:00:51
      188500 -- [-1748.611] (-1749.620) (-1752.120) (-1752.596) * (-1749.688) [-1750.571] (-1750.280) (-1747.287) -- 0:00:51
      189000 -- (-1755.152) (-1750.128) (-1748.535) [-1748.643] * [-1749.334] (-1749.801) (-1749.051) (-1747.248) -- 0:00:51
      189500 -- [-1747.858] (-1751.840) (-1748.497) (-1749.044) * (-1750.537) (-1752.285) [-1752.654] (-1749.086) -- 0:00:51
      190000 -- (-1753.144) (-1749.776) [-1749.828] (-1749.732) * (-1749.258) [-1747.878] (-1749.807) (-1749.212) -- 0:00:51

      Average standard deviation of split frequencies: 0.019642

      190500 -- (-1747.693) [-1748.417] (-1748.799) (-1750.709) * (-1751.679) (-1747.441) [-1749.172] (-1746.922) -- 0:00:55
      191000 -- [-1747.693] (-1747.338) (-1749.128) (-1751.062) * (-1751.952) [-1747.296] (-1749.959) (-1747.376) -- 0:00:55
      191500 -- (-1747.691) [-1751.030] (-1749.128) (-1752.638) * [-1752.729] (-1747.605) (-1753.996) (-1747.719) -- 0:00:54
      192000 -- [-1747.646] (-1748.494) (-1748.048) (-1752.278) * (-1750.184) (-1747.379) (-1754.141) [-1748.706] -- 0:00:54
      192500 -- [-1754.508] (-1748.526) (-1748.086) (-1751.148) * [-1748.391] (-1747.659) (-1753.519) (-1748.823) -- 0:00:54
      193000 -- [-1749.775] (-1750.990) (-1749.910) (-1753.076) * (-1748.564) (-1750.427) (-1753.330) [-1748.440] -- 0:00:54
      193500 -- (-1752.442) (-1748.962) [-1747.413] (-1749.182) * [-1749.970] (-1749.800) (-1749.321) (-1748.744) -- 0:00:54
      194000 -- [-1749.481] (-1747.774) (-1748.017) (-1754.568) * (-1750.539) [-1748.688] (-1749.275) (-1751.706) -- 0:00:54
      194500 -- (-1748.941) [-1747.437] (-1750.328) (-1754.479) * (-1753.110) [-1753.841] (-1747.491) (-1749.883) -- 0:00:53
      195000 -- [-1747.963] (-1747.335) (-1750.878) (-1755.993) * (-1749.968) (-1753.926) (-1747.363) [-1749.040] -- 0:00:53

      Average standard deviation of split frequencies: 0.017918

      195500 -- [-1748.425] (-1747.474) (-1749.651) (-1748.272) * (-1747.496) (-1750.374) [-1749.247] (-1751.000) -- 0:00:53
      196000 -- [-1748.804] (-1747.957) (-1747.530) (-1749.722) * (-1748.842) [-1752.372] (-1750.138) (-1750.987) -- 0:00:53
      196500 -- (-1748.540) [-1749.321] (-1748.758) (-1749.467) * [-1748.136] (-1752.411) (-1748.368) (-1751.306) -- 0:00:53
      197000 -- [-1749.293] (-1749.878) (-1748.540) (-1746.890) * [-1747.659] (-1751.677) (-1749.871) (-1755.495) -- 0:00:52
      197500 -- (-1753.129) (-1749.222) [-1748.870] (-1746.958) * (-1747.266) (-1748.662) [-1749.054] (-1752.443) -- 0:00:52
      198000 -- (-1750.520) [-1749.472] (-1749.376) (-1746.958) * [-1747.485] (-1748.939) (-1747.914) (-1751.682) -- 0:00:52
      198500 -- (-1751.905) (-1747.691) [-1748.386] (-1749.137) * (-1747.493) (-1748.292) [-1747.349] (-1752.680) -- 0:00:52
      199000 -- (-1748.713) (-1749.888) (-1752.023) [-1751.376] * [-1748.070] (-1748.919) (-1747.681) (-1749.933) -- 0:00:52
      199500 -- (-1748.697) [-1750.137] (-1751.526) (-1752.789) * [-1754.292] (-1749.036) (-1749.417) (-1749.717) -- 0:00:52
      200000 -- (-1746.824) (-1750.015) [-1750.204] (-1752.386) * (-1748.193) (-1750.661) [-1749.360] (-1747.774) -- 0:00:51

      Average standard deviation of split frequencies: 0.018299

      200500 -- (-1747.732) [-1750.261] (-1751.063) (-1751.272) * (-1748.700) [-1750.826] (-1748.973) (-1748.682) -- 0:00:51
      201000 -- (-1752.404) [-1748.664] (-1747.638) (-1750.075) * [-1754.558] (-1754.890) (-1750.666) (-1749.112) -- 0:00:51
      201500 -- (-1747.777) (-1747.774) [-1754.560] (-1751.714) * (-1747.868) [-1747.229] (-1749.712) (-1747.501) -- 0:00:51
      202000 -- (-1749.128) (-1752.271) (-1752.874) [-1747.228] * (-1747.733) (-1747.394) (-1748.986) [-1747.492] -- 0:00:51
      202500 -- (-1750.818) [-1751.754] (-1749.909) (-1749.971) * [-1747.769] (-1748.391) (-1752.197) (-1748.263) -- 0:00:51
      203000 -- (-1750.251) (-1752.813) (-1751.533) [-1749.828] * (-1750.978) [-1748.159] (-1758.681) (-1748.593) -- 0:00:51
      203500 -- (-1747.671) (-1752.518) [-1751.130] (-1750.299) * (-1753.050) [-1749.135] (-1753.580) (-1748.853) -- 0:00:50
      204000 -- [-1748.529] (-1754.073) (-1751.001) (-1748.992) * [-1747.068] (-1751.897) (-1750.014) (-1748.486) -- 0:00:50
      204500 -- (-1748.040) [-1751.662] (-1748.143) (-1756.494) * [-1747.289] (-1754.612) (-1748.662) (-1748.943) -- 0:00:50
      205000 -- [-1747.337] (-1750.349) (-1749.380) (-1748.163) * (-1748.154) [-1752.326] (-1749.671) (-1748.015) -- 0:00:50

      Average standard deviation of split frequencies: 0.016672

      205500 -- (-1747.396) (-1750.132) (-1749.674) [-1747.355] * [-1749.608] (-1750.169) (-1750.086) (-1750.904) -- 0:00:54
      206000 -- [-1747.452] (-1750.787) (-1747.937) (-1747.728) * [-1748.585] (-1750.618) (-1753.747) (-1747.909) -- 0:00:53
      206500 -- [-1748.771] (-1753.061) (-1748.547) (-1747.598) * (-1750.474) (-1748.855) [-1747.307] (-1749.113) -- 0:00:53
      207000 -- (-1748.285) (-1748.780) [-1748.235] (-1748.406) * [-1748.591] (-1747.729) (-1748.323) (-1750.991) -- 0:00:53
      207500 -- (-1750.844) (-1748.770) (-1749.352) [-1749.421] * (-1748.639) [-1747.408] (-1749.462) (-1751.179) -- 0:00:53
      208000 -- (-1750.388) [-1750.255] (-1748.093) (-1750.865) * (-1747.422) [-1747.749] (-1749.440) (-1750.371) -- 0:00:53
      208500 -- (-1749.379) (-1748.111) (-1747.796) [-1754.795] * (-1748.536) (-1747.302) (-1749.290) [-1749.391] -- 0:00:53
      209000 -- (-1748.821) (-1750.268) (-1747.671) [-1748.233] * (-1757.275) (-1747.977) [-1748.329] (-1751.993) -- 0:00:52
      209500 -- (-1748.670) (-1749.050) (-1749.034) [-1752.890] * (-1750.435) (-1751.205) (-1749.972) [-1750.054] -- 0:00:52
      210000 -- (-1747.676) [-1749.309] (-1751.918) (-1748.599) * (-1747.890) (-1750.546) (-1755.636) [-1750.128] -- 0:00:52

      Average standard deviation of split frequencies: 0.015782

      210500 -- [-1747.574] (-1750.493) (-1748.943) (-1749.471) * (-1748.718) (-1749.125) [-1751.507] (-1750.665) -- 0:00:52
      211000 -- (-1750.124) (-1750.080) [-1750.252] (-1749.224) * (-1749.127) (-1748.749) [-1747.389] (-1749.229) -- 0:00:52
      211500 -- [-1751.503] (-1750.900) (-1749.388) (-1750.306) * (-1748.552) (-1748.546) [-1747.664] (-1750.461) -- 0:00:52
      212000 -- [-1748.983] (-1749.414) (-1751.471) (-1748.277) * (-1749.737) (-1748.342) (-1748.838) [-1749.524] -- 0:00:52
      212500 -- (-1747.830) [-1749.447] (-1747.670) (-1747.505) * (-1749.941) (-1750.837) (-1749.720) [-1750.096] -- 0:00:51
      213000 -- (-1747.793) [-1749.690] (-1747.987) (-1747.060) * (-1750.602) (-1752.052) [-1749.199] (-1752.413) -- 0:00:51
      213500 -- (-1748.537) (-1751.823) (-1757.291) [-1749.944] * (-1750.178) (-1748.148) [-1750.977] (-1748.964) -- 0:00:51
      214000 -- [-1747.790] (-1751.965) (-1752.122) (-1751.737) * (-1747.917) (-1750.536) [-1746.933] (-1747.341) -- 0:00:51
      214500 -- (-1747.663) (-1750.443) [-1749.418] (-1750.345) * [-1748.321] (-1750.943) (-1747.586) (-1747.709) -- 0:00:51
      215000 -- [-1750.498] (-1752.818) (-1750.056) (-1749.804) * (-1748.164) [-1748.851] (-1748.606) (-1749.152) -- 0:00:51

      Average standard deviation of split frequencies: 0.014913

      215500 -- (-1749.258) (-1754.052) [-1749.175] (-1749.395) * (-1747.405) (-1747.877) [-1747.671] (-1750.570) -- 0:00:50
      216000 -- [-1751.767] (-1750.868) (-1756.258) (-1748.732) * (-1747.714) (-1748.936) (-1749.299) [-1747.444] -- 0:00:50
      216500 -- [-1753.724] (-1750.107) (-1756.820) (-1748.814) * (-1747.186) (-1747.379) [-1750.340] (-1749.412) -- 0:00:50
      217000 -- [-1751.222] (-1752.002) (-1749.302) (-1750.408) * [-1747.023] (-1747.869) (-1749.046) (-1750.110) -- 0:00:50
      217500 -- (-1748.206) (-1750.304) [-1749.834] (-1749.997) * (-1747.912) (-1749.328) (-1747.767) [-1749.238] -- 0:00:50
      218000 -- [-1751.174] (-1749.967) (-1747.810) (-1751.023) * [-1747.828] (-1749.292) (-1748.590) (-1747.608) -- 0:00:50
      218500 -- (-1752.735) (-1747.672) [-1749.060] (-1747.987) * [-1748.695] (-1748.955) (-1749.090) (-1747.511) -- 0:00:50
      219000 -- [-1752.942] (-1749.483) (-1751.397) (-1752.143) * [-1747.654] (-1748.865) (-1749.897) (-1749.802) -- 0:00:49
      219500 -- [-1750.344] (-1747.964) (-1750.061) (-1751.049) * (-1747.964) (-1747.982) [-1748.208] (-1749.980) -- 0:00:49
      220000 -- [-1750.642] (-1750.610) (-1750.019) (-1751.209) * (-1749.177) (-1750.008) (-1748.208) [-1747.166] -- 0:00:49

      Average standard deviation of split frequencies: 0.014577

      220500 -- [-1748.099] (-1750.510) (-1747.995) (-1748.187) * (-1749.129) [-1748.782] (-1747.981) (-1747.370) -- 0:00:49
      221000 -- (-1747.521) (-1748.564) [-1748.840] (-1748.657) * [-1748.398] (-1747.864) (-1748.779) (-1749.804) -- 0:00:52
      221500 -- (-1748.308) [-1752.223] (-1748.208) (-1754.280) * (-1750.342) (-1747.992) [-1750.445] (-1750.355) -- 0:00:52
      222000 -- [-1748.196] (-1750.563) (-1748.500) (-1749.480) * [-1749.793] (-1747.427) (-1748.570) (-1749.919) -- 0:00:52
      222500 -- (-1748.339) [-1749.136] (-1748.447) (-1753.779) * (-1747.721) (-1746.775) [-1748.169] (-1749.613) -- 0:00:52
      223000 -- (-1748.355) [-1748.899] (-1748.446) (-1751.564) * (-1747.631) (-1748.443) [-1747.908] (-1747.929) -- 0:00:52
      223500 -- (-1748.778) [-1747.643] (-1750.648) (-1747.638) * (-1752.248) [-1748.046] (-1747.706) (-1749.928) -- 0:00:52
      224000 -- (-1748.945) (-1749.310) (-1753.769) [-1752.790] * [-1747.840] (-1750.211) (-1749.028) (-1752.140) -- 0:00:51
      224500 -- (-1748.358) (-1749.842) (-1749.743) [-1749.222] * (-1749.270) [-1749.701] (-1748.357) (-1752.398) -- 0:00:51
      225000 -- (-1750.300) (-1750.998) [-1749.167] (-1751.807) * (-1751.329) (-1747.733) [-1746.921] (-1750.053) -- 0:00:51

      Average standard deviation of split frequencies: 0.015369

      225500 -- (-1749.967) (-1747.951) (-1748.134) [-1748.878] * (-1749.687) [-1748.182] (-1749.554) (-1748.338) -- 0:00:51
      226000 -- (-1748.009) [-1747.843] (-1750.252) (-1750.357) * (-1749.444) [-1749.620] (-1747.648) (-1748.514) -- 0:00:51
      226500 -- [-1748.831] (-1747.461) (-1749.495) (-1752.759) * (-1749.318) (-1748.674) [-1747.441] (-1747.974) -- 0:00:51
      227000 -- (-1750.681) (-1753.455) (-1748.073) [-1748.912] * (-1747.807) (-1752.070) (-1747.118) [-1746.948] -- 0:00:51
      227500 -- (-1749.705) (-1748.702) [-1748.074] (-1747.790) * [-1747.007] (-1749.720) (-1749.979) (-1746.965) -- 0:00:50
      228000 -- [-1751.691] (-1749.283) (-1747.335) (-1750.128) * [-1747.593] (-1749.778) (-1749.947) (-1748.744) -- 0:00:50
      228500 -- (-1750.637) [-1750.223] (-1748.928) (-1749.806) * (-1747.462) (-1750.094) (-1751.348) [-1748.322] -- 0:00:50
      229000 -- (-1749.127) (-1749.888) (-1748.763) [-1749.400] * (-1748.533) [-1754.983] (-1748.792) (-1747.828) -- 0:00:50
      229500 -- (-1747.573) [-1750.058] (-1750.442) (-1749.495) * (-1751.388) (-1750.628) (-1749.732) [-1752.754] -- 0:00:50
      230000 -- (-1747.624) [-1747.256] (-1749.301) (-1748.333) * [-1749.139] (-1752.380) (-1749.670) (-1753.379) -- 0:00:50

      Average standard deviation of split frequencies: 0.015811

      230500 -- (-1747.818) [-1747.256] (-1750.336) (-1747.980) * (-1750.546) [-1749.978] (-1749.283) (-1751.352) -- 0:00:50
      231000 -- (-1747.865) [-1747.218] (-1749.612) (-1748.597) * (-1751.685) (-1749.782) (-1748.481) [-1747.583] -- 0:00:49
      231500 -- (-1748.628) (-1747.196) [-1750.222] (-1747.692) * (-1749.988) (-1751.153) [-1747.478] (-1747.473) -- 0:00:49
      232000 -- (-1748.381) (-1749.875) [-1747.631] (-1748.057) * [-1747.882] (-1750.067) (-1750.627) (-1750.250) -- 0:00:49
      232500 -- (-1750.355) (-1748.197) [-1749.771] (-1748.638) * [-1749.617] (-1752.516) (-1749.345) (-1749.447) -- 0:00:49
      233000 -- (-1749.340) (-1747.837) [-1748.322] (-1749.041) * [-1747.361] (-1750.042) (-1748.306) (-1749.064) -- 0:00:49
      233500 -- (-1751.969) [-1749.733] (-1747.986) (-1757.564) * (-1747.699) (-1747.957) [-1748.172] (-1751.593) -- 0:00:49
      234000 -- (-1753.503) [-1748.012] (-1749.871) (-1749.198) * (-1749.872) (-1748.872) [-1749.589] (-1750.295) -- 0:00:49
      234500 -- (-1751.003) (-1751.260) (-1747.561) [-1749.616] * (-1748.484) (-1747.834) (-1747.546) [-1750.273] -- 0:00:48
      235000 -- (-1749.034) (-1750.470) (-1748.588) [-1751.392] * (-1748.996) (-1747.853) [-1749.845] (-1752.210) -- 0:00:48

      Average standard deviation of split frequencies: 0.015862

      235500 -- [-1748.876] (-1753.558) (-1748.346) (-1748.066) * [-1749.251] (-1747.858) (-1748.392) (-1749.488) -- 0:00:48
      236000 -- [-1748.132] (-1751.694) (-1748.777) (-1749.184) * (-1748.157) [-1747.912] (-1751.176) (-1749.923) -- 0:00:48
      236500 -- (-1747.582) (-1752.113) (-1747.413) [-1749.370] * (-1747.631) (-1748.142) [-1751.452] (-1749.085) -- 0:00:51
      237000 -- (-1747.599) (-1753.900) [-1748.550] (-1747.851) * (-1747.313) (-1748.663) [-1751.325] (-1751.550) -- 0:00:51
      237500 -- (-1752.460) (-1755.026) (-1751.415) [-1750.313] * (-1748.330) (-1749.401) [-1750.405] (-1748.936) -- 0:00:51
      238000 -- (-1752.357) [-1752.354] (-1749.324) (-1751.342) * (-1750.697) [-1750.551] (-1748.259) (-1751.109) -- 0:00:51
      238500 -- (-1747.222) [-1748.097] (-1747.368) (-1751.755) * (-1749.293) (-1749.779) [-1749.471] (-1753.803) -- 0:00:51
      239000 -- (-1749.254) (-1755.423) [-1747.985] (-1749.559) * [-1747.552] (-1746.926) (-1748.267) (-1750.010) -- 0:00:50
      239500 -- [-1749.548] (-1748.711) (-1748.821) (-1748.970) * (-1748.836) (-1746.926) (-1747.678) [-1748.402] -- 0:00:50
      240000 -- (-1751.411) (-1749.791) [-1749.031] (-1748.319) * (-1749.999) [-1748.434] (-1748.008) (-1748.910) -- 0:00:50

      Average standard deviation of split frequencies: 0.015094

      240500 -- [-1749.380] (-1749.933) (-1749.172) (-1747.820) * (-1750.171) (-1748.247) (-1749.483) [-1754.507] -- 0:00:50
      241000 -- (-1750.938) (-1749.628) (-1751.068) [-1748.715] * (-1749.648) (-1747.924) (-1750.574) [-1749.987] -- 0:00:50
      241500 -- (-1748.851) [-1748.000] (-1750.060) (-1747.963) * (-1749.691) (-1748.093) (-1749.848) [-1749.822] -- 0:00:50
      242000 -- (-1751.519) (-1749.072) [-1750.125] (-1749.075) * (-1747.837) (-1752.965) [-1749.557] (-1750.567) -- 0:00:50
      242500 -- (-1749.220) [-1747.969] (-1749.774) (-1749.157) * (-1747.842) (-1748.655) [-1751.682] (-1751.538) -- 0:00:49
      243000 -- (-1751.078) [-1748.654] (-1749.163) (-1751.439) * (-1747.054) [-1749.219] (-1752.349) (-1749.600) -- 0:00:49
      243500 -- (-1749.802) [-1749.567] (-1749.592) (-1748.631) * (-1747.454) (-1748.732) [-1748.545] (-1750.144) -- 0:00:49
      244000 -- (-1747.040) (-1752.382) [-1750.184] (-1751.743) * (-1749.624) (-1748.411) [-1750.469] (-1747.783) -- 0:00:49
      244500 -- (-1753.017) [-1751.164] (-1749.330) (-1749.692) * [-1748.198] (-1751.789) (-1749.029) (-1749.104) -- 0:00:49
      245000 -- (-1750.620) (-1750.335) [-1750.391] (-1747.437) * [-1747.227] (-1751.679) (-1748.436) (-1749.988) -- 0:00:49

      Average standard deviation of split frequencies: 0.016395

      245500 -- [-1749.528] (-1751.993) (-1750.574) (-1751.774) * (-1748.667) (-1752.233) [-1749.313] (-1747.455) -- 0:00:49
      246000 -- [-1747.788] (-1752.984) (-1748.542) (-1750.191) * (-1748.667) (-1751.715) (-1750.149) [-1748.025] -- 0:00:49
      246500 -- (-1749.567) (-1750.337) (-1748.499) [-1747.440] * (-1748.773) (-1752.342) (-1756.428) [-1748.587] -- 0:00:48
      247000 -- [-1748.166] (-1754.722) (-1751.711) (-1749.567) * [-1749.079] (-1753.689) (-1753.272) (-1749.517) -- 0:00:48
      247500 -- (-1747.010) (-1751.051) [-1748.626] (-1752.277) * (-1747.748) (-1749.899) (-1753.569) [-1748.760] -- 0:00:48
      248000 -- (-1747.317) (-1751.571) [-1746.973] (-1750.106) * (-1748.840) (-1750.005) [-1749.357] (-1753.235) -- 0:00:48
      248500 -- (-1750.091) [-1752.787] (-1747.551) (-1749.666) * (-1747.743) (-1750.092) [-1749.374] (-1751.380) -- 0:00:48
      249000 -- (-1750.495) [-1747.594] (-1748.610) (-1749.920) * (-1750.848) (-1749.253) (-1749.722) [-1749.005] -- 0:00:48
      249500 -- (-1749.958) (-1747.310) (-1748.272) [-1750.327] * [-1753.344] (-1751.570) (-1751.790) (-1747.947) -- 0:00:48
      250000 -- (-1748.800) (-1748.360) (-1752.452) [-1748.337] * [-1748.264] (-1749.862) (-1749.801) (-1747.780) -- 0:00:48

      Average standard deviation of split frequencies: 0.017123

      250500 -- (-1747.988) [-1748.349] (-1751.931) (-1747.429) * [-1748.264] (-1751.003) (-1749.822) (-1751.277) -- 0:00:47
      251000 -- [-1749.496] (-1752.057) (-1748.590) (-1747.428) * (-1749.526) [-1751.120] (-1750.131) (-1748.801) -- 0:00:47
      251500 -- [-1748.721] (-1748.280) (-1750.538) (-1747.004) * (-1750.650) (-1750.474) (-1750.786) [-1748.956] -- 0:00:47
      252000 -- (-1748.052) (-1750.669) [-1748.080] (-1748.753) * [-1750.757] (-1750.382) (-1749.609) (-1749.936) -- 0:00:50
      252500 -- (-1747.946) (-1749.704) [-1748.037] (-1747.796) * [-1748.883] (-1747.116) (-1748.102) (-1750.072) -- 0:00:50
      253000 -- (-1748.406) [-1750.049] (-1747.817) (-1748.901) * [-1751.318] (-1749.331) (-1750.805) (-1749.401) -- 0:00:50
      253500 -- (-1751.518) (-1751.083) [-1749.467] (-1748.325) * (-1750.260) [-1748.659] (-1748.220) (-1749.623) -- 0:00:50
      254000 -- (-1749.382) (-1747.189) (-1747.662) [-1747.091] * (-1748.046) (-1748.807) [-1749.906] (-1748.166) -- 0:00:49
      254500 -- (-1747.842) [-1748.715] (-1747.767) (-1750.085) * [-1748.789] (-1750.687) (-1747.216) (-1747.234) -- 0:00:49
      255000 -- (-1750.525) (-1749.959) [-1747.810] (-1748.235) * [-1748.275] (-1748.825) (-1747.375) (-1748.683) -- 0:00:49

      Average standard deviation of split frequencies: 0.017033

      255500 -- (-1749.193) (-1750.648) [-1747.182] (-1747.260) * (-1748.814) [-1749.127] (-1747.349) (-1757.983) -- 0:00:49
      256000 -- (-1749.588) [-1750.446] (-1747.247) (-1747.227) * (-1748.613) (-1751.586) (-1748.248) [-1752.816] -- 0:00:49
      256500 -- (-1748.639) (-1749.514) [-1748.273] (-1750.474) * (-1748.612) (-1750.363) [-1748.549] (-1750.188) -- 0:00:49
      257000 -- (-1747.370) (-1749.377) (-1747.502) [-1750.116] * (-1748.126) (-1750.104) (-1750.860) [-1750.421] -- 0:00:49
      257500 -- (-1747.322) (-1750.928) (-1751.261) [-1752.498] * [-1749.494] (-1749.752) (-1750.660) (-1750.422) -- 0:00:49
      258000 -- (-1749.912) [-1754.297] (-1752.380) (-1751.171) * (-1748.017) (-1753.341) [-1748.367] (-1749.700) -- 0:00:48
      258500 -- (-1747.944) (-1748.132) (-1753.688) [-1751.859] * (-1748.022) (-1748.172) [-1748.882] (-1752.577) -- 0:00:48
      259000 -- [-1748.148] (-1750.547) (-1750.001) (-1747.477) * (-1748.818) [-1749.501] (-1750.008) (-1752.017) -- 0:00:48
      259500 -- [-1748.712] (-1748.726) (-1749.901) (-1750.524) * (-1748.278) [-1751.746] (-1749.555) (-1749.375) -- 0:00:48
      260000 -- (-1751.527) (-1748.078) (-1748.720) [-1747.767] * (-1748.330) (-1751.506) [-1749.337] (-1749.621) -- 0:00:48

      Average standard deviation of split frequencies: 0.017783

      260500 -- (-1750.417) [-1749.392] (-1747.618) (-1748.490) * (-1752.078) [-1749.926] (-1749.129) (-1749.202) -- 0:00:48
      261000 -- (-1749.688) [-1750.528] (-1750.184) (-1748.369) * (-1749.822) (-1748.722) (-1747.621) [-1749.180] -- 0:00:48
      261500 -- (-1752.559) [-1750.622] (-1752.612) (-1749.311) * (-1748.878) (-1749.702) [-1749.115] (-1747.982) -- 0:00:48
      262000 -- (-1754.604) (-1748.736) (-1748.438) [-1748.244] * (-1750.790) (-1749.050) (-1748.271) [-1750.296] -- 0:00:47
      262500 -- (-1750.600) (-1751.459) (-1748.451) [-1751.323] * (-1748.907) (-1748.088) (-1750.163) [-1748.851] -- 0:00:47
      263000 -- (-1748.867) (-1754.467) (-1748.432) [-1749.817] * (-1750.579) (-1747.527) (-1749.792) [-1747.878] -- 0:00:47
      263500 -- [-1748.711] (-1749.883) (-1748.343) (-1750.928) * [-1747.693] (-1747.493) (-1747.776) (-1748.386) -- 0:00:47
      264000 -- (-1755.564) (-1750.824) (-1747.457) [-1751.759] * [-1751.224] (-1749.480) (-1750.542) (-1751.407) -- 0:00:47
      264500 -- (-1751.778) [-1749.187] (-1747.457) (-1752.605) * [-1749.508] (-1749.418) (-1747.988) (-1748.020) -- 0:00:47
      265000 -- (-1748.285) (-1749.278) [-1747.344] (-1752.605) * (-1748.383) (-1748.236) (-1748.344) [-1747.719] -- 0:00:47

      Average standard deviation of split frequencies: 0.016304

      265500 -- (-1749.627) (-1750.662) (-1748.315) [-1749.805] * (-1752.843) (-1752.572) [-1751.576] (-1747.752) -- 0:00:47
      266000 -- (-1748.438) (-1749.261) [-1748.647] (-1752.942) * (-1747.237) (-1749.815) [-1750.416] (-1750.856) -- 0:00:46
      266500 -- (-1748.198) [-1748.876] (-1749.197) (-1753.404) * (-1748.044) (-1747.487) (-1747.973) [-1753.468] -- 0:00:46
      267000 -- (-1748.760) (-1747.560) [-1747.734] (-1750.461) * (-1748.761) [-1747.487] (-1749.075) (-1750.385) -- 0:00:46
      267500 -- (-1748.760) (-1750.872) (-1750.081) [-1749.239] * (-1748.331) (-1748.702) [-1752.082] (-1749.798) -- 0:00:49
      268000 -- (-1748.977) (-1748.581) (-1752.474) [-1748.594] * (-1751.151) (-1750.477) (-1751.392) [-1749.638] -- 0:00:49
      268500 -- (-1748.546) (-1747.671) (-1752.570) [-1752.467] * (-1751.200) [-1750.699] (-1748.965) (-1749.633) -- 0:00:49
      269000 -- (-1751.398) (-1748.401) [-1749.587] (-1751.310) * (-1750.018) (-1750.114) (-1748.758) [-1748.960] -- 0:00:48
      269500 -- (-1752.466) (-1749.721) [-1748.139] (-1751.026) * [-1749.367] (-1750.320) (-1748.650) (-1749.627) -- 0:00:48
      270000 -- (-1751.713) (-1750.308) [-1749.820] (-1748.845) * (-1747.735) (-1748.975) (-1747.963) [-1747.143] -- 0:00:48

      Average standard deviation of split frequencies: 0.015675

      270500 -- (-1751.772) (-1748.101) (-1750.701) [-1751.537] * (-1752.305) (-1748.801) [-1749.674] (-1748.437) -- 0:00:48
      271000 -- (-1752.172) (-1748.477) (-1750.349) [-1748.758] * (-1750.704) [-1748.794] (-1754.705) (-1748.135) -- 0:00:48
      271500 -- (-1749.706) [-1748.118] (-1748.771) (-1748.927) * [-1748.894] (-1748.812) (-1748.606) (-1750.476) -- 0:00:48
      272000 -- (-1752.441) (-1750.137) (-1747.245) [-1747.428] * (-1748.335) (-1747.947) (-1747.391) [-1750.163] -- 0:00:48
      272500 -- [-1750.334] (-1748.373) (-1748.363) (-1749.878) * [-1748.754] (-1749.015) (-1747.385) (-1750.057) -- 0:00:48
      273000 -- (-1752.635) (-1748.356) (-1748.908) [-1747.403] * [-1750.118] (-1751.734) (-1750.352) (-1755.950) -- 0:00:47
      273500 -- (-1751.683) (-1748.657) (-1747.816) [-1748.352] * (-1749.374) (-1748.566) [-1748.903] (-1749.796) -- 0:00:47
      274000 -- (-1752.604) (-1748.134) [-1747.312] (-1749.709) * (-1747.873) (-1747.037) (-1754.900) [-1747.371] -- 0:00:47
      274500 -- (-1751.011) (-1748.200) [-1747.095] (-1749.330) * (-1747.455) (-1748.080) (-1755.440) [-1748.643] -- 0:00:47
      275000 -- (-1758.803) [-1748.205] (-1748.160) (-1748.563) * (-1750.005) (-1747.832) (-1747.525) [-1748.768] -- 0:00:47

      Average standard deviation of split frequencies: 0.015372

      275500 -- (-1751.452) (-1751.478) (-1749.440) [-1752.560] * (-1751.501) (-1747.468) [-1750.247] (-1748.372) -- 0:00:47
      276000 -- (-1750.056) (-1750.451) [-1747.790] (-1754.713) * [-1748.021] (-1747.910) (-1751.560) (-1747.764) -- 0:00:47
      276500 -- (-1751.006) (-1749.700) (-1749.082) [-1748.764] * (-1748.696) (-1749.167) [-1750.650] (-1747.289) -- 0:00:47
      277000 -- [-1749.703] (-1748.351) (-1750.005) (-1747.930) * (-1748.295) (-1749.954) (-1751.422) [-1748.704] -- 0:00:46
      277500 -- (-1749.701) (-1749.791) (-1751.409) [-1747.381] * [-1749.443] (-1748.113) (-1751.342) (-1748.165) -- 0:00:46
      278000 -- (-1749.956) (-1748.042) (-1749.032) [-1747.405] * (-1751.045) [-1750.095] (-1751.788) (-1747.917) -- 0:00:46
      278500 -- (-1748.595) [-1747.110] (-1749.072) (-1747.283) * [-1748.127] (-1747.672) (-1749.039) (-1749.972) -- 0:00:46
      279000 -- (-1747.576) (-1747.902) [-1748.696] (-1747.516) * (-1748.793) (-1747.475) (-1749.146) [-1750.318] -- 0:00:46
      279500 -- (-1747.797) [-1747.253] (-1749.359) (-1747.860) * (-1749.095) (-1747.737) (-1748.128) [-1750.583] -- 0:00:46
      280000 -- [-1750.084] (-1747.270) (-1749.246) (-1748.810) * (-1748.017) (-1749.404) [-1748.294] (-1750.694) -- 0:00:46

      Average standard deviation of split frequencies: 0.013931

      280500 -- (-1748.005) (-1747.803) [-1750.729] (-1750.732) * (-1748.850) (-1749.477) [-1750.865] (-1749.002) -- 0:00:46
      281000 -- [-1749.570] (-1751.454) (-1749.099) (-1749.884) * [-1749.504] (-1751.012) (-1753.017) (-1751.282) -- 0:00:46
      281500 -- (-1749.330) [-1748.741] (-1747.937) (-1747.683) * (-1753.037) (-1747.512) (-1751.469) [-1747.892] -- 0:00:45
      282000 -- (-1754.332) [-1750.606] (-1752.202) (-1749.452) * (-1749.870) (-1747.216) [-1752.538] (-1747.149) -- 0:00:45
      282500 -- (-1754.051) (-1756.623) [-1755.526] (-1751.890) * [-1749.598] (-1747.235) (-1750.374) (-1747.910) -- 0:00:45
      283000 -- [-1748.942] (-1749.237) (-1753.224) (-1747.111) * (-1751.092) [-1747.928] (-1749.178) (-1747.319) -- 0:00:45
      283500 -- (-1749.479) (-1747.643) (-1752.282) [-1746.737] * [-1749.466] (-1754.356) (-1750.704) (-1748.065) -- 0:00:48
      284000 -- (-1748.380) (-1753.975) (-1749.160) [-1746.877] * (-1746.825) (-1752.301) (-1750.630) [-1750.810] -- 0:00:47
      284500 -- (-1753.752) (-1747.639) [-1747.495] (-1746.881) * (-1747.921) (-1751.310) [-1747.220] (-1750.188) -- 0:00:47
      285000 -- (-1749.789) [-1750.363] (-1752.263) (-1747.415) * (-1749.271) (-1747.574) (-1746.859) [-1751.518] -- 0:00:47

      Average standard deviation of split frequencies: 0.015082

      285500 -- (-1749.218) [-1748.634] (-1750.416) (-1750.365) * (-1749.858) [-1747.990] (-1747.296) (-1752.650) -- 0:00:47
      286000 -- (-1751.933) (-1749.103) [-1752.658] (-1748.866) * (-1751.172) [-1747.824] (-1748.284) (-1749.923) -- 0:00:47
      286500 -- (-1752.520) (-1747.731) (-1752.985) [-1750.199] * (-1751.160) [-1748.095] (-1748.999) (-1752.003) -- 0:00:47
      287000 -- (-1750.255) (-1749.924) (-1753.404) [-1750.242] * (-1749.802) (-1749.066) (-1747.803) [-1748.833] -- 0:00:47
      287500 -- (-1747.090) (-1749.127) (-1749.239) [-1751.794] * (-1750.845) (-1750.228) [-1750.613] (-1748.833) -- 0:00:47
      288000 -- (-1747.089) (-1750.156) (-1748.912) [-1752.315] * (-1751.558) (-1754.214) [-1749.523] (-1753.402) -- 0:00:46
      288500 -- [-1747.029] (-1750.918) (-1750.183) (-1747.871) * (-1750.084) (-1751.847) (-1747.510) [-1749.462] -- 0:00:46
      289000 -- (-1749.488) (-1750.112) [-1750.139] (-1747.887) * (-1752.799) (-1753.663) [-1747.943] (-1751.121) -- 0:00:46
      289500 -- [-1749.514] (-1749.290) (-1747.729) (-1748.537) * (-1747.508) (-1747.443) (-1748.027) [-1748.795] -- 0:00:46
      290000 -- [-1750.357] (-1748.173) (-1747.891) (-1747.403) * (-1750.308) (-1747.516) (-1748.030) [-1753.239] -- 0:00:46

      Average standard deviation of split frequencies: 0.014110

      290500 -- [-1749.339] (-1750.945) (-1751.140) (-1748.997) * (-1750.237) (-1747.127) (-1747.467) [-1755.829] -- 0:00:46
      291000 -- (-1751.380) (-1748.871) (-1750.498) [-1749.169] * (-1748.821) (-1747.127) [-1747.754] (-1755.618) -- 0:00:46
      291500 -- (-1750.563) [-1749.133] (-1753.357) (-1750.184) * (-1749.906) [-1747.412] (-1751.198) (-1753.833) -- 0:00:46
      292000 -- (-1747.830) (-1751.180) (-1750.631) [-1750.173] * (-1748.439) [-1748.669] (-1752.243) (-1749.813) -- 0:00:46
      292500 -- [-1748.829] (-1750.739) (-1751.540) (-1749.995) * (-1748.945) (-1750.201) [-1749.179] (-1749.707) -- 0:00:45
      293000 -- (-1748.332) (-1750.385) (-1750.881) [-1750.741] * [-1753.155] (-1748.430) (-1748.873) (-1748.392) -- 0:00:45
      293500 -- [-1748.255] (-1748.328) (-1750.732) (-1752.219) * (-1751.487) (-1751.467) (-1747.254) [-1749.483] -- 0:00:45
      294000 -- (-1748.037) (-1748.514) [-1748.441] (-1750.578) * (-1749.241) [-1750.421] (-1748.630) (-1750.357) -- 0:00:45
      294500 -- (-1748.002) (-1750.662) (-1749.237) [-1748.070] * (-1748.811) (-1751.279) (-1749.068) [-1748.022] -- 0:00:45
      295000 -- (-1751.166) [-1751.281] (-1750.827) (-1753.224) * (-1749.258) (-1750.425) [-1747.446] (-1748.627) -- 0:00:45

      Average standard deviation of split frequencies: 0.014094

      295500 -- (-1747.555) (-1750.381) [-1751.349] (-1749.462) * (-1747.525) (-1751.951) [-1747.522] (-1750.263) -- 0:00:45
      296000 -- (-1748.256) [-1749.953] (-1748.297) (-1751.252) * (-1748.812) (-1748.354) (-1750.951) [-1751.360] -- 0:00:45
      296500 -- (-1749.054) (-1749.626) [-1747.688] (-1749.320) * (-1747.464) (-1748.541) (-1749.861) [-1751.287] -- 0:00:45
      297000 -- (-1749.932) (-1751.952) [-1752.009] (-1747.806) * [-1747.267] (-1750.175) (-1748.910) (-1751.659) -- 0:00:44
      297500 -- (-1748.091) [-1748.275] (-1752.410) (-1748.042) * [-1747.556] (-1748.566) (-1748.067) (-1747.723) -- 0:00:44
      298000 -- (-1748.634) (-1748.932) [-1752.216] (-1750.531) * (-1748.182) (-1748.842) [-1747.406] (-1747.720) -- 0:00:44
      298500 -- [-1749.890] (-1748.839) (-1753.171) (-1747.350) * (-1751.106) (-1750.573) [-1749.101] (-1749.188) -- 0:00:44
      299000 -- (-1748.995) [-1750.459] (-1751.112) (-1750.652) * (-1750.751) (-1750.215) [-1749.129] (-1748.171) -- 0:00:46
      299500 -- (-1752.845) (-1749.482) (-1750.583) [-1748.592] * (-1748.907) [-1747.249] (-1748.241) (-1748.238) -- 0:00:46
      300000 -- (-1748.550) [-1749.445] (-1748.751) (-1749.051) * (-1748.781) (-1747.209) [-1748.385] (-1748.171) -- 0:00:46

      Average standard deviation of split frequencies: 0.013153

      300500 -- [-1747.487] (-1748.207) (-1748.873) (-1749.564) * (-1748.286) (-1747.337) [-1748.887] (-1746.901) -- 0:00:46
      301000 -- (-1748.950) [-1748.220] (-1748.366) (-1748.922) * (-1753.261) (-1748.812) (-1748.339) [-1747.212] -- 0:00:46
      301500 -- (-1747.823) (-1748.224) [-1747.408] (-1749.318) * (-1757.432) (-1747.292) (-1750.290) [-1749.222] -- 0:00:46
      302000 -- (-1749.733) (-1748.909) [-1750.120] (-1750.322) * (-1750.138) [-1747.805] (-1747.756) (-1750.722) -- 0:00:46
      302500 -- (-1749.458) (-1747.780) (-1748.438) [-1752.458] * (-1749.103) (-1747.897) (-1749.977) [-1748.794] -- 0:00:46
      303000 -- (-1747.454) [-1747.818] (-1752.233) (-1753.692) * (-1747.719) (-1747.809) [-1748.809] (-1749.150) -- 0:00:46
      303500 -- [-1749.122] (-1749.001) (-1753.049) (-1748.885) * [-1748.298] (-1747.648) (-1751.006) (-1750.198) -- 0:00:45
      304000 -- [-1749.874] (-1750.990) (-1749.023) (-1749.619) * (-1747.995) (-1747.659) (-1750.081) [-1748.166] -- 0:00:45
      304500 -- (-1748.895) (-1749.600) [-1750.114] (-1750.825) * (-1747.044) (-1752.061) [-1751.334] (-1750.780) -- 0:00:45
      305000 -- (-1747.205) [-1751.518] (-1749.228) (-1748.678) * (-1747.490) [-1748.401] (-1749.375) (-1750.511) -- 0:00:45

      Average standard deviation of split frequencies: 0.012471

      305500 -- (-1747.944) [-1751.127] (-1749.901) (-1753.413) * [-1747.420] (-1751.162) (-1750.763) (-1748.160) -- 0:00:45
      306000 -- (-1748.087) [-1753.818] (-1749.901) (-1750.436) * (-1747.479) [-1749.845] (-1750.436) (-1747.724) -- 0:00:45
      306500 -- (-1748.202) (-1753.648) [-1749.343] (-1752.706) * (-1747.011) [-1748.768] (-1748.002) (-1751.433) -- 0:00:45
      307000 -- [-1749.417] (-1752.378) (-1750.237) (-1749.146) * (-1749.996) (-1751.302) (-1748.483) [-1750.315] -- 0:00:45
      307500 -- (-1751.832) [-1751.157] (-1750.358) (-1749.204) * (-1749.975) [-1750.331] (-1748.232) (-1750.751) -- 0:00:45
      308000 -- [-1755.315] (-1748.000) (-1747.689) (-1751.744) * (-1748.666) (-1749.334) (-1748.729) [-1752.962] -- 0:00:44
      308500 -- (-1751.451) [-1748.293] (-1748.164) (-1748.474) * [-1748.648] (-1749.649) (-1748.667) (-1750.097) -- 0:00:44
      309000 -- [-1748.412] (-1747.883) (-1749.718) (-1749.963) * (-1748.578) [-1747.747] (-1748.635) (-1751.466) -- 0:00:44
      309500 -- [-1746.984] (-1747.669) (-1748.730) (-1748.462) * [-1747.131] (-1751.640) (-1750.159) (-1749.771) -- 0:00:44
      310000 -- (-1753.098) (-1750.733) [-1749.401] (-1748.593) * (-1747.910) (-1750.724) [-1749.763] (-1749.743) -- 0:00:44

      Average standard deviation of split frequencies: 0.012594

      310500 -- (-1751.389) (-1751.652) (-1747.953) [-1748.350] * (-1747.296) [-1751.407] (-1747.870) (-1747.258) -- 0:00:44
      311000 -- (-1748.458) (-1748.604) (-1747.441) [-1749.048] * (-1747.980) (-1748.205) (-1747.724) [-1748.518] -- 0:00:44
      311500 -- (-1749.249) (-1748.989) (-1749.773) [-1749.747] * (-1748.165) (-1747.149) [-1748.026] (-1747.901) -- 0:00:44
      312000 -- [-1749.026] (-1748.208) (-1747.075) (-1749.345) * (-1752.280) [-1748.253] (-1748.027) (-1751.653) -- 0:00:44
      312500 -- (-1752.822) (-1752.429) [-1748.261] (-1749.434) * (-1749.072) (-1747.573) (-1751.916) [-1748.780] -- 0:00:44
      313000 -- (-1747.402) (-1754.028) [-1747.535] (-1749.118) * (-1749.224) [-1747.021] (-1748.791) (-1749.065) -- 0:00:43
      313500 -- (-1748.726) (-1751.091) [-1748.126] (-1749.715) * (-1747.771) [-1746.788] (-1750.560) (-1751.317) -- 0:00:43
      314000 -- [-1747.951] (-1751.275) (-1747.491) (-1748.597) * (-1747.173) [-1747.515] (-1750.019) (-1754.617) -- 0:00:43
      314500 -- [-1747.538] (-1751.022) (-1748.266) (-1751.978) * [-1746.767] (-1748.179) (-1748.968) (-1751.446) -- 0:00:45
      315000 -- (-1748.237) (-1750.345) (-1748.201) [-1748.435] * (-1746.814) (-1751.447) [-1750.186] (-1750.615) -- 0:00:45

      Average standard deviation of split frequencies: 0.012929

      315500 -- (-1748.614) [-1749.486] (-1748.501) (-1748.122) * (-1749.145) (-1749.358) (-1747.965) [-1750.934] -- 0:00:45
      316000 -- (-1753.924) (-1751.872) (-1750.306) [-1748.041] * (-1754.894) (-1750.722) (-1748.058) [-1750.047] -- 0:00:45
      316500 -- (-1750.652) (-1747.814) (-1748.647) [-1747.512] * [-1751.032] (-1749.547) (-1748.745) (-1750.104) -- 0:00:45
      317000 -- (-1754.357) (-1747.982) (-1748.452) [-1750.219] * (-1750.056) (-1750.029) [-1748.061] (-1747.482) -- 0:00:45
      317500 -- [-1751.487] (-1747.975) (-1749.417) (-1750.572) * (-1750.390) (-1749.257) [-1748.734] (-1747.939) -- 0:00:45
      318000 -- (-1748.824) (-1750.395) [-1747.698] (-1749.910) * (-1750.636) (-1750.509) (-1749.134) [-1747.787] -- 0:00:45
      318500 -- (-1752.441) (-1749.011) [-1747.739] (-1751.106) * (-1751.386) (-1749.829) [-1749.166] (-1750.762) -- 0:00:44
      319000 -- (-1750.155) [-1748.403] (-1747.837) (-1752.939) * (-1750.044) [-1747.055] (-1749.617) (-1750.608) -- 0:00:44
      319500 -- (-1750.803) [-1750.416] (-1747.726) (-1749.505) * (-1750.734) (-1748.871) [-1748.426] (-1752.397) -- 0:00:44
      320000 -- (-1750.013) [-1749.341] (-1748.507) (-1750.128) * [-1748.368] (-1748.174) (-1749.897) (-1751.097) -- 0:00:44

      Average standard deviation of split frequencies: 0.012921

      320500 -- (-1749.962) [-1747.634] (-1748.680) (-1752.006) * [-1749.204] (-1749.117) (-1748.689) (-1750.301) -- 0:00:44
      321000 -- [-1748.327] (-1747.624) (-1748.811) (-1749.678) * (-1750.179) (-1749.247) (-1748.631) [-1749.337] -- 0:00:44
      321500 -- [-1747.640] (-1747.192) (-1748.271) (-1747.423) * (-1750.093) [-1748.391] (-1752.314) (-1748.338) -- 0:00:44
      322000 -- [-1748.977] (-1748.028) (-1748.776) (-1747.278) * (-1750.591) (-1750.080) (-1747.218) [-1748.253] -- 0:00:44
      322500 -- [-1748.986] (-1747.898) (-1748.901) (-1751.780) * [-1747.419] (-1750.538) (-1749.545) (-1749.522) -- 0:00:44
      323000 -- [-1747.479] (-1748.248) (-1757.191) (-1750.540) * (-1750.534) (-1750.535) [-1748.832] (-1748.146) -- 0:00:44
      323500 -- (-1752.111) [-1749.634] (-1751.536) (-1748.517) * (-1749.334) (-1751.526) [-1747.872] (-1747.968) -- 0:00:43
      324000 -- (-1750.812) (-1749.493) (-1751.794) [-1748.084] * [-1750.510] (-1750.961) (-1749.782) (-1747.559) -- 0:00:43
      324500 -- (-1748.856) (-1748.770) (-1749.263) [-1747.682] * (-1751.287) (-1756.719) [-1749.184] (-1747.697) -- 0:00:43
      325000 -- [-1747.147] (-1749.424) (-1750.619) (-1747.682) * [-1749.916] (-1750.771) (-1749.584) (-1748.431) -- 0:00:43

      Average standard deviation of split frequencies: 0.013159

      325500 -- (-1749.565) (-1752.899) (-1748.757) [-1750.449] * (-1748.484) (-1750.818) [-1749.890] (-1750.654) -- 0:00:43
      326000 -- (-1753.303) [-1749.018] (-1749.133) (-1747.209) * [-1748.473] (-1748.243) (-1749.942) (-1749.481) -- 0:00:43
      326500 -- (-1749.506) (-1748.450) [-1752.609] (-1750.349) * (-1749.746) (-1747.399) [-1748.499] (-1747.428) -- 0:00:43
      327000 -- (-1750.866) [-1749.280] (-1750.759) (-1748.677) * (-1749.247) [-1747.878] (-1748.031) (-1749.503) -- 0:00:43
      327500 -- (-1749.556) [-1748.850] (-1750.031) (-1748.561) * [-1747.677] (-1751.282) (-1748.519) (-1751.270) -- 0:00:43
      328000 -- (-1751.977) (-1750.754) (-1749.012) [-1749.428] * (-1747.289) [-1750.482] (-1747.872) (-1751.119) -- 0:00:43
      328500 -- (-1751.824) [-1750.904] (-1748.799) (-1750.919) * (-1747.244) (-1750.685) [-1747.728] (-1753.359) -- 0:00:42
      329000 -- (-1749.662) [-1750.527] (-1749.678) (-1750.698) * [-1747.703] (-1747.888) (-1748.657) (-1749.998) -- 0:00:42
      329500 -- (-1751.378) [-1749.058] (-1749.400) (-1749.554) * [-1751.022] (-1748.126) (-1748.778) (-1747.905) -- 0:00:42
      330000 -- (-1749.064) (-1748.145) (-1754.058) [-1749.334] * (-1748.526) (-1747.099) [-1747.321] (-1750.917) -- 0:00:44

      Average standard deviation of split frequencies: 0.012759

      330500 -- (-1749.831) (-1746.866) (-1749.037) [-1749.398] * [-1749.549] (-1747.034) (-1749.532) (-1748.245) -- 0:00:44
      331000 -- (-1749.480) [-1746.899] (-1749.461) (-1748.601) * (-1748.875) [-1748.982] (-1750.003) (-1749.898) -- 0:00:44
      331500 -- (-1749.627) [-1747.625] (-1750.076) (-1749.129) * (-1751.122) (-1747.555) [-1747.792] (-1755.623) -- 0:00:44
      332000 -- (-1749.638) (-1749.876) [-1748.010] (-1746.999) * (-1747.535) [-1748.582] (-1747.844) (-1749.412) -- 0:00:44
      332500 -- (-1749.595) (-1748.198) (-1751.681) [-1749.769] * (-1747.425) (-1749.090) [-1748.442] (-1750.323) -- 0:00:44
      333000 -- (-1747.755) (-1747.528) [-1749.899] (-1749.447) * (-1749.024) (-1748.040) [-1748.848] (-1748.272) -- 0:00:44
      333500 -- (-1750.654) (-1748.714) [-1749.732] (-1748.997) * (-1749.645) [-1747.364] (-1752.427) (-1747.423) -- 0:00:43
      334000 -- (-1752.080) (-1747.701) (-1751.324) [-1748.308] * (-1748.949) (-1749.356) (-1749.622) [-1749.011] -- 0:00:43
      334500 -- [-1747.127] (-1750.052) (-1749.544) (-1748.140) * (-1747.532) [-1749.823] (-1749.803) (-1749.731) -- 0:00:43
      335000 -- (-1747.565) [-1749.894] (-1749.718) (-1747.992) * (-1748.031) (-1749.431) (-1748.600) [-1749.871] -- 0:00:43

      Average standard deviation of split frequencies: 0.013048

      335500 -- (-1747.517) [-1749.932] (-1748.720) (-1748.979) * (-1748.404) (-1748.336) (-1749.335) [-1748.989] -- 0:00:43
      336000 -- [-1747.376] (-1752.508) (-1747.578) (-1748.747) * (-1749.685) (-1752.948) (-1749.081) [-1750.263] -- 0:00:43
      336500 -- [-1746.851] (-1752.322) (-1748.502) (-1748.569) * [-1748.214] (-1748.896) (-1748.187) (-1750.807) -- 0:00:43
      337000 -- (-1750.740) (-1754.143) (-1749.512) [-1750.248] * (-1747.866) [-1750.103] (-1747.192) (-1752.082) -- 0:00:43
      337500 -- (-1750.591) (-1753.903) (-1752.190) [-1750.177] * [-1750.068] (-1747.404) (-1751.266) (-1750.459) -- 0:00:43
      338000 -- (-1748.621) (-1753.367) [-1748.210] (-1747.769) * (-1750.290) (-1747.570) (-1750.931) [-1749.840] -- 0:00:43
      338500 -- (-1748.084) (-1750.955) (-1747.785) [-1747.813] * (-1751.465) (-1748.292) [-1749.024] (-1749.420) -- 0:00:42
      339000 -- [-1749.663] (-1752.413) (-1747.545) (-1748.581) * (-1749.755) [-1749.329] (-1747.440) (-1751.220) -- 0:00:42
      339500 -- (-1749.806) (-1750.624) (-1747.860) [-1751.128] * [-1751.204] (-1752.324) (-1748.130) (-1751.145) -- 0:00:42
      340000 -- (-1754.490) (-1751.359) (-1748.216) [-1753.043] * [-1748.576] (-1750.097) (-1749.110) (-1750.367) -- 0:00:42

      Average standard deviation of split frequencies: 0.011640

      340500 -- (-1752.798) (-1751.804) [-1747.952] (-1752.058) * [-1748.438] (-1750.455) (-1752.089) (-1750.716) -- 0:00:42
      341000 -- [-1752.798] (-1751.891) (-1747.802) (-1752.224) * (-1751.091) (-1752.331) [-1747.566] (-1750.087) -- 0:00:42
      341500 -- (-1753.246) [-1747.491] (-1748.056) (-1750.646) * [-1748.496] (-1748.887) (-1748.055) (-1748.923) -- 0:00:42
      342000 -- (-1751.045) (-1748.253) [-1749.101] (-1750.271) * (-1748.271) (-1747.277) [-1747.909] (-1750.147) -- 0:00:42
      342500 -- [-1748.779] (-1749.161) (-1747.943) (-1748.609) * (-1748.649) (-1752.122) (-1749.096) [-1748.641] -- 0:00:42
      343000 -- (-1748.922) (-1747.980) [-1748.206] (-1753.699) * [-1748.219] (-1752.013) (-1750.209) (-1748.462) -- 0:00:42
      343500 -- (-1751.971) [-1751.297] (-1747.574) (-1749.376) * (-1747.800) (-1749.576) (-1748.551) [-1747.776] -- 0:00:42
      344000 -- (-1750.581) (-1749.894) (-1748.484) [-1749.316] * (-1749.142) (-1748.073) [-1749.715] (-1747.767) -- 0:00:41
      344500 -- [-1750.775] (-1749.765) (-1752.505) (-1749.320) * (-1749.819) (-1749.570) (-1747.358) [-1751.099] -- 0:00:41
      345000 -- (-1751.044) (-1749.280) [-1748.225] (-1749.400) * (-1750.574) [-1749.506] (-1753.783) (-1751.227) -- 0:00:41

      Average standard deviation of split frequencies: 0.010975

      345500 -- (-1751.040) [-1749.263] (-1748.530) (-1751.795) * (-1752.003) (-1749.656) (-1749.961) [-1749.898] -- 0:00:43
      346000 -- (-1747.083) (-1748.748) (-1748.755) [-1748.636] * (-1749.496) [-1752.399] (-1749.057) (-1754.162) -- 0:00:43
      346500 -- (-1748.825) (-1747.580) [-1749.725] (-1747.309) * (-1748.820) (-1752.784) [-1749.109] (-1749.465) -- 0:00:43
      347000 -- [-1748.618] (-1749.127) (-1748.830) (-1749.179) * (-1748.614) (-1750.318) (-1748.703) [-1748.333] -- 0:00:43
      347500 -- (-1748.291) (-1751.224) [-1750.298] (-1749.878) * (-1748.904) (-1748.669) (-1749.223) [-1749.311] -- 0:00:43
      348000 -- [-1750.110] (-1749.482) (-1747.764) (-1749.386) * (-1748.174) [-1749.301] (-1749.444) (-1753.732) -- 0:00:43
      348500 -- (-1747.905) (-1747.417) (-1747.675) [-1747.299] * (-1748.162) [-1748.578] (-1751.348) (-1748.439) -- 0:00:42
      349000 -- (-1749.271) (-1748.949) [-1749.241] (-1752.332) * (-1748.703) [-1750.307] (-1752.527) (-1749.368) -- 0:00:42
      349500 -- [-1748.794] (-1749.386) (-1747.534) (-1753.423) * (-1750.943) (-1749.161) (-1749.402) [-1749.435] -- 0:00:42
      350000 -- (-1750.379) [-1749.311] (-1748.195) (-1749.650) * (-1748.616) (-1751.885) [-1747.865] (-1749.421) -- 0:00:42

      Average standard deviation of split frequencies: 0.010834

      350500 -- (-1747.738) [-1748.111] (-1748.972) (-1750.568) * [-1749.389] (-1752.944) (-1748.163) (-1756.990) -- 0:00:42
      351000 -- [-1747.665] (-1748.206) (-1756.868) (-1749.355) * (-1748.352) (-1752.217) [-1748.743] (-1756.301) -- 0:00:42
      351500 -- (-1748.285) [-1747.582] (-1755.999) (-1747.389) * [-1748.376] (-1750.787) (-1748.036) (-1747.994) -- 0:00:42
      352000 -- (-1748.167) (-1747.381) (-1749.259) [-1746.839] * (-1748.909) (-1747.419) (-1748.587) [-1747.459] -- 0:00:42
      352500 -- [-1748.530] (-1748.010) (-1753.805) (-1748.697) * [-1750.285] (-1749.158) (-1749.915) (-1748.127) -- 0:00:42
      353000 -- (-1748.905) (-1748.747) (-1748.994) [-1750.603] * (-1755.491) [-1751.141] (-1749.999) (-1749.180) -- 0:00:42
      353500 -- [-1751.259] (-1748.290) (-1748.414) (-1749.042) * (-1750.717) (-1753.480) [-1749.177] (-1750.011) -- 0:00:42
      354000 -- [-1749.346] (-1751.453) (-1749.237) (-1747.382) * (-1747.157) (-1750.832) (-1750.517) [-1749.058] -- 0:00:41
      354500 -- (-1749.097) [-1749.145] (-1749.666) (-1750.480) * (-1747.157) (-1751.141) [-1751.142] (-1750.034) -- 0:00:41
      355000 -- (-1748.301) (-1749.093) [-1750.734] (-1747.634) * (-1749.747) [-1748.094] (-1749.252) (-1747.547) -- 0:00:41

      Average standard deviation of split frequencies: 0.010842

      355500 -- (-1752.584) (-1747.954) [-1750.210] (-1750.401) * (-1747.121) [-1748.875] (-1749.048) (-1748.795) -- 0:00:41
      356000 -- [-1750.146] (-1748.130) (-1751.667) (-1748.925) * (-1750.147) (-1750.174) (-1748.957) [-1747.684] -- 0:00:41
      356500 -- (-1747.441) [-1748.279] (-1748.262) (-1753.580) * (-1748.022) (-1750.765) (-1747.278) [-1747.726] -- 0:00:41
      357000 -- [-1751.492] (-1749.429) (-1749.295) (-1747.541) * (-1749.077) (-1748.703) (-1747.612) [-1749.386] -- 0:00:41
      357500 -- (-1747.009) (-1748.809) [-1749.390] (-1748.236) * (-1752.741) [-1754.704] (-1747.193) (-1747.333) -- 0:00:41
      358000 -- (-1747.013) (-1748.837) (-1750.976) [-1749.011] * [-1749.213] (-1748.083) (-1750.731) (-1749.664) -- 0:00:41
      358500 -- [-1747.103] (-1749.645) (-1750.285) (-1749.190) * (-1748.139) (-1750.239) (-1750.862) [-1748.324] -- 0:00:41
      359000 -- (-1747.103) (-1748.825) (-1751.122) [-1748.569] * (-1750.100) [-1748.077] (-1750.164) (-1749.392) -- 0:00:41
      359500 -- (-1747.787) (-1749.256) (-1752.239) [-1749.827] * (-1751.568) [-1748.118] (-1747.600) (-1748.852) -- 0:00:40
      360000 -- (-1747.832) (-1755.552) [-1751.270] (-1749.809) * [-1749.190] (-1748.107) (-1750.508) (-1748.850) -- 0:00:40

      Average standard deviation of split frequencies: 0.011518

      360500 -- [-1747.108] (-1749.727) (-1752.219) (-1749.947) * (-1752.872) (-1747.262) (-1752.910) [-1748.468] -- 0:00:40
      361000 -- (-1752.877) (-1750.056) [-1747.982] (-1750.734) * (-1754.777) (-1750.040) (-1750.363) [-1748.496] -- 0:00:42
      361500 -- (-1754.399) [-1748.460] (-1749.047) (-1748.155) * (-1751.168) (-1747.805) [-1751.724] (-1752.172) -- 0:00:42
      362000 -- [-1751.977] (-1748.460) (-1747.816) (-1750.517) * (-1748.382) [-1748.620] (-1747.070) (-1752.862) -- 0:00:42
      362500 -- (-1751.973) [-1748.174] (-1751.888) (-1751.198) * (-1750.951) [-1749.893] (-1748.795) (-1748.531) -- 0:00:42
      363000 -- (-1749.114) [-1748.320] (-1750.214) (-1750.600) * [-1751.366] (-1748.456) (-1750.412) (-1749.060) -- 0:00:42
      363500 -- (-1751.917) [-1748.610] (-1750.783) (-1748.013) * (-1751.560) (-1747.992) [-1752.443] (-1748.333) -- 0:00:42
      364000 -- (-1751.807) (-1748.547) [-1752.462] (-1748.139) * [-1750.689] (-1750.682) (-1747.013) (-1755.565) -- 0:00:41
      364500 -- (-1749.979) (-1747.771) (-1747.161) [-1747.340] * (-1748.233) [-1755.103] (-1748.350) (-1749.214) -- 0:00:41
      365000 -- (-1751.507) [-1749.087] (-1748.085) (-1747.984) * (-1753.945) (-1748.734) (-1748.759) [-1748.225] -- 0:00:41

      Average standard deviation of split frequencies: 0.011592

      365500 -- (-1751.707) (-1748.560) [-1747.822] (-1748.627) * (-1751.876) [-1749.472] (-1748.496) (-1751.831) -- 0:00:41
      366000 -- (-1752.379) (-1749.188) (-1747.394) [-1748.261] * (-1750.215) (-1753.386) [-1751.552] (-1750.054) -- 0:00:41
      366500 -- (-1756.932) [-1749.676] (-1751.902) (-1749.776) * (-1749.847) (-1751.383) (-1750.491) [-1750.936] -- 0:00:41
      367000 -- (-1754.106) (-1748.420) (-1748.540) [-1748.662] * [-1750.298] (-1748.934) (-1751.213) (-1752.321) -- 0:00:41
      367500 -- (-1751.102) (-1747.753) [-1750.892] (-1748.760) * (-1747.827) [-1748.349] (-1751.040) (-1752.185) -- 0:00:41
      368000 -- (-1751.876) (-1750.339) (-1749.843) [-1754.967] * (-1748.562) (-1748.330) (-1749.781) [-1748.377] -- 0:00:41
      368500 -- (-1753.618) [-1753.322] (-1747.505) (-1751.644) * (-1749.374) (-1749.527) (-1749.216) [-1750.341] -- 0:00:41
      369000 -- (-1756.649) (-1751.908) [-1747.977] (-1752.650) * (-1749.029) (-1750.306) (-1749.725) [-1747.264] -- 0:00:41
      369500 -- (-1751.451) (-1751.953) [-1750.891] (-1752.476) * [-1751.408] (-1750.097) (-1748.229) (-1748.138) -- 0:00:40
      370000 -- (-1749.269) [-1751.498] (-1748.193) (-1754.802) * (-1749.424) (-1748.724) (-1752.729) [-1748.507] -- 0:00:40

      Average standard deviation of split frequencies: 0.011128

      370500 -- (-1748.007) [-1750.187] (-1749.433) (-1751.269) * [-1748.709] (-1749.343) (-1750.672) (-1749.745) -- 0:00:40
      371000 -- (-1748.449) (-1749.431) (-1748.659) [-1748.974] * (-1747.840) (-1754.060) (-1750.631) [-1750.731] -- 0:00:40
      371500 -- (-1748.603) (-1750.875) (-1748.867) [-1748.613] * (-1750.593) (-1749.272) (-1748.676) [-1748.221] -- 0:00:40
      372000 -- (-1748.298) (-1748.160) [-1750.118] (-1749.063) * [-1750.832] (-1750.091) (-1748.977) (-1747.705) -- 0:00:40
      372500 -- (-1752.707) (-1749.511) (-1750.226) [-1748.179] * (-1751.973) (-1750.590) [-1749.559] (-1748.755) -- 0:00:40
      373000 -- (-1750.143) [-1749.446] (-1748.468) (-1752.219) * (-1751.662) [-1751.503] (-1748.185) (-1750.187) -- 0:00:40
      373500 -- (-1748.765) (-1749.696) [-1748.145] (-1747.430) * (-1755.034) (-1750.745) (-1748.281) [-1749.253] -- 0:00:40
      374000 -- [-1748.679] (-1748.878) (-1747.957) (-1750.608) * (-1750.979) (-1748.922) (-1747.957) [-1750.826] -- 0:00:40
      374500 -- [-1747.590] (-1749.733) (-1748.049) (-1751.381) * (-1749.025) (-1752.220) [-1747.962] (-1751.246) -- 0:00:40
      375000 -- (-1747.991) (-1751.274) [-1747.185] (-1747.693) * (-1752.915) (-1750.476) [-1748.543] (-1749.831) -- 0:00:40

      Average standard deviation of split frequencies: 0.011136

      375500 -- [-1748.178] (-1751.614) (-1748.449) (-1749.881) * (-1756.154) [-1751.052] (-1749.956) (-1748.614) -- 0:00:39
      376000 -- (-1749.786) (-1751.975) (-1750.128) [-1750.259] * [-1750.018] (-1749.388) (-1749.261) (-1748.350) -- 0:00:39
      376500 -- (-1749.588) [-1748.653] (-1752.398) (-1748.906) * (-1748.769) (-1750.925) [-1752.777] (-1748.098) -- 0:00:41
      377000 -- (-1748.791) [-1747.756] (-1753.448) (-1746.773) * [-1748.255] (-1748.264) (-1754.252) (-1751.926) -- 0:00:41
      377500 -- (-1747.696) [-1749.653] (-1757.454) (-1748.414) * [-1747.877] (-1747.690) (-1748.190) (-1749.831) -- 0:00:41
      378000 -- (-1747.586) (-1748.031) [-1753.057] (-1748.386) * [-1747.781] (-1750.010) (-1747.700) (-1750.092) -- 0:00:41
      378500 -- [-1749.649] (-1756.022) (-1749.132) (-1754.049) * (-1747.968) (-1750.579) (-1748.400) [-1749.748] -- 0:00:41
      379000 -- (-1747.653) (-1749.020) [-1748.784] (-1750.301) * (-1752.096) (-1752.467) [-1749.393] (-1749.422) -- 0:00:40
      379500 -- [-1747.433] (-1755.122) (-1750.774) (-1752.542) * [-1748.189] (-1754.628) (-1748.182) (-1747.740) -- 0:00:40
      380000 -- (-1748.944) [-1752.078] (-1752.123) (-1756.366) * (-1750.483) (-1749.739) (-1748.971) [-1748.021] -- 0:00:40

      Average standard deviation of split frequencies: 0.011455

      380500 -- [-1747.403] (-1749.859) (-1750.644) (-1747.851) * (-1750.095) (-1748.991) (-1747.888) [-1747.764] -- 0:00:40
      381000 -- [-1748.970] (-1753.452) (-1749.664) (-1750.506) * (-1748.771) [-1749.128] (-1749.990) (-1748.211) -- 0:00:40
      381500 -- (-1750.959) (-1749.593) (-1747.446) [-1748.062] * [-1747.717] (-1748.543) (-1749.857) (-1748.663) -- 0:00:40
      382000 -- [-1749.254] (-1749.244) (-1747.294) (-1747.640) * [-1749.535] (-1748.687) (-1749.930) (-1748.929) -- 0:00:40
      382500 -- (-1749.264) (-1751.090) (-1747.598) [-1747.925] * (-1749.856) [-1749.608] (-1750.578) (-1747.847) -- 0:00:40
      383000 -- (-1750.911) (-1749.249) (-1750.564) [-1748.831] * [-1749.980] (-1750.007) (-1755.573) (-1750.377) -- 0:00:40
      383500 -- (-1748.968) (-1751.323) [-1747.664] (-1749.895) * (-1750.592) [-1747.922] (-1756.008) (-1748.073) -- 0:00:40
      384000 -- (-1749.723) (-1749.812) [-1748.037] (-1750.193) * (-1751.553) (-1746.896) (-1751.179) [-1747.713] -- 0:00:40
      384500 -- [-1749.207] (-1751.877) (-1751.066) (-1750.030) * (-1748.317) (-1747.184) [-1749.515] (-1748.124) -- 0:00:40
      385000 -- (-1755.598) (-1749.410) (-1747.591) [-1748.279] * (-1748.742) [-1746.917] (-1750.958) (-1748.528) -- 0:00:39

      Average standard deviation of split frequencies: 0.012069

      385500 -- (-1751.547) [-1747.294] (-1748.095) (-1747.672) * (-1750.108) (-1749.047) (-1751.801) [-1748.528] -- 0:00:39
      386000 -- (-1749.187) (-1748.215) (-1752.690) [-1748.808] * [-1751.775] (-1749.182) (-1748.399) (-1748.286) -- 0:00:39
      386500 -- [-1747.876] (-1749.486) (-1748.786) (-1747.533) * (-1748.301) (-1749.283) [-1747.378] (-1749.455) -- 0:00:39
      387000 -- [-1747.974] (-1751.364) (-1749.009) (-1747.579) * (-1748.500) (-1750.917) [-1748.830] (-1749.476) -- 0:00:39
      387500 -- (-1748.943) (-1751.314) (-1748.256) [-1751.200] * (-1748.498) [-1747.586] (-1749.349) (-1748.132) -- 0:00:39
      388000 -- (-1752.201) (-1747.193) [-1752.100] (-1751.104) * (-1748.950) (-1747.872) (-1751.989) [-1748.280] -- 0:00:39
      388500 -- [-1748.012] (-1747.203) (-1756.871) (-1750.807) * (-1752.205) (-1748.073) [-1750.186] (-1747.979) -- 0:00:39
      389000 -- [-1750.806] (-1751.127) (-1748.739) (-1748.721) * (-1755.237) (-1751.329) (-1750.973) [-1748.651] -- 0:00:39
      389500 -- (-1748.605) (-1751.360) (-1747.975) [-1749.668] * (-1750.116) (-1752.048) [-1751.082] (-1749.748) -- 0:00:39
      390000 -- (-1748.636) (-1748.722) [-1749.463] (-1747.448) * [-1750.025] (-1749.294) (-1748.446) (-1749.968) -- 0:00:39

      Average standard deviation of split frequencies: 0.012635

      390500 -- (-1749.419) [-1749.216] (-1751.567) (-1749.049) * [-1746.891] (-1748.582) (-1750.459) (-1752.048) -- 0:00:39
      391000 -- (-1749.893) (-1748.903) (-1748.868) [-1747.061] * (-1746.823) (-1748.972) (-1749.534) [-1747.757] -- 0:00:38
      391500 -- (-1753.901) [-1749.492] (-1748.063) (-1748.669) * (-1751.007) [-1747.468] (-1753.477) (-1747.636) -- 0:00:38
      392000 -- (-1750.900) (-1751.285) [-1750.571] (-1747.936) * (-1748.577) [-1748.483] (-1750.542) (-1747.379) -- 0:00:40
      392500 -- [-1747.869] (-1749.728) (-1750.772) (-1753.372) * (-1748.986) (-1748.399) (-1748.175) [-1748.342] -- 0:00:40
      393000 -- (-1748.766) [-1750.405] (-1750.803) (-1750.715) * [-1749.090] (-1748.386) (-1749.369) (-1748.226) -- 0:00:40
      393500 -- [-1747.909] (-1751.304) (-1750.592) (-1751.180) * (-1747.464) [-1748.846] (-1751.731) (-1751.356) -- 0:00:40
      394000 -- (-1754.594) [-1747.345] (-1749.549) (-1757.578) * (-1749.288) (-1749.272) [-1747.872] (-1755.128) -- 0:00:39
      394500 -- (-1751.796) (-1748.953) [-1748.439] (-1753.551) * (-1750.166) [-1747.169] (-1748.580) (-1749.749) -- 0:00:39
      395000 -- (-1751.425) (-1750.100) (-1747.781) [-1748.680] * (-1751.925) (-1747.758) [-1748.212] (-1748.789) -- 0:00:39

      Average standard deviation of split frequencies: 0.013235

      395500 -- (-1748.108) (-1747.900) [-1746.949] (-1749.885) * (-1751.104) [-1747.883] (-1747.670) (-1747.873) -- 0:00:39
      396000 -- (-1749.133) (-1747.888) (-1747.667) [-1749.377] * [-1747.245] (-1749.134) (-1748.627) (-1747.654) -- 0:00:39
      396500 -- [-1750.548] (-1754.421) (-1747.610) (-1749.479) * (-1747.431) (-1750.020) (-1750.685) [-1749.978] -- 0:00:39
      397000 -- (-1752.817) (-1751.725) [-1748.042] (-1752.181) * (-1747.430) (-1750.171) (-1747.046) [-1748.576] -- 0:00:39
      397500 -- (-1751.288) (-1749.573) [-1749.923] (-1749.502) * (-1747.433) (-1749.683) [-1748.698] (-1751.507) -- 0:00:39
      398000 -- (-1748.475) [-1747.773] (-1747.897) (-1753.264) * [-1748.608] (-1752.018) (-1749.463) (-1749.958) -- 0:00:39
      398500 -- (-1749.220) [-1747.599] (-1750.626) (-1751.308) * (-1747.375) (-1749.863) (-1748.434) [-1749.948] -- 0:00:39
      399000 -- [-1748.620] (-1747.629) (-1748.588) (-1747.887) * (-1747.610) [-1751.317] (-1750.673) (-1749.897) -- 0:00:39
      399500 -- (-1749.895) (-1748.457) [-1748.750] (-1751.216) * (-1748.270) (-1749.568) (-1753.013) [-1747.487] -- 0:00:39
      400000 -- (-1748.426) [-1747.495] (-1750.897) (-1749.545) * (-1749.570) (-1752.288) [-1751.289] (-1747.394) -- 0:00:39

      Average standard deviation of split frequencies: 0.013080

      400500 -- (-1749.259) [-1747.970] (-1747.611) (-1749.042) * (-1749.245) [-1750.629] (-1750.266) (-1747.377) -- 0:00:38
      401000 -- [-1751.198] (-1754.091) (-1748.198) (-1748.441) * (-1750.664) (-1749.560) (-1749.674) [-1748.229] -- 0:00:38
      401500 -- (-1749.042) (-1750.978) (-1750.138) [-1750.666] * (-1749.469) (-1747.526) [-1751.272] (-1749.017) -- 0:00:38
      402000 -- (-1748.949) (-1750.068) [-1750.094] (-1748.753) * [-1751.931] (-1750.392) (-1748.296) (-1748.331) -- 0:00:38
      402500 -- [-1748.661] (-1749.773) (-1748.061) (-1748.817) * (-1749.966) [-1747.595] (-1747.369) (-1749.519) -- 0:00:38
      403000 -- (-1747.973) (-1748.793) [-1753.228] (-1749.620) * (-1749.098) (-1751.516) [-1747.896] (-1749.385) -- 0:00:38
      403500 -- (-1749.334) (-1749.700) (-1750.387) [-1748.612] * (-1749.931) (-1749.577) (-1748.867) [-1749.370] -- 0:00:38
      404000 -- (-1749.500) (-1751.344) (-1748.823) [-1748.537] * (-1750.283) (-1750.932) (-1747.192) [-1749.291] -- 0:00:38
      404500 -- (-1747.959) (-1748.609) [-1749.237] (-1749.334) * (-1751.112) [-1747.403] (-1748.911) (-1747.012) -- 0:00:38
      405000 -- (-1748.494) [-1747.069] (-1749.985) (-1748.810) * (-1748.953) (-1749.881) [-1750.899] (-1750.769) -- 0:00:38

      Average standard deviation of split frequencies: 0.013250

      405500 -- (-1750.110) [-1749.197] (-1749.916) (-1747.838) * [-1748.013] (-1747.656) (-1751.114) (-1751.257) -- 0:00:38
      406000 -- (-1748.753) (-1749.795) (-1750.467) [-1754.168] * [-1748.526] (-1748.082) (-1751.692) (-1750.814) -- 0:00:38
      406500 -- (-1750.708) [-1748.058] (-1748.537) (-1747.506) * (-1749.569) (-1748.801) [-1748.087] (-1747.043) -- 0:00:37
      407000 -- [-1757.005] (-1748.158) (-1751.663) (-1747.505) * [-1751.213] (-1747.456) (-1750.574) (-1747.059) -- 0:00:37
      407500 -- (-1750.051) [-1749.381] (-1750.023) (-1750.249) * (-1753.979) (-1747.863) [-1748.669] (-1747.023) -- 0:00:39
      408000 -- (-1748.610) [-1750.602] (-1747.748) (-1753.008) * (-1751.226) [-1748.700] (-1748.174) (-1747.898) -- 0:00:39
      408500 -- [-1749.807] (-1750.056) (-1749.133) (-1748.136) * (-1751.971) [-1748.391] (-1748.632) (-1748.316) -- 0:00:39
      409000 -- (-1750.944) [-1747.794] (-1749.459) (-1747.478) * (-1752.338) (-1749.382) (-1750.751) [-1747.354] -- 0:00:39
      409500 -- (-1751.405) (-1752.536) (-1748.166) [-1748.357] * (-1752.898) (-1747.178) (-1750.435) [-1747.028] -- 0:00:38
      410000 -- (-1749.241) (-1750.460) (-1748.529) [-1753.154] * (-1752.063) (-1749.751) (-1752.421) [-1747.507] -- 0:00:38

      Average standard deviation of split frequencies: 0.012699

      410500 -- (-1748.466) (-1748.451) [-1748.709] (-1748.632) * [-1748.239] (-1748.552) (-1754.020) (-1747.466) -- 0:00:38
      411000 -- (-1749.718) (-1749.529) [-1748.486] (-1748.719) * (-1750.906) (-1748.289) (-1749.044) [-1748.283] -- 0:00:38
      411500 -- (-1749.213) (-1748.045) (-1750.496) [-1747.422] * (-1749.932) (-1750.648) (-1749.717) [-1748.462] -- 0:00:38
      412000 -- (-1748.829) (-1747.506) [-1747.693] (-1747.556) * (-1750.252) (-1747.559) (-1748.360) [-1747.912] -- 0:00:38
      412500 -- (-1750.078) (-1750.429) (-1753.366) [-1754.260] * (-1748.918) (-1749.961) [-1750.603] (-1751.993) -- 0:00:38
      413000 -- (-1750.429) (-1750.016) [-1748.850] (-1748.990) * (-1748.159) (-1747.670) [-1752.908] (-1752.235) -- 0:00:38
      413500 -- (-1748.535) (-1749.300) (-1748.969) [-1751.149] * (-1747.531) [-1747.705] (-1748.160) (-1753.045) -- 0:00:38
      414000 -- (-1748.218) (-1749.470) [-1752.900] (-1749.859) * (-1749.114) [-1747.179] (-1748.041) (-1747.713) -- 0:00:38
      414500 -- (-1748.051) (-1750.038) [-1747.719] (-1751.221) * (-1749.931) [-1747.878] (-1748.752) (-1748.773) -- 0:00:38
      415000 -- (-1748.576) [-1749.347] (-1747.517) (-1749.095) * (-1749.275) (-1748.384) (-1749.783) [-1748.770] -- 0:00:38

      Average standard deviation of split frequencies: 0.012607

      415500 -- (-1748.392) (-1749.199) [-1749.593] (-1749.941) * (-1748.554) [-1748.474] (-1749.802) (-1748.960) -- 0:00:37
      416000 -- (-1748.502) (-1748.706) (-1748.491) [-1748.254] * (-1747.653) (-1748.188) [-1749.233] (-1750.063) -- 0:00:37
      416500 -- (-1750.116) (-1748.195) [-1756.026] (-1750.401) * (-1752.360) [-1748.787] (-1749.282) (-1750.473) -- 0:00:37
      417000 -- [-1749.443] (-1748.325) (-1752.793) (-1748.786) * [-1752.012] (-1750.178) (-1751.068) (-1753.562) -- 0:00:37
      417500 -- [-1749.443] (-1754.582) (-1748.031) (-1751.977) * [-1749.430] (-1750.216) (-1749.442) (-1749.198) -- 0:00:37
      418000 -- (-1752.815) [-1754.347] (-1748.230) (-1748.002) * (-1749.532) [-1747.937] (-1751.230) (-1748.439) -- 0:00:37
      418500 -- (-1754.475) [-1751.863] (-1748.902) (-1748.880) * (-1747.537) [-1747.234] (-1751.394) (-1747.611) -- 0:00:37
      419000 -- (-1747.278) (-1750.308) [-1749.352] (-1748.424) * (-1747.443) [-1747.576] (-1749.715) (-1749.791) -- 0:00:37
      419500 -- (-1752.211) [-1748.192] (-1749.615) (-1750.116) * (-1748.729) (-1747.035) (-1748.550) [-1747.023] -- 0:00:37
      420000 -- (-1750.805) (-1748.983) (-1750.524) [-1749.003] * (-1748.728) (-1752.182) (-1749.347) [-1747.358] -- 0:00:37

      Average standard deviation of split frequencies: 0.012887

      420500 -- (-1753.466) (-1750.117) [-1747.030] (-1749.850) * [-1747.493] (-1750.647) (-1748.422) (-1748.488) -- 0:00:37
      421000 -- (-1747.468) (-1753.200) (-1749.695) [-1749.927] * [-1749.866] (-1753.257) (-1749.281) (-1748.614) -- 0:00:37
      421500 -- (-1749.765) (-1753.117) (-1749.138) [-1748.596] * (-1747.512) (-1748.906) (-1747.527) [-1750.361] -- 0:00:37
      422000 -- [-1748.477] (-1750.100) (-1749.138) (-1752.119) * (-1747.274) [-1746.759] (-1748.459) (-1749.030) -- 0:00:36
      422500 -- (-1747.904) (-1749.849) [-1750.763] (-1752.241) * [-1750.355] (-1746.759) (-1748.352) (-1750.689) -- 0:00:36
      423000 -- (-1749.669) [-1748.702] (-1748.194) (-1753.313) * (-1747.115) (-1748.247) (-1748.247) [-1748.779] -- 0:00:38
      423500 -- (-1754.100) (-1752.137) (-1758.604) [-1748.474] * (-1747.638) (-1749.022) [-1749.520] (-1754.281) -- 0:00:38
      424000 -- (-1749.681) (-1748.355) [-1750.012] (-1750.984) * (-1751.852) (-1749.321) [-1749.339] (-1750.194) -- 0:00:38
      424500 -- (-1748.017) (-1747.391) (-1748.971) [-1748.224] * (-1749.716) [-1748.985] (-1751.296) (-1751.051) -- 0:00:37
      425000 -- (-1747.333) [-1747.035] (-1748.212) (-1747.423) * (-1748.017) (-1751.545) [-1750.406] (-1749.076) -- 0:00:37

      Average standard deviation of split frequencies: 0.013348

      425500 -- [-1748.108] (-1749.417) (-1749.835) (-1749.786) * [-1754.006] (-1747.719) (-1751.416) (-1751.083) -- 0:00:37
      426000 -- (-1747.615)